CLUSTAL format seed alignment for MF_01565

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

ZNTB_ECOL6      MEAIKGSDVNVPDAVFAWMLDGRGGVKPLENTDVIDEAHPCWLHLNYVHHDSAQWLATTP
ZNTB_ECO57      MEAIKGSDVNVPDAVFAWMLDGRGGVKPLENTDVIDEAHPCWLHLNYVHHDSAQWLATTP
ZNTB_ECOLI      MEAIKGSDVNVPDAVFAWMLDGRGGVKPLENTDVIDEAHPCWLHLNYVHHDSAQWLATTP
ZNTB_SHIDS      MEAIKGSDVNVPDAVFAWMLDGRGGVKPLENTDVIDEAHPCWLHLNYVHHDSAQWLATTP
ZNTB_SHIBS      MEAIKGSDVNVPDAVFAWMLDGRGGVKPLENTDVIDEAHPCWLHLNYVHHDSAQWLATTP
ZNTB_SHISS      MEAIKGSDVNVPDAVFAWMLDGRGGVKPLENTDVIDEAHPCWLHLNYVHHDSAQWLATTP
ZNTB_SHIFL      MEAIKGSDVNVPDAVFAWMLDGRGGVKPLENTDVIDEAHPCWLHLNYVHHDSAQWLATTP
ZNTB_SALPA      MEAIKGSDVNVPDAVFAWLLDGRGGVKPLEDNDVIDSQHPCWLHLNYTHPDSARWLASTP
ZNTB_SALTY      MEAIKGSDVNVPDAVFAWLLDGRGGVKPLEDNDVIDSQHPCWLHLNYTHPDSARWLASTP
ZNTB_SALTI      MEAIKGSDVNVPDAVFAWLLDGRGGVKPLEDNDVIDSQHPCWLHLNYTHPDSARWLASTP
ZNTB_SALCH      MEAIKGSDVNVPDAVFAWLLDGHGGVKPLEDNDVIDSQHPCWLHLNYTHPDSARWLASTP
ZNTB_PECAS      MESFAGKELQHSGAVHAYQLDGKGGITPIGEQDVVNSEKPCWLHLDSTVPASARWLNKTL
ZNTB_YERPE      MDVVEGKALQVSDAVYAYQLDGKGGMTAISVDAVASATQPCWLHLDYTYPESAEWLQNTP
ZNTB_YERPS      MDVVEGKALQVSDAVYAYQLDGKGGMTAISVDAVASATQPCWLHLDYTYPESAEWLQNTP
ZNTB_PHOLL      METIYGSSLKEADAVYACQFDGQGGMTPIDMNGVATPVQPFWQHLDYRNPKSYRWLMDTD
                *: . *. :: ..**.*  :**:**:..:    *    :* * **:     * .**  * 

ZNTB_ECOL6      LLPNNVRDALAGESTRPRVSRLGEGTLITLRCINGSTDERPDQLVAMRVYMDGRLIVSTR
ZNTB_ECO57      LLPNNVRDALAGESTRPRVSRLGEGTLITLRCINGSTDERPDQLVAMRVYMDGRLIVSTR
ZNTB_ECOLI      LLPNNVRDALAGESTRPRVSRLGEGTLITLRCINGSTDERPDQLVAMRVYMDGRLIVSTR
ZNTB_SHIDS      LLPNNVRDALAGESTRPRVSRLGEGTLITLRCINGSTDERPDQLVAMRVYMDGRLIVSTR
ZNTB_SHIBS      LLPNNVRDALAGESTRPRVSRLGEGTLITLRCINGSTDERPDQLVAMRVYMDGRLIVSTR
ZNTB_SHISS      LLPNNVRDALAGESTRPRVSRLGEGTLITLRCINGSTDERPDQLVAMRVYMDGRLIVSTR
ZNTB_SHIFL      LLPNNVRDALAGESTRPRVSRFGEGTLITLRCINGSTDERPDQLVAMRVYMDGRLIVSTR
ZNTB_SALPA      LLPNNVRDALAGESSRPRVSRMGEGTLITLRCINGSTDERPDQLVAMRLYMDERFIVSTR
ZNTB_SALTY      LLPNNVRDALAGESSRPRVSRMGEGTLITLRCINGSTDERPDQLVAMRLYMDERFIVSTR
ZNTB_SALTI      LLPNNVRDALAGESSRPRVSRMGEGTLITLRCINGSTDERPDQLVAMRLYMDERFIVSTR
ZNTB_SALCH      LLPNNVRDALAGESSRPRVSRMGEGTLITLRCINGSTDERPDQLVAMRLYMDERFIVSTR
ZNTB_PECAS      VVPDSVRTALAGESVRPRVTRLGEGTLITLRSINLNANARPDQLVAVRVFITDKLIISTR
ZNTB_YERPE      LLPEVVRDGLAGESMRPKITRLGDGTMITLRGINFNNDARPDQLVTIRVYMTDKLIVSTR
ZNTB_YERPS      LLPEVVRDGLAGESMRPKITRLGDGTMITLRGINFNNDARPDQLVTIRVYMTDKLIVSTR
ZNTB_PHOLL      LLPETVKAGLAGESLRPKIMRTGDGTMITFRTINNSESERPDQLVVFRIYINSQIVISSR
                ::*: *: .***** **:: * *:**:**:* ** . . ******..*:::  ::::*:*

ZNTB_ECOL6      QRKVLALDDVVSDLEEGTGPTDCGGWLVDVCDALTDHSSEFIEQLHDKIIDLEDNLLDQQ
ZNTB_ECO57      QRKVLALDDVVSDLEEGTGPTDCGGWLVDVCDALTDHSSEFIEQLHDKIIDLEDNLLDQQ
ZNTB_ECOLI      QRKVLALDDVVSDLEEGTGPTDCGGWLVDVCDALTDHSSEFIEQLHDKIIDLEDNLLDQQ
ZNTB_SHIDS      QRKVLALDDVVSDLEEGTGPTDCGGWLVDVCDALTDHSSEFIEQLHDKIIDLEDNLLDQQ
ZNTB_SHIBS      QRKVLALDDVVSDLEEGTGPTDCGGWLVDVCDALTDHSSEFIEQLHDKIIDLEDNLLDQQ
ZNTB_SHISS      QRKVLALDDVVSDLEEGTGPTDCGGWLVDVCDALTDHSSEFIEQLHDKIIDLEDNLLDQQ
ZNTB_SHIFL      QRKVLALDDVVSDLEEGTGPTDCGGWLVDVCDALTDHSSEFIEQLHDKIIDLEDNLLDQQ
ZNTB_SALPA      QRKVLALDDVVSDLQEGTGPVDCGGWLVDVCDALTDHASEFIEELHDKIIDLEDNLLDQQ
ZNTB_SALTY      QRKVLALDDVVSDLQEGTGPVDCGGWLVDVCDALTDHASEFIEELHDKIIDLEDNLLDQQ
ZNTB_SALTI      QRKVLALDDVVSDLQEGTGPVDCGGWLVDVCDALTDHASEFIEELHDKIIDLEDNLLDQQ
ZNTB_SALCH      QRKVLALDDVVSDLQEGTGPVDCGGWLVDVCDALTDHASEFIEELHDKIIDLEDNLLDQQ
ZNTB_PECAS      RRKILAIDEILTDLKEGNGPTDSGNWLVSIAEALTDHTSEFIDDLHEKIIDLEDDLLEQK
ZNTB_YERPE      HRKVYSIDNVLNDLQSGTGPTGSGHWLVDIADGLTDHTSEFIEDLHDKIIDLEDDLMEQK
ZNTB_YERPS      HRKVYSIDNVLNDLQSGTGPTGSGHWLVDIADGLTDHTSEFIEDLHDKIIDLEDDLMEQK
ZNTB_PHOLL      HRKVHSLEQVLSDLQNGIGAKTTGHWLVEMVDAITDEVGNFIEDLHDNLIELENMILEQR
                :**: ::::::.**:.* *.   * ***.: :.:**. .:**::**:::*:**: :::*:

ZNTB_ECOL6      IPPRGFLALLRKQLIVMRRYMAPQRDVYARLASERLPWMSDDQRRRMQDIADRLGRGLDE
ZNTB_ECO57      IPPRGFLALLRKQLIVMRRYMAPQRDVYARLASERLPWMSDDQRRRMQDIADRLGRGLDE
ZNTB_ECOLI      IPPRGFLALLRKQLIVMRRYMAPQRDVYARLASERLPWMSDDQRRRMQDIADRLGRGLDE
ZNTB_SHIDS      IPPRGFLALLRKQLIVMRRYMAPQRDVYARLASERLPWMSDDQRRRMQDIADRLGRGLDE
ZNTB_SHIBS      IPPRGFLALLRKQLIVMRRYMAPQRDVYARLASERLPWMSDDQRRRMQDIADRLGRGLDE
ZNTB_SHISS      IPPRGFLALLRKQLIVMRRYMAPQRDVYARLASERLPWMSDDQRRRMQDIADRLGRGLDE
ZNTB_SHIFL      IPPRGFLALLRKQLIVMRRYMAPQRDVYARLASERLPWMSDDQRRRMQDIADRLGRGLDE
ZNTB_SALPA      IPPRGFLALLRKQLIVMRRYMAPQRDVYARLASERLPWMSDDHRRRMQDIADRLGRGLDE
ZNTB_SALTY      IPPRGFLALLRKQLIVMRRYMAPQRDVYARLASERLPWMSDDHRRRMQDIADRLGRGLDE
ZNTB_SALTI      IPPRGFLALLRKQLIVMRRYMAPQRDVYARLASERLPWMSDDHRRRMQDIADRLGRGLDE
ZNTB_SALCH      IPPRGFLALLRKQLIVMRRYMAPQRDVYARLASERLPWMSDDHRRRMQDIADRLGRGLDE
ZNTB_PECAS      IPPRGELALIRKQLIVLRRYMTPQRDVFSRISGEKLPWMQDDDRRRMQEIADRLGRGLED
ZNTB_YERPE      VPPRGQMALLRKQLIVLRRYMAPQRDVFSRLASERLPWMNDDDRRRMQEISERLGRGLED
ZNTB_YERPS      VPPRGQMALLRKQLIVLRRYMAPQRDVFSRLASERLPWMNDDDRRRMQEISERLGRGLED
ZNTB_PHOLL      IPGRGGLALLRKQLIILRRYMAPQRDVFARLASEKLLWMSDEDRYRMQEISDRLGRELDD
                :* ** :**:*****::****:*****::*::.*:* **.*:.* ***:*::**** *::

ZNTB_ECOL6      IDACIARTGVMADEIAQVMQENLARRTYTMSLMAMVFLPSTFLTGLFGVNLGGIPGGGWQ
ZNTB_ECO57      IDACIARTGVMADEIAQVMQENLARRTYTMSLMAMVFLPSTFLTGLFGVNLGGIPGGGWQ
ZNTB_ECOLI      IDACIARTGVMADEIAQVMQENLARRTYTMSLMAMVFLPSTFLTGLFGVNLGGIPGGGWQ
ZNTB_SHIDS      IDACIARTGVMADEIAQVMQENLARRTYTMSLMAMVFLPSTFLTGLFGVNLGGIPGGGWQ
ZNTB_SHIBS      IDACIARTGVMADEIAQVMQENLARRTYTMSLMAMVFLPSTFLTGLFGVNLGGIPGGGWQ
ZNTB_SHISS      IDACIARTGVMADEIAQVMQENLARRTYTMSLMAMVFLPSTFLTGLFGVNLGGIPGGGWQ
ZNTB_SHIFL      IDACIARTGVMADEIAQVMQENLARRTYTMSLMAMVFLPSTFLTGLFGVNLGGIPGGGWQ
ZNTB_SALPA      IDACIARTGIMADEIAQVMQESLARRTYTMSLMAMVFLPSTFLTGLFGVNLGGIPGGGWR
ZNTB_SALTY      IDACIARTGIMADEIAQVMQESLARRTYTMSLMAMVFLPSTFLTGLFGVNLGGIPGGGWR
ZNTB_SALTI      IDACIARTGIMADEIAQVMQESLARRTYTMSLMAMVFLPSTFFTGLFGVNLGGIPGGGWR
ZNTB_SALCH      IDACIARTGIMADEIAQVMQESLARRTYTMSLMAMVFLPSTFLTGLFGVNLGGIPGGGWR
ZNTB_PECAS      LDASVARTTVLSDEITALMTEAMNRRTYTMSLLAMVFLPTTFLTGLFGVNLGGIPGGDAP
ZNTB_YERPE      LDGSIARTAVLSDEISSLMADAMNRRTYTMSLLAMVFLPTTFLTGLFGVNLGGIPGNTDA
ZNTB_YERPS      LDGSIARTAVLSDEISSLMADAMNRRTYTMSLLAMVFLPTTFLTGLFGVNLGGIPGNTDA
ZNTB_PHOLL      LDGCIARTAIISDEITSMMADAMNRRTYTMSLLAMIFLPTTFLTGLFGVNLGGIPGNEYY
                :*..:*** :::***: :* : : ********:**:***:**:*************.   

ZNTB_ECOL6      FGFSIFCILLVVLIGGVALWLHRSKWL
ZNTB_ECO57      FGFSIFCILLVVLIGGVALWLHRSKWL
ZNTB_ECOLI      FGFSIFCILLVVLIGGVALWLHRSKWL
ZNTB_SHIDS      FGFSIFCILLVVLIGGVALWLHRSKWL
ZNTB_SHIBS      FGFSIFCILLVVLIGGVALWLHRSKWL
ZNTB_SHISS      FGFSIFCILLVVLIGGVALWLHRSKWL
ZNTB_SHIFL      FGFSIFCILLVVLIGGVALWLHRSKWL
ZNTB_SALPA      FGFSLFCILLVVLIGGVTLWLHRSKWL
ZNTB_SALTY      FGFSLFCILLVVLIGGVTLWLHRSKWL
ZNTB_SALTI      FGFSLFCILLVVLIGGVTLWLHRSKWL
ZNTB_SALCH      FGFSLFCILLVVLIGGVTLWLHRSKWL
ZNTB_PECAS      FGFFTFCLMLVILVGGVAWWLKRSKWL
ZNTB_YERPE      FGFTIFCMMLVVLVLSVAWWLKRSKWL
ZNTB_YERPS      FGFTIFCMMLVVLVLSVAWWLKRSKWL
ZNTB_PHOLL      LGFAIFCLLLFGLVLFVAWWLKKSKWL
                :**  **::*. *:  *: **::****