CLUSTAL format seed alignment for MF_01568

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

Y1430_STRPF      ----MKLPKEGDFITIQSYKHDGSLHRTWRDTMVLKTTENALIGVNDHTLVTESDGRRWV
Y1362_STRPM      ----MKLPKEGDFITIQSYKHDGSLHRTWRDTMVLKTTENALIGVNDHTLVTESDGRRWV
Y1315_STRPC      ----MKLPKEGDFITIQSYKHDGSLHRTWRDTMVLKTTENALIGVNDHTLVTESDGRRWV
Y1437_STRPD      ----MKLPKEGDFITIQSYKHDGSLHRTWRDTMVLKTTENALIGVNDHTLVTESDGRRWV
Y1617_STRP8      ----MKLPKEGDFITIQSYKHDGSLHRTWRDTMVLKTTENALIGVNDHTLVTESDGRRWV
Y1342_STRPB      ----MKLPKEGDFITIQSYKHDGSLHRTWRDTMVLKTTENALIGVNDHTLVTESDGRRWV
Y1608_STRP1      ----MKLPKEGDFITIQSYKHDGSLHRTWRDTMVLKTTENALIGVNDHTLVTESDGRRWV
Y1367_STRP6      ----MKLPKEGDFITIQSYKHDGSLHRTWRDTMVLKTTENALIGVNDHTLVTESDGRRWV
Y1356_STRP3      ----MKLPKEGDFITIQSYKHDGSLHRTWRDTMVLKTTENALIGVNDHTLVTESDGRRWV
Y374_STRT1       ----MKLPKEGDFITIQSYKHDGRLHRTWRDTMVLKTTENAVIGVNDHTLVTEADGRRWV
Y374_STRT2       ----MKLPKEGDFITIQSYKHDGRLHRTWRDTMVLKTTENAVIGVNDHTLVTEADGRRWV
Y1781_STRMU      ----MKLPKEGDFITIQSYKHDGSLHRTWRDTMVLKTTENAVIGVNDHTLVTESDGRRWV
Y1903_STRPN      ----MKLPKEGDFITIQSYKHDGSLHRTWRDTMVLKTTENAIIGVNDHTLVTESDGRRWV
Y1719_STRR6      ----MKLPKEGDFITIQSYKHDGSLHRTWRDTMVLKTTENAIIGVNDHTLVTESDGRRWV
Y492_STRA1       ----MRLPKEGDFITIQSYKHDGSLHRTWRDTMVLKTTENALIGVNDHTLVTENDGRRWV
Y446_STRA3       ----MRLPKEGDFITIQSYKHDGSLHRTWRDTMVLKTTENALIGVNDHTLVTENDGRRWV
Y411_STRA5       ----MRLPKEGDFITIQSYKHDGSLHRTWRDTMVLKTTENALIGVNDHTLVTENDGRRWV
Y370_LIGS1       -MMNISGPREGDFITIKSYKHDGSLHRTWRDTMVLKTSENALIGCNDHTLVTESDGRRWI
Y1475_LATSS      ----MNAPKEGDYIAIQSYKHDGSLHRTWRDTMVLKTSENAVIGCNDHTLVTESDGRKWV
Y1241_LACPL      MAREAKGPKEGDFITIKSYKHDGSLHRTWRDTMVLKTSENVLIGCNDHTLVTEDDGRRWV
Y697_ENTFA       ----MGIPKEGEFVTIQSYKHDGHLHRTWRDTMVLKTSEYSLIGVNDHTLVTESDGRRWV
YJJG_LACLA       ----MKIPKEGDFITIQSYKHDGNLHRTWRDTMVLKTNENSIIGVNDHTLVTESDDRRWV
Y1604_LACJO      ----MEMPREGDYIAIQSYKHNGTLHRNWRDTMVVKTEQNIIIGVNDRTLITEEDGRKWI
Y582_BACC1       ----MGFPKEGEKVQIHSYKHNGSIHRMWEETTILKGTQSLVIGANDRTVVTESDGRTWI
Y434_BACCZ       ----MGFPKEGEKVQIHSYKHNGSIHRMWEETTILKGTQSLVIGANDRTVVTESDGRTWI
Y438_BACHK       ----MGFPKEGEKVQIHSYKHNGSIHRMWEETTILKGTQSLVIGANDRTVVTESDGRTWI
Y527_BACAN       ----MGFPKEGEKVQIHSYKHNGSIHRMWKETTILKGTQSLVIGANDRTVVTESDGRTWI
Y508_BACCR       ----MGFPKEGEKVQIHSYKHNGSIHRMWEETTILKGTQSLVIGANDRTVVTESDGRTWI
Y890_BACLD       ----MGFPKEGETIQIHSYKHNGQIHRIWNETTILKATELCIIGANDRTMVTESDGRTWV
YGAC_BACSU       ----MGYPKEGETIQIHSYKHNGLIHRIWNETTILKSTEMCVIGANDRTMVTESDGRTWI
Y940_ALKHC       ----MNFPKVGSKIQIQSYKHNGSIHRIWEETIVLKGTSKVVIGGNDRILVKESDGRHWR
Y1315_ALKCK      ----MSFPKEGSTIQIHSYKHNGKLHRIWEDTIVLKGTSKVVVAGNDRIIVREADGRNWR
Y899_OCEIH       ----MVSPNAGSKVSIQSYKHNGQLHRTWENSVILKGTESVVIGANDRTKVIESDGRSWI
Y468_GEOKA       ---MPVYPREGKIIQIHSYKHNGTIHRIWQETVVLKGTPSYVIGGNNKTLVMEADGRTWV
Y1848_STAA3      -MVRESIPKEGENIKIQSYKHDGKIHRVWSETTILKGTDHVVIGGNDHTLVTESDGRTWI
Y2004_STAA8      -MVRESIPKEGENIKIQSYKHDGKIHRVWSETTILKGTDHVVIGGNDHTLVTESDGRTWI
Y1800_STAAB      -MVRESIPKEGENIKIQSYKHDGKIHRVWSETTILKGTDHVVIGGNDHTLVTESDGRTWI
Y1925_STAAC      -MVRESIPKEGENIKIQSYKHDGKIHRVWSETTILKGTDHVVIGGNDHTLVTESDGRTWI
Y1867_STAAM      -MVRESIPKEGENIKIQSYKHDGKIHRVWSETTILKGTDHVVIGGNDHTLVTESDGRTWI
Y1684_STAAN      -MVRESIPKEGENIKIQSYKHDGKIHRVWSETTILKGTDHVVIGGNDHTLVTESDGRTWI
Y1807_STAAW      -MVRESIPKEGENIKIQSYKHDGKIHRVWSETTILKGTDHVVIGGNDHTLVTESDGRTWI
Y1957_STAAR      -MVRESIPKEGENIKIQSYKHDGKIHRVWSETTILKGTDHVVIGGNDHTLVTESDGRTWI
Y1789_STAAS      -MVRESIPKEGENIKIQSYKHDGKIHRVWSETTILKGTDHVVIGGNDHTLVTESDGRTWI
Y1405_STAEQ      -MVKESIPKEGENIKIQSYKHDGNIHRVWSETTILKGTEHVIIGGNDHTLVTESDGRTWI
Y1551_STAES      -MVKESIPKEGENIKIQSYKHDGNIHRVWSETTILKGTEHVIIGGNDHTLVTESDGRTWI
Y1094_STAHJ      -MVKESIPKEGENIKIQSYKHDGNIHRVWSETTILKGTDHVIIGGNDHTLVTESDGRTWI
Y926_STAS1       -MVKESIPKEGQTIKIQSYKHDGNIHRVWSETTILKGTEHVVIGGNDHTLVTESDSRTWI
Y1711_LISMF      ----MYLPKEKEIIQIKSYKHNGKLHRTWKKTVVLKSTENIIIGGNDHTLVVEADGRKWV
Y1687_LISMO      ----MYLPKEKEIIQIKSYKHNGKLHRTWKKTVVLKSTENIIIGGNDHTLVVEADGRKWV
Y1795_LISIN      ----MYLPKEKEIIQIKSYKHNGKLHRTWKKTVVLKSTENIIIGGNDHTLVVEADGRKWV
                        *.  . : *:****:* :** * .: ::*     ::. *::  : * *.* * 

Y1430_STRPF      TREPAIVYFHKKYWFNIIAMIRDNGVSYYCNLASPYMMDTEALKYIDYDLDVKVFADGEK
Y1362_STRPM      TREPAIVYFHKKYWFNIIAMIRDNGVSYYCNLASPYMMDTEALKYIDYDLDVKVFADGEK
Y1315_STRPC      TREPAIVYFHKKYWFNIIAMIRDNGVSYYCNLASPYMMDTEALKYIDYDLDVKVFADGEK
Y1437_STRPD      TREPAIVYFHKKYWFNIIAMIRDNGVSYYCNLASPYMMDTEALKYIDYDLDVKVFADGEK
Y1617_STRP8      TREPAIVYFHKKYWFNIIAMIRDNGVSYYCNLASPYMMDTEALKYIDYDLDVKVFADGEK
Y1342_STRPB      TREPAIVYFHKKYWFNIIAMIRDNGVSYYCNLASPYMMDTEALKYIDYDLDVKVFADGEK
Y1608_STRP1      TREPAIVYFHKKYWFNIIAMIRDNGVSYYCNLASPYMMDTEALKYIDYDLDVKVFADGEK
Y1367_STRP6      TREPAIVYFHKKYWFNIIAMIRDNGVSYYCNLASPYMMDTEALKYIDYDLDVKVFADGEK
Y1356_STRP3      TREPAIVYFHKKYWFNIIAMIRDNGVSYYCNLASPYMMDTEALKYIDYDLDVKVFADGEK
Y374_STRT1       TREPAIVYFHKKYWFNIIAMIRDNGISYYCNLASPYVLDQEALKYIDYDLDVKVFADGEK
Y374_STRT2       TREPAIVYFHKKYWFNIIAMIRDNGISYYCNLASPYVLDQEALKYIDYDLDVKVFADGEK
Y1781_STRMU      TREPAIVYFHKKFWFNIIAMIRDNGVSYYCNLASPYIMDQEALKYIDYDLDVKVFADGEK
Y1903_STRPN      TREPAIVYFHKKYWFNIIAMIRDNGTSYYCNMASPYYLDEEALKYIDYDLDVKIFTDGEK
Y1719_STRR6      TREPAIVYFHKKYWFNIIAMIRDNGTSYYCNMASPYYLDEEALKYIDYDLDVKIFTDGEK
Y492_STRA1       TREPAIVYFHKKYWFNIIAMIRETGVSYYCNLASPYILDPEALKYIDYDLDVKVFADGEK
Y446_STRA3       TREPAIVYFHKKYWFNIIAMIRETGVSYYCNLASPYILDPEALKYIDYDLDVKVFADGEK
Y411_STRA5       TREPAIVYFHKKYWFNIIAMIRETGVSYYCNLASPYILDPEALKYIDYDLDVKVFADGEK
Y370_LIGS1       TREPALVYFHKHYWFNIVTMIRENGVSYYCNLASPAVLDKEALKYIDYDLDVKVFPNGEK
Y1475_LATSS      TREPALIYFHKKYWFNVVAMIREGGVSYYCNLASPHVMDQEALKYIDYDLDVKVFPNGEK
Y1241_LACPL      TREPAIVYFHKHYWFNIVAMIRDNGVSYYCNLASPYVLDKEALKYIDYDLDVKVFPDGER
Y697_ENTFA       TREPAIVYFHKKYWFNIIAMIREKGVSYYCNLASPYVLDDEALKYIDYDLDIKVFPDGEK
YJJG_LACLA       TREPAIVYFHKKFWFNIIAMIREEGVSYYCNLASPFVLDNEALKYIDYDLDVKVFKDGEK
Y1604_LACJO      SREPAIVYFHRKLWFNVIAMLRPDGVAYYANLASPFILDREALKYIDYDLDIKVFPDGEK
Y582_BACC1       TREPAICYFHANYWFNVIGMLREEGVYYYCNLSSPFAYDSEALKYIDYDLDIKVYPDMTY
Y434_BACCZ       TREPAICYFHANYWFNVIGMLREEGVYYYCNLSSPFAYDSEALKYIDYDLDIKVYPDMTY
Y438_BACHK       TREPAICYFHANYWFNVIGMLREEGVYYYCNLSSPFAYDSEALKYIDYDLDIKVYPDMTY
Y527_BACAN       TREPAICYFHENYWFNVIGMLREEGVYYYCNLSSPFAYDSEALKYIDYDLDIKVYPDMTY
Y508_BACCR       TREPAICYFHANYWFNVIGMLREDGVYYYCNLSSPFAYDPEALKYIDYDLDIKVYPDMTY
Y890_BACLD       TREPAICYFHAKQWFNVIGMLREDGIYYYCNISSPFALDDEAIKYIDYDLDVKVFPDMTY
YGAC_BACSU       TREPAICYFHARQWFNVIGMLREDGVHYYCNISSPFAYDGEAIKYIDYDLDVKVFPDMTY
Y940_ALKHC       TREPAICYFDSEQWFNTIGMIRADGIYFYCNLGTPFTWDEEALKYIDYDLDIKVFPDMTF
Y1315_ALKCK      TREPAICYFDAEQWFNMICMLRADGIYYYCNLGTPFTWDEEALKYIDYDLDIKVYPDMTM
Y899_OCEIH       TREPAICYFHSKYWFNIIGMLRNDGIYYYCNISSPFVYDGEALKYIDYDLDVKVFPDMTF
Y468_GEOKA       TREPAICFFHAKHWFNIIAMIREDGVYYYCNLSSPFVWDEEALKYIDYDLDIKVFPDMTY
Y1848_STAA3      TREPAIVYFHSEYWFNVICMFREDGIYYYCNLSSPFVCDEEALKYIDYDLDIKVYPNGKY
Y2004_STAA8      TREPAIVYFHSEYWFNVICMFREDGIYYYCNLSSPFVCDEEALKYIDYDLDIKVYPNGKY
Y1800_STAAB      TREPAIVYFHSEYWFNVICMFREDGIYYYCNLSSPFVCDEEALKYIDYDLDIKVYPNGKY
Y1925_STAAC      TREPAIVYFHSEYWFNVICMFREDGIYYYCNLSSPFVCDEEALKYIDYDLDIKVYPNGKY
Y1867_STAAM      TREPAIVYFHSEYWFNVICMFREDGIYYYCNLSSPFVCDEEALKYIDYDLDIKVYPNGKY
Y1684_STAAN      TREPAIVYFHSEYWFNVICMFREDGIYYYCNLSSPFVCDEEALKYIDYDLDIKVYPNGKY
Y1807_STAAW      TREPAIVYFHSEYWFNVICMFREDGIYYYCNLSSPFVCDEEALKYIDYDLDIKVYPNGKY
Y1957_STAAR      TREPAIVYFHSEYWFNVICMFREDGIYYYCNLSSPFVCDEEALKYIDYDLDIKVYPNGKY
Y1789_STAAS      TREPAIVYFHSEYWFNVICMFREDGIYYYCNLSSPFVCDEEALKYIDYDLDIKVYPNGKY
Y1405_STAEQ      TREPAIVYFHSEYWFNVICMFREDGIYYYCNLSSPFACDEEALKYIDYDLDIKVYPNGKY
Y1551_STAES      TREPAIVYFHSEYWFNVICMFREDGIYYYCNLSSPFACDEEALKYIDYDLDIKVYPNGKY
Y1094_STAHJ      TREPAIVYFHSEFWFNVICMFREDGIYYYCNLSSPFVCDEEALKYIDYDLDIKVYPNGKY
Y926_STAS1       TREPAIVYFHSEFWFNVICMFREDGVYYYCNLSSPFVCDDEALKYIDYDLDIKVYPNGKY
Y1711_LISMF      TREPSICYFHSDYWFNVISMIREDGIYHYCNLGTPFAVDEQALKYIDYDLDIKVFPDGRF
Y1687_LISMO      TREPSICYFHSDYWFNVISMIREDGIYHYCNLGTPFAVDEQALKYIDYDLDIKVFPDGRF
Y1795_LISIN      TREPSICYFHSDYWFNVISMIREDGIYHYCNLGTPFAVDEQALKYIDYDLDIKVFPDGRF
                 :***:: :*.   *** : *:*  *  .*.*:.:*   * :*:********:*:: :   

Y1430_STRPF      RLLDVDEYEIHKKEMQYSADMDFILKENVKILVDWINHEKGPFSKAYITIWYKRYLELKN
Y1362_STRPM      RLLDVDEYEIHKKEMQYSADMDFILKENVKILVDWINHEKGPFSKAYITIWYKRYLELKN
Y1315_STRPC      RLLDVDEYEIHKKEMQYSADMDFILKENVKILVDWINHEKGPFSKAYITIWYKRYLELKN
Y1437_STRPD      RLLDVDEYEIHKKEMQYSADMDFILKENVKILVDWINHEKGPFSKAYITIWYKRYLELKN
Y1617_STRP8      RLLDVDEYEIHKKEMQYSADMDFILKENVKILVDWINHEKGPFSKAYITIWYKRYLELKN
Y1342_STRPB      RLLDVDEYEIHKKEMQYSADMDFILKENVKILVDWINHEKGPFSKAYITIWYKRYLELKN
Y1608_STRP1      RLLDVDEYEIHKKEMQYSADMDFILKENVKILVDWINHEKGPFSKAYITIWYKRYLELKN
Y1367_STRP6      RLLDVDEYEIHKKEMQYSADMDFILKENVKILVDWINHEKGPFSKAYITIWYKRYLELKN
Y1356_STRP3      RLLDVDEYGIHKKEMQYSADMDFILKENVKILVDWINHEKGPFSKAYITIWYKRYLELKN
Y374_STRT1       KLLDVDEYEIHKKEMHYSPDIDYILKEHVKILVDWINNGKGPFSQSYVNIWYKRYLELRN
Y374_STRT2       KLLDVDEYEIHKKEMHYSPDIDYILKEHVKILVDWINNGKGPFSQSYVNIWYKRYLELRN
Y1781_STRMU      KLLDVDEYELHKQKMGYSSDIDYILKENVKILVDWINNGKGPFSQSYINIWYKRYLELKN
Y1903_STRPN      RLLDVEEYERHKRKMNYSDDLDYILKEHVKILVDWINNGRGPFSEAYVNIWYKRYVELKN
Y1719_STRR6      RLLDVEEYERHKRKMNYSDDLDYILKEHVKILVDWINNGRGPFSEAYVNIWYKRYVELKN
Y492_STRA1       RLLDVDEYEQHKAQMNYPTDIDYILKENVKILVEWINENKGPFSSSYINIWYKRYLELKK
Y446_STRA3       RLLDVDEYEQHKAQMNYPTDIDYILKENVKILVEWINENKGPFSSSYINIWYKRYLELKK
Y411_STRA5       RLLDVDEYEQHKAQMNYPTDIDYILKENVKILVEWINENKGPFSSSYINIWYKRYLELKK
Y370_LIGS1       RLLDVDEYEDHGNKWHYSADIDKILKHNVRVLVDWINNGKGPFSKEYVEIWYNRYLELSR
Y1475_LATSS      RLLDVDEYEAHSAKWHYSAETDRILKANVKVLVDWINNGKGPFSKEYIDIWYNRYQELAH
Y1241_LACPL      RLLDVDEYEEHGAQWRYSADTDRILKANVKVLVDWIKNKKGPFSQDYIDIWYSRYQELSR
Y697_ENTFA       RLLDVDEYEFHSKLMDYPEDIDFILKENVKTLVDWINNEKGPFSPEYVDIWYQRYQQLSK
YJJG_LACLA       KLLDVEEYERHRRKMHYPKEIDHILKENVKILVDWINNEKGPFSKEYVEIWYNRYHQLKK
Y1604_LACJO      RLLDADEYAMNKKRWHYSEEIDSILRSTSFELLDWIDQKKGPFARKFVQIWYERYNQLRP
Y582_BACC1       TLLDEDEYEKHSQIMQYPPVIDTILKRNVAQLTQWIHQRKGPFAPDFVDMWYERYLMYRN
Y434_BACCZ       TLLDEDEYEKHSQIMQYPPVIDTILKRNVAQLTQWIHQRKGPFAPDFVDMWYERYLMYRN
Y438_BACHK       TLLDEDEYEKHSQIMQYPPVIDTILKRNVAQLTQWIHQRKGPFAPDFVDMWYERYLMYRN
Y527_BACAN       TLLDEDEYEKHSQIMQYPPVIDTILKRNVAQLTQWIHQRKGPFAPDFVDMWYERYLMYRN
Y508_BACCR       TLLDEDEYEKHSEIMQYPPVIDTILKRNVAHLTQWIHQRKGPFAPDFVDMWYERYLMYRN
Y890_BACLD       HILDEDEYADHKKAMNYPKEIDGILRYHLNTLLHWIHQRKGPFASEFIDIWYERYLHYTK
YGAC_BACSU       NILDEDEYDDHRKAMNYPKEIDSILRDYLNTLLHWIHQRQGPFAPEFVDMWYERYLRYTK
Y940_ALKHC       KLLDEDEYAMHRKMMKYPPEIDRILQRSVDELVSWIHQRKGPFAPQFVESWYERFLQYR-
Y1315_ALKCK      KLLDEDEYELHSKLMKYPPELDVILRKSVDELISWIHQRKGPFAPQFVENWYERYLQYR-
Y899_OCEIH       QLLDEDEYEEHRNLMNYPQVIDRILHQQLEILIRWIRQGKGPFSPDFVDNWYEMYLTYH-
Y468_GEOKA       MLLDEDEYERHRREMHYPDVIDRILKNNVQKLIGWIKERKGPFAPEFIDKWYGVFQAYQT
Y1848_STAA3      HLLDEDEYEQHMNQMNYPHDIDIILRRNVDILQQWIEQKKGPFAPDFIKVWKERYKKIRQ
Y2004_STAA8      HLLDEDEYEQHMNQMNYPHDIDIILRRNVDILQQWIEQKKGPFAPDFIKVWKERYKKIRQ
Y1800_STAAB      HLLDEDEYEQHMNQMNYPHDIDIILRRNVDILQQWIEQKKGPFAPDFIKVWKERYKKIRQ
Y1925_STAAC      HLLDEDEYEQHMNQMNYPHDIDIILRRNVDILQQWIEQKKGPFAPDFIKVWKERYKKIRQ
Y1867_STAAM      HLLDEDEYEQHMNQMNYPHDIDIILRRNVDILQQWIEQKKGPFAPDFIKVWKERYKKIRQ
Y1684_STAAN      HLLDEDEYEQHMNQMNYPHDIDIILRRNVDILQQWIEQKKGPFAPDFIKVWKERYKKIRQ
Y1807_STAAW      HLLDEDEYEQHMNQMNYPHDIDIILRRNVDILQQWIEQKKGPFAPDFIKVWKERYKKIRQ
Y1957_STAAR      HLLDEDEYEQHMNQMNYPHDIDIILRRNVDILQQWIEQKKGPFAPDFIKVWKDRYKKIRQ
Y1789_STAAS      HLLDEDEYEQHMNQMNYPHDIDIILRRNVDILQQWIEQKKGPFAPDFIKVWNERYKKIRQ
Y1405_STAEQ      HLLDEDEYEQHMNQMNYPHDIDIILRRNVDILQQWIEQKKGPFAPDFIKVWKERYKKIRD
Y1551_STAES      HLLDEDEYEQHMNQMNYPHDIDIILRRNVDILQQWIEQKKGPFAPDFIKVWKERYKKIRD
Y1094_STAHJ      HLLDEDEYEQHMNQMNYPHDIDVILRRNVDILQQWIEQKKGPFAPDFIKVWKERYKKIRN
Y926_STAS1       HLLDEDEYEQHMRQMNYSSDIDVILRRNVDILQQWIEQKKGPFAPDFIKVWRERYKKIRN
Y1711_LISMF      HLLDEGEYEQHRRQMKYPDSIDRILRHNVDVLSHWILDKKGPFSPDYIDIWYEKYKEYR-
Y1687_LISMO      HLLDEGEYEQHRRQMKYPDSIDRILRHNVDVLSHWILDKKGPFSPDYIDIWYEKYKEYR-
Y1795_LISIN      HLLDEGEYEQHRRQMKYPDSIDRILKTNVDVLSHWILDKKGPFSPDYIDIWYEKYKEYR-
                  :**  **  :     *.   * **:     *  ** . :**::  ::  *   :     

Y1430_STRPF      R-------------------
Y1362_STRPM      R-------------------
Y1315_STRPC      R-------------------
Y1437_STRPD      R-------------------
Y1617_STRP8      R-------------------
Y1342_STRPB      R-------------------
Y1608_STRP1      R-------------------
Y1367_STRP6      R-------------------
Y1356_STRP3      R-------------------
Y374_STRT1       R-------------------
Y374_STRT2       R-------------------
Y1781_STRMU      R-------------------
Y1903_STRPN      R-------------------
Y1719_STRR6      R-------------------
Y492_STRA1       R-------------------
Y446_STRA3       R-------------------
Y411_STRA5       R-------------------
Y370_LIGS1       QQ------------------
Y1475_LATSS      HR------------------
Y1241_LACPL      RQ------------------
Y697_ENTFA       K-------------------
YJJG_LACLA       --------------------
Y1604_LACJO      DLDRSFFKGRENEERKILGT
Y582_BACC1       --------------------
Y434_BACCZ       --------------------
Y438_BACHK       --------------------
Y527_BACAN       --------------------
Y508_BACCR       --------------------
Y890_BACLD       --------------------
YGAC_BACSU       --------------------
Y940_ALKHC       --------------------
Y1315_ALKCK      --------------------
Y899_OCEIH       --------------------
Y468_GEOKA       --------------------
Y1848_STAA3      Y-------------------
Y2004_STAA8      Y-------------------
Y1800_STAAB      Y-------------------
Y1925_STAAC      Y-------------------
Y1867_STAAM      Y-------------------
Y1684_STAAN      Y-------------------
Y1807_STAAW      Y-------------------
Y1957_STAAR      Y-------------------
Y1789_STAAS      Y-------------------
Y1405_STAEQ      Y-------------------
Y1551_STAES      Y-------------------
Y1094_STAHJ      Y-------------------
Y926_STAS1       Y-------------------
Y1711_LISMF      --------------------
Y1687_LISMO      --------------------
Y1795_LISIN      --------------------