CLUSTAL format seed alignment for MF_01569

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

SYP_AQUAE       ------MRWSRYF-LYTEKEEPKEAEAPSHRLLLKAGFIKQV--SAGIYELLPPAYKVLK
SYP_THEMA       ------MRMKDLY-APTLKETPSDVETVSHEYLLRGGFIRKV--AAGIYTYLPLGRRVLL
SYP_BACSU       ------MRQSLTL-IPTLREVPADAEAKSHQLLLRAGFIRQN--TSGVYSYMPLAYKVIQ
SYP_BACLD       ------MRQSRTL-IPTLREVPADAEAKSHQLLLRAGFIRQN--TSGVYSYMPLANKVIH
SYP1_BACAN      ------MKQSMVF-SPTLREVPADAEIKSHQLLLRAGFMRQN--ASGIYSFLPFGLKVLH
SYP1_BACCZ      ------MKQSMVF-SPTLREVPADAEIKSHQLLLRAGFMRQN--ASGIYSFLPFGLKVLH
SYP1_BACHK      ------MKQSMVF-SPTLREVPADAEIKSHQLLLRAGFMRQN--ASGIYSFLPFGLKVLH
SYP1_BACC1      ------MKQSMVF-SPTLREVPADAEIKSHQLLLRAGFMRQN--ASGIYSFLPFGLKVLH
SYP1_BACCR      ------MKQSMVF-SPTLREVPADAEIKSHQLLLRAGFMRQN--ASGIYSFLPFGLKVLH
SYP_GEOKA       ------MRQSQAF-IPTLREVPADAEVKSHQLLLRAGFIRQS--ASGVYTFLPLGQRVLQ
SYP_LISMF       ------MRQTMTF-IPTLKEVPADAEVKSHQLLLRAGFIRQT--ASGIYSYLPLATLMLR
SYP_LISMO       ------MRQTMTF-IPTLKEVPADAEVKSHQLLLRAGFIRQT--ASGIYSYLPLATLMLR
SYP_LISIN       ------MRQTMTF-IPTLKEVPADAEVKSHQLLLRAGFIRQV--ASGIYSYLPLATLTLR
SYP_STAA3       ------MKQSKVF-IPTMRDVPSEAEAQSHRLLLKSGLIKQS--TSGIYSYLPLATRVLN
SYP_STAA8       ------MKQSKVF-IPTMRDVPSEAEAQSHRLLLKSGLIKQS--TSGIYSYLPLATRVLN
SYP_STAAC       ------MKQSKVF-IPTMRDVPSEAEAQSHRLLLKSGLIKQS--TSGIYSYLPLATRVLN
SYP_STAAM       ------MKQSKVF-IPTMRDVPSEAEAQSHRLLLKSGLIKQS--TSGIYSYLPLATRVLN
SYP_STAAN       ------MKQSKVF-IPTMRDVPSEAEAQSHRLLLKSGLIKQS--TSGIYSYLPLATRVLN
SYP_STAAW       ------MKQSKVF-IPTMRDVPSEAEAQSHRLLLKSGLIKQS--TSGIYSYLPLATRVLN
SYP_STAAS       ------MKQSKVF-IPTMRDVPSEAEAQSHRLLLKSGLIKQS--TSGIYSYLPLATRVLN
SYP_STAAR       ------MKQSKVF-IPTMRDVPSEAEAQSHRLLLKAGLIKQS--TSGIYSYLPLATRVLN
SYP_STAAB       ------MKQSKVF-IPTMRDVPSEAEAQSHRLLLKSGLIKQS--TSGIYSYLPLATRVLN
SYP_STAHJ       ------MKQSKVF-IPTRRDVPAEAEALSHQLLLKAGLIKQS--TSGIYSYLPLASRVLN
SYP_STAS1       ------MKQSKVF-IPTMKEVPAGAEALSHRLLLKAGLIKQS--TSGIYSYLPLAARVLN
SYP_STAES       ------MKQSKVF-IPTMREVPAEAEALSHRLLLKAGLIKQS--TSGIYSYLPLATRVLN
SYP_STAEQ       ------MKQSKVF-IPTMREVPAEAEALSHRLLLKAGLIKQS--TSGIYSYLPLATRVLN
SYP_BACHD       ------MKQSFFL-VPTMREVPADADVVSHQLMLRAGMIRQV--AAGIYTYLPLARRVIR
SYP_BACSK       ------MRQSTYL-APTMRDVPADAEAISHQLMLRAGMMRQI--AAGVYAYLPLAKRTIA
SYP_LACPL       ------MKQSKLL-IPTLKEVPNDAEALSHQMMLRAGYIRQI--SAGMYAYLPLAYRVLT
SYP_LACSS       ------MKQSKLF-IPTLKEVPNSAEAKSHRMMLRAGYIHQV--SAGVYSYLPLAYRVLE
SYP_ENTFA       ------MKQSKML-IPTLREVPNDAEVLSHQILLRAGYIRQV--AAGIYSYLPLANRVLE
SYP_LACS1       ------MKQSQML-IPTLKEIPSDAEVVSHQLMLRGGYIKQI--TAGMYAYLPLAYRVMK
SYP_STRA3       ------MKQSKML-IPTLREMPSDAQVISHALMVRAGYVRQV--SAGIYAYLPLANRTIE
SYP_STRA5       ------MKQSKML-IPTLREMPSDAQVISHALMVRAGYVRQV--SAGIYAYLPLANRTIE
SYP_STRA1       ------MKQSKML-IPTLREMPSDAQVISHALMVRAGYVRQV--SAGIYAYLPLANRTIE
SYP_STRP1       ------MKQSKLL-IPTLREMPSDAQVISHALMVRAGYVRQV--SAGIYAYLPLANRTIE
SYP_STRPM       ------MKQSKLL-IPTLREMPSDAQVISHALMVRAGYVRQV--SAGIYAYLPLANRTIE
SYP_STRP3       ------MKQSKLL-IPTLREMPSDAQVISHALMVRAGYVRQV--SAGIYAYLPLANRTIE
SYP_STRPF       ------MKQSKLL-IPTLREMPSDAQVISHALMVRAGYVRQV--SAGIYAYLPLANRTIE
SYP_STRP8       ------MKQSKLL-IPTLREMPSDAQVISHALMVRAGYVRQV--SAGIYAYLPLANRTIE
SYP_STRP6       ------MKQSKLL-IPTLREMPSDAQVISHALMVRAGYVRQV--SAGIYAYLPLANRTIE
SYP_STRPB       ------MKQSKLL-IPTLREMPSDAQVISHALMVRAGYVRQV--SAGIYAYLPLANRTIE
SYP_STRPC       ------MKQSKLL-IPTLREMPSDAQVISHALMVRAGYVRQV--SAGIYAYLPLANRTIE
SYP_STRPD       ------MKQSKLL-IPTLREMPSDAQVISHALMVRAGYVRQV--SAGIYAYLPLANRTIE
SYP_STRT1       ------MKQSKML-IPTLREMPSDAQVISHALMVRAGYVRQV--SAGIYAYMPLANRAIE
SYP_STRT2       ------MKQSKML-IPTLREMPSDAQVISHALMVRAGYVRQV--SAGIYAYMPLANRAIE
SYP_STRMU       ------MKQSNML-IPTLREMPSDAQVISHALMVRAGYVRQV--SAGIYSYLPLAHRVIE
SYP_STRPN       ------MKQSKMP-IPTLREMPSDAQVISHALMLRAGYVRQV--SAGVYSYLPLANRVIE
SYP_STRR6       ------MKQSKMP-IPTLREMPSDAQVISHALMLRAGYVRQV--SAGVYSYLPLANRVIE
SYP_LACLA       ------MKQSKML-IPTLREMPSDAQVISHALLMRAGYVRQV--SAGIYAYLPLANRVLE
SYP_LACAC       ------MRQSKFF-MPTLKEAPSDAVAESHKLMIRGGYIRQV--TAGVYAYLPLGYRVLR
SYP_LACJO       ------MRQSKFF-MPTLKEAPSDAVAKSHQLMLRGGYIRQV--TAGVYAYLPLGYRVLR
SYP_FUSNN       ------MRFSKAY-IKTLKETPKEAEIASHKLMLRAGMIKKL--ASGIYAYLPLGYRTIK
SYP_DEHM1       ------MRYSRLF-GKTQREIPSDAETISHQLLLRSGMIAQL--TAGVYSFMPLAWRSIQ
SYP_DEHMC       ------MRYSRLF-GKTQREIPSDAETISHQLLLRSGMIAQL--TAGVYSFMPLAWRSIQ
SYP1_ANADE      ---MHAVRYTQAF-IPTLKEAPADAQVASHKLLVRAGFIRQL--GAGIYDYLPLAKRSLT
SYP_CARHZ       ------MRLSQYF-MPTLRENPAEAEVISHKLLLRAGFIRKS--ASGVYTYLPLAQRVLK
SYP_MOOTA       ------MRASELL-APTLRETPAEAEIVSHQLLLRGGFIRKA--AAGIYTYLPLGRRVLA
SYP_DESHY       ------MRVSQIL-NPTLREVPAEAEVVSHQLLVRAGLIRKS--AAGIYTYLPLGLRVLR
SYP_CLOAB       ------MKMSNML-MLTLRESPAEAEIESHKLMLRSGMIRKM--ASGVYNYMPLGLKALK
SYP_CLOTE       ------MKLSNML-VSTLREVPAEAEIPSHKLMLRAGMMRKM--ASGVYNFMPFGLRVIK
SYP_CLOPE       ------MKMSNML-VGTLREVPAEAEIESHKLMLRAGLMRKM--AAGIYNYMPLGLKVIE
SYP_CALS4       ------MRLSQLL-MPTLREVPADAEIPSHVLMLKAGLMRKL--AAGIYVYLPLGKRVLK
SYP_DESAG       ------MRWSNFY-IPTLKEAPADAEVVSHKLLIRAGMIRKL--TSGIYIYLPLGLRSIE
SYP_DESVH       ------MRWSRCY-IPTLKEAPSDAEVVSHKLLVRAGMIRKL--TSGIYTFMPMGLRALN
SYP_LAWIP       ------MRWSQCY-IPTLKEAPGDAELLSHKLLIRAGMIRKL--TSGIYTWLPLGLKTLN
SYP_GEOMG       ------MRYSQYF-IPTVKETPSDAEVVSHKLMLRAGMIRKL--AAGIYNYLPLGLRSIR
SYP_GEOSL       ------MRYTNYF-IPTLKETPSDAEVVSHQLMLRAGMIRKL--AAGIYNYLPLGLRSIR
SYP_PELCD       ------MRYTDYL-LPTLKETPSDAEVISHKLMLRAGMIRKL--AAGIYNYLPFGLRSIR
SYP_DESPS       ------MRYSQSF-IPTKKETPAEAEVASHQLMLRAGFMRKL--SSGVYSYLPYGLAAIR
SYP_SYNAS       ------MRYSEMF-LPTEREIPSDAEVVSHQLMLRAGMIRKL--SAGIYSYLPLGYRVLR
SYP_MYCTU       ----MITRMSELF-LRTLRDDPADAEVASHKLLIRAGYIRPV--APGLYSWLPLGLRVLR
SYP_MYCBO       ----MITRMSELF-LRTLRDDPADAEVASHKLLIRAGYIRPV--APGLYSWLPLGLRVLR
SYP_MYCPA       ----MITRMSQLF-LRTLRDDPADAEVPSHKLLIRAGYIRPV--APGLYSWLPLGLRVLR
SYP_NOCFA       ----MITRLSHLF-LRTLRDDPADAEVPSHKLLVRAGYVRRV--APGVYSWLPLGLRVLR
SYP_COREF       ----MITRLSTLF-LRTLREDPADAEVPSHKLLVRAGYIRRV--APGVYSWLPLGLRALR
SYP_CORGL       ----MITRLSTLF-LRTLREDPADAEVPSHKLLVRAGYIRRV--APGIYSWLPLGLRAVR
SYP_CORDI       ----MITRLSTLF-LRTLREDPADAEVPSHKLLVRAGYIRRT--APGVYTWLPLGLRTLR
SYP_CORJK       ----MITRMSQLF-LRTLRDDPADAEVPSHKLLVRAGYIRRV--APGVYSWLPLGLRVLR
SYP_THEFY       ----MLLRMSNLF-LRTLREDPADAEVPSHKLLVRGGFVRRT--APGVYSWLPLGKIVLE
SYP_LEIXX       ----MPTRLTNYF-LRTLREDPADAEVTSHRLLVRAGYIRRQ--APGVFAWLPLGLRVKA
SYP_CUTAK       ----MLTRMSQLF-VRTLREDPADAEVPSHRWLVRAGYIRRV--APGVYSWLPLGLRVMR
SYP_BIFLO       --------MSTMF-LRTLREDPADADVDSAKLLQRAGYIRKA--APGIWTWLPLGLRVLN
SYP_STRCO       MANAPVQRMSKLM-AKTLRDDPADAEVLSHKLLVRAGYVRRT--AAGLWSWLPLGKKVLG
SYP1_STRAW      --MAQVQRMSRLM-VKTLRDDPADAETLNHKLLVRADYVRRT--AAGIWSWLPLGKKVLE
SYP_TROW8       ----MITKVSDFL-FRTFREDPATTESRGYGFLLRAGYIRQT--GSGIFSWMPLGLKVRH
SYP_TROWT       ----MITKVSGFL-FRTFREDPATTESRGYGFLLRAGYIRQT--GSGIFSWMPLGLKVRH
SYP_TREPA       --------MSAFF-APTLRSAPADATIASHQLLMRAGYVRKI--ANGLFAYLPLGLRVRH
SYP_TREDE       ------MKMTQMY-MPTLREIPNEAVVESHKLLLRAGMIRNL--ANGLFAYLPLGLKAFR
SYP_LEPIC       ------MKASKYI-LPTEKENPADAVVASHRLMIRAGLVRKS--SAGLYFYLPLGLKVLK
SYP_LEPIN       ------MKASKYI-LPTEKENPADAVVASHRLMIRAGLVRKS--SAGLYFYLPLGLKVLK
SYP_CHLTR       ------MRMSLLF-YRTSKNANKEASVLSYELLQKAGYLFKT--SKGIYSYTPLFQRVIL
SYP_CHLTA       ------MRTSLLF-YRTSKNANKEASVLSYELLQKAGYLFKT--SKGIYSYTPLFQRVIL
SYP_CHLMU       ------MKTSLLF-YRTSKNANKEASVLSYELLEKAGYLFKT--SKGIYSYTPLFQRVIL
SYP_CHLCV       ------MKTSQLF-YKTSKNANKEAAVLSYELLEKAGYIFKT--AKGIYTYTPLFWRVAL
SYP_CHLFF       ------MRTSQLF-YKTSKNANKDAAVLSYELLEKAGYIFKT--AKGVYTYTPLFWRVAL
SYP_CHLAB       ------MKTSQLF-YKTSKNANKEASVLSYELLEKAGYIFKT--AKGIYTYTPLFWRVAL
SYP_CHLPN       ------MKTSQLF-YKTSKNANKSAAVLSNELLEKAGYLFKV--SKGVYTYTPLLWRVVS
SYP_NOSS1       ------MRLSQML-FVTLRDDPSDAEIPSHKLLLRAGYIRRI--GSGIYAYLPLMWRVLQ
SYP_TRIV2       ------MRLSQML-FVTLRDDPADAEIPSHKLLLRAGYIRRI--GSGIYAYLPLMWRVLQ
SYP_SYNP6       ------MRLSQML-FVTLREDPAEAEIPSHKLLLRAGYIRRI--ASGIYAYLPLMWRVLR
SYP_SYNE7       ------MRLSQML-FVTLREDPAEAEIPSHKLLLRAGYIRRI--ASGIYAYLPLMWRVLR
SYP_SYNY3       ------MRLSQML-FVTLRDDPADAEIPSHKLLVRAGFIRRL--GSGLYAYLPLIWRVLE
SYP_THEEB       ------MRLSQML-FVTLRDEPAEAEIPSHKLLLRAGYIRRI--ASGIYSYLPLMWRVLQ
SYP_SYNJA       --MQRSQRLSQML-FVTLREDPAEAELISHKLLLRGGFIRRL--SPGIYTYLPLLWRVLQ
SYP_SYNJB       --MQQSQRLSQML-FVTLREDPVEAELPSHKLLLRGCFIRRL--SPGIYTYLPLLWRVLQ
SYP_PROM9       ------MRVTTSFPLGTLRDTPSEAEIISHQLLLKAGYIRRV--YSGIYAYMPIMLKVIE
SYP_PROMP       ------MRVTTSFPLGTLRDTPSEAEIISHQLLLKGGYIRRV--NSGIYAYMPIMLRVIE
SYP_PROMA       ------MRVSRLM-LVTLRDVPAEAEIVSHQLLIRGGFIKRV--TSGIYAYMPLMWKVIK
SYP_PROMT       ------MRVSRLM-LNTLRDVPAEADIISHQLLVRGGYVKRL--TGGIYAYMPLLWKVLK
SYP_SYNPX       ------MRVSRLM-LVTLRDVPAEAEITSHQLLLRGGFIRRV--GSGIYAYLPMMWKVLQ
SYP_SYNS9       ------MRVSRLL-LVTLRDVPAEAEIASHQLLLRGGYIRRI--GSGIYGYLPLMWKVIQ
SYP_SYNSC       ------MRVSRLL-LVTLRDVPAEAEITSHQLLLRAGYIRRV--GSGIYAYLPLMWRVLQ
SYP_PROMM       ------MRVSRLM-LVTLRDIPADAEIASHQLLLRGGYIRRV--TSGIYAYLPLMWRVLR
SYP_GLOVI       -----MTRLSSSF-FFTLREAPAEAVAVSHKLLLRAGFIRPLAGTAGLYAYGPLMQRVLQ
SYP_HELPY       ------MLFSKLF-APTLKEPPKDAVLKSHKHLAQAGYIYQV--GSGIYNFLPLAKKVLD
SYP_HELPJ       ------MLFSKLF-APTLKEPPKDAVLKSPKHPGKAGYIYQI--GSGIYNFLPLAKKVLD
SYP_CAMJE       -----MMRFTKFY-APSLKEAPKDASLPSHIFLTRAGFVEQI--GSGLYNFLPLGKRVLD
SYP_CAMJR       -----MMRFTKFY-APSLKEAPKDASLPSHIFLTRAGFVEQI--GSGLYNFLPLGKRVLD
SYP_HELHP       ------MRFSQLF-VNTLKESPKDAVLKSHQYLIRGGFIQQI--GSGIYNFLPLGKKLLD
SYP_WOLSU       ------MRFSAFF-APTLKEAPKDATLKSHEYLIRGGYIQQV--GSGIYNFLPLGKRVMD
SYP_SHIBS       ------MRTSQYL-LSTLKETPADAEVISHQLMLRAGMIRKL--ASGLYTWLPTGVRVLK
SYP_SHIFL       ------MRTSQYL-LSTLKETPADAEVISHQLMLRAGMIRKL--ASGLYTWLPTGVRVLK
SYP_SHISS       ------MRTSQYL-LSTLKETPADAEVISHQLMLRAGMIRKL--ASGLYTWLPTGVRVLK
SYP_ECOLI       ------MRTSQYL-LSTLKETPADAEVISHQLMLRAGMIRKL--ASGLYTWLPTGVRVLK
SYP_ECO57       ------MRTSQYL-LSTLKETPADAEVISHQLMLRAGMIRKL--ASGLYTWLPTGVRVLK
SYP_SHIDS       ------MRTSQYL-LSTLKETPADAEVISHQLMLRAGMIRKL--ASGLYTWLPTGVRVLK
SYP_ECOL6       ------MRTSQYL-LSTLKETPADAEVISHQLMLRAGMIRKL--ASGLYTWLPTGVRVLK
SYP_ECOUT       ------MRTSQYL-LSTLKETPADAEVISHQLMLRAGMIRKL--ASGLYTWLPTGVRVLK
SYP_SALPA       ------MRTSQYL-LSTLKETPADAEVISHQLMLRAGMIRKL--ASGLYTWLPTGLRVLK
SYP_SALTI       ------MRTSQYL-LSTLKETPADAEVISHQLMLRAGMIRKL--ASGLYTWLPTGLRVLK
SYP_SALTY       ------MRTSQYL-LSTLKETPADAEVISHQLMLRAGMIRKL--ASGLYTWLPTGLRVLK
SYP_SALCH       ------MRTSQYL-LSTLKETPADAEVISHQLMLRAGMIRKL--ASGLYTWLPTGLRVLK
SYP_YERPE       ------MRTSQYL-LSTQKETPADAEVISHQLMLRAGMIRKL--ASGLYTWLPTGVRVLK
SYP_YERPS       ------MRTSQYL-LSTQKETPADAEVISHQLMLRAGMIRKL--ASGLYTWLPTGVRVLK
SYP_PECAS       ------MRTSQYM-LSTLKETPADAEVISHQLMLRAGMIRKL--ASGLYTWLPTGLRVLR
SYP_SODGM       ------MRTSQYL-LSTLKEVPADAEVVSHQLMLRAGMIRKL--ASGLYSWLPTGLRVLR
SYP_PHOLL       ------MRTSQYL-LSTLKETPADAEVVSHKLMLRAGMIRKL--ASGLYNWMPTGIRVLK
SYP_HAEIN       ------MRTSQYL-FSTLKETPNDAQVVSHQLMLRAGMIRPM--ASGLYNWLPTGIRVLK
SYP_HAEI8       ------MRTSQYL-FSTLKETPNDAQVVSHQLMLRAGMIRPM--ASGLYNWLPTGIRVLK
SYP_MANSM       ------MRTSKYL-FSTLKETPNDAQVVSHQLMLRAGMIRPM--ASGLYNWLPSGIRVLE
SYP_HAEDU       ------MRTSQYL-FSTLKETPNDAQVISHQLMLRAGMIRPT--AAGLYNWLPTGVKILK
SYP_PASMU       ------MRTSQYL-FSTLKETPAEASIVSHQLMLRAGMIRPL--ASGLYTWLPTGLRVLN
SYP_BAUCH       ------MRTSQYL-LSTIKEIPLDAEVISHQLMLRAGIIRQL--ASGLYTWLPTGLRILR
SYP_VIBVU       ------MRTSKYL-LSTLKETPNDAEVVSHQLMLRAGMIRKL--ASGLYTWLPTGLRVLR
SYP_VIBVY       ------MRTSKYL-LSTLKETPNDAEVVSHQLMLRAGMIRKL--ASGLYTWLPTGLRVLR
SYP_VIBPA       ------MRTSNYL-LSTLKETPNDAEVVSHQLMLRAGMIRKL--ASGLYTWLPTGLRVLR
SYP_ALIF1       ------MRTSKYL-LSTLKETPNDAEVVSHQLMLRAGMIRRL--ASGLYTWLPTGLRVLR
SYP_VIBCH       ------MRTSNYL-LSTLKETPNDAEVVSHKLMLRAGMIRKL--ASGLYTWLPTGLRVLR
SYP_PHOPR       ------MRTSNYL-LSTLKETPNDAEVISHQLMLRAGMIRKL--ASGLYTWLPTGLRVLR
SYP_SHEON       ------MRVSKYL-LSTQKETPANAEVISHQLMLRAGMIRRN--ASGLYSYLPSGLRVLR
SYP_PSE14       ------MRTSQFL-LATQKETPSDAVVVSHQLMLRAGMIRKL--ASGLYTWLPMGLRVLR
SYP_PSEU2       ------MRTSQFL-LATQKETPSDAVVVSHQLMLRAGMIRKL--ASGLYTWLPMGLRVLR
SYP_PSESM       ------MRTSQFL-LATQKETPSDAVVVSHQLMLRAGMIRKL--ASGLYTWLPMGLRVLR
SYP_PSEF5       ------MRTSQYL-LATQKETPSDAVVISHQLMLRAGMIRKL--ASGLYTWLPMGLRVMR
SYP_PSEPF       ------MRTSQFL-LATQKETPSDAVVISHQLMLRAGMIRKL--ASGLYTWLPMGLRVMR
SYP_PSEPK       ------MRTSQYL-LATQKETPADAVVISHQLMLRAGMIRKL--ASGLYTWLPMGLRVMR
SYP_PSEAE       ------MRTSQYL-LSTLKETPADAVVISHQLLLRAGMIRRL--ASGLYTWLPMGLRVLR
SYP_CHRSD       ------MRASQLL-ISTLKETPADADIVSHQLMLRAGMIRRL--SSGLYTWLPLGLRTLR
SYP_PSYA2       ------MKASQFL-FATLKETPSDADIASSQLMVRAGLIRKI--ASGLYIWLPMGLRVLQ
SYP_PSYCK       ------MKASQFL-FATLKETPSDADIASSQLMVRAGLIRKI--ASGLYIWLPMGLRVLQ
SYP_ACIAD       ------MRASRFL-FATLRETPNDAEVISHQLMLRAGMIRKL--ASGLYTWLPMGVRVLN
SYP_HAHCH       ------MRASRYL-IATLKETPADAEVISHQLMLRAGMIRKL--AAGLYTWLPLGLRVLK
SYP_SACD2       ------MRASKYL-IATYKETPADAEVISHQLMLRAGLIRKL--ASGLYNWLPAGLRVLR
SYP_COLP3       ------MRTSQYL-LSTLKETPANAEVISHQLMLRAGLVRNL--ASGLYTWLPTGLRVLK
SYP_IDILO       ------MRSSKYL-LSTLKETPSDAEIVSHQLMLRAGMIRKV--AAGLYTWTPTGLRVLR
SYP_PSEHT       ------MRTSQYI-LATLKETPSDAEIVSHQLMLRAGMIRRV--ASGLYTWLPTGLRVLR
SYP_HYDCU       ------MKTSSLL-LATTRETPADAVVISHQLMLRAGIIRPL--AGGLYNWLPLGVRVLR
SYP_COXBU       ----MLMKVSQFF-LATVKETPADAVLASHQLMIRAGMLRKL--ASGLYTWLPLGLRVLQ
SYP_NITOC       ------MRTSQYL-LTTTRETPADAEIISHQLMLRGSFIRRL--AAGLYTWLPLGLRVLR
SYP_METCA       ------MRTSQFP-LNTLKEIPSDAEIVSHQLMLRAGLIRKL--AAGLYTWLPLGLKVLR
SYP_LEGPA       ------MRASQWF-LVTQKETPNDAEIASHQLMLRSGMIRKL--GSGLYTWMPLGLRVLR
SYP_LEGPL       ------MRASQWF-LVTQKETPNDAEIASHQLMLRSGMIRKL--GSGLYTWMPLGLRVLR
SYP_LEGPH       ------MRASQWF-LVTQKETPNDAEIASHQLMLRSGMIRKL--GSGLYTWMPLGLRVLR
SYP_FRATH       ------MKATQTL-IATTKELPKEAVLISHQYMLKAGLIKKL--ASGIYTWMPLGLKVLQ
SYP_FRATT       ------MKATQTL-IATTKELPKEAVLISHQYMLKAGLIKKL--ASGIYTWMPLGLKVLQ
SYP_BORBR       ------MRASKYH-LNTLKEAPAEAEIASHQLMTRAGMIRKL--AGGIYTYMPLGLKVIR
SYP_BORPE       ------MRASKYH-LNTLKEAPAEAEIASHQLMTRAGMIRKL--AGGIYTYMPLGLKVIR
SYP_BORPA       ------MRASKYH-LNTLKEAPAEAEIASHQLMTRAGMIRKL--AGGIYTYMPLGLKVIR
SYP_BORA1       ------MRASNYH-INTLKEAPADAEVASHQLMTRAGMIRKL--AGGIYSYMPLGLKVIR
SYP_AROAE       ------MRASQYF-ISTLKEAPSDAEVVSQKLMLRAGFIRKV--AAGIYSYLPIGLRVIR
SYP_RHOFT       ------MKASQFF-ISTLKEAPADAEVVSHKLMTRAGMIKKL--GAGIYSLMPMGLRVVR
SYP_BURP1       ------MKASRFF-IGTLKEAPADAEIVSHKLMVRAGMIRRV--AGGIYNYLPVGLRSIR
SYP_BURPS       ------MKASRFF-IGTLKEAPADAEIVSHKLMVRAGMIRRV--AGGIYNYLPVGLRSIR
SYP_BURMA       ------MKASRFF-IGTLKEAPADAEIVSHKLMVRAGMIRRV--AGGIYNYLPVGLRSIR
SYP_BURTA       ------MKASRFF-IGTLKEAPADAEIVSHKLMVRAGMIRRV--AGGIYNYLPVGLRSIR
SYP_BURL3       ------MKASRFF-IGTLKEAPADAEIVSHKLMVRAGMIRRV--AGGIYNYLPVGLRSIR
SYP_CUPPJ       ------MKASQFF-ISTLKEAPADAEIVSHKLMMRAGMIKKL--GAGIYNYMPVGLRVIR
SYP_CUPMC       ------MKASQFF-ISTLKEAPADAEIVSHKLMMRAGMIKKL--GAGIYNYMPVGLRVIR
SYP_RALSO       ------MKASQFF-ISTLKEAPADAEIVSHKLMMRAGMIKKL--GAGLYTYMPVGLRVIR
SYP_CHRVO       ------MRASQFF-ISTLKEAPADADITSQKLMIRAGFIRKQ--AAGIYSWMPMGLRVVR
SYP_NEIMA       ------MKASQFF-ISTLKEAPAEAALASHKLMIRAGLIKAN--ASGLYTWMPMGLRVLR
SYP_NEIMB       ------MKASQFF-ISTLKEAPAEAALASHKLMIRAGLIKAN--ASGLYTWMPMGLRVLR
SYP_NEIG1       ------MKASQFF-ISTLKEAPAEAAFASHKLMIRAGLIKAN--ASGLYTWMPMGLRVLR
SYP_NITEU       ------MRVSQFF-LATLKEAPAEAELISHRLMLRAGLIKRL--GSGLYTWMPLGLRILH
SYP_NITMU       ------MRASGFF-ISTLKEAPAEAELISHKLMLRAGIIRRL--GSGLYTWMPLGLKVLR
SYP_THIDA       ------MRTTQFF-LSTTKEAPSEAELVSHKLMLRAGLIKRL--GSGLYTWMPLGLRVLR
SYP_DECAR       ------MRTSQFF-FTTLKEAPADAEVISQKMMLRAGYIKRA--AAGIYTWMPLGLRVLR
SYP_XANAC       ------MRLSQFH-LHTTKETPADAELVSHRLMLRAGMIRKL--ASGLYTWSPLGLRVLR
SYP_XANC5       ------MRLSQFH-LHTTKETPADAELVSHRLMLRAGMIRKL--ASGLYTWSPLGLRVLR
SYP_XANOM       ------MRLSQFH-LHTTKETPADAELVSHRLMLRAGMIRKL--ASGLYTWSPLGLRVLR
SYP_XANOR       ------MRLSQFH-LHTTKETPADAELVSHRLMLRAGMIRKL--ASGLYTWSPLGLRVLR
SYP_XANC8       ------MRLSQFH-LHTTKETPADAELVSHRLMLRAGMIRKL--ASGLYTWSPLGLRVLR
SYP_XANCP       ------MRLSQFH-LHTTKETPADAELVSHRLMLRAGMIRKL--ASGLYTWSPLGLRVLR
SYP_XYLFA       ------MRLSEFH-LHTTKEIPADAELVSHRLMLRAGMIRKL--ASGLYTWSPLGLRVLR
SYP_XYLFT       ------MRLSEFH-LHTTKEIPADAELVSHRLMLRAGMIRKL--ASGLYTWSPLGLRVLR
SYP_BUCAI       ------MLTSQYL-LSTSKDIPYDAKIISHQLMIRSGMIRKT--SSGLYVWLPTGMRVLK
SYP_BUCAP       ------MRASKYL-FSTLKETPHHAKIISHQLMLKSGMIRKL--SSGIYIWLPTGIRVLN
SYP_BUCBP       ------MQARKYL-FSTLKETPHNSDCISHALMLRAGIIRQN--TSGTYIWLPTGLRILK
SYP_BLOFL       ------MRTTQYL-LATIKEIPKSCEPISHQLMLRSGMVRQI--SSGVYTWLPTGLRVLK
SYP_BLOPB       ------MRTSQYL-LATLKEAPKNCKAISHQLMLRAGLIRQV--SSGLYTWLPTGLRVLR
SYP_WIGBR       ------MRTSQYY-LATLKDSPSETEGISHRLMIRSGMIRKL--SSGLYAWLPTGFRVLK
                                : :.        .     :.  :       * :   *       

SYP_AQUAE       KVESIIRKEMDRSGAQELLLTVLNPKELWEETGRWETYGE---ELFKLKDRNG---REYC
SYP_THEMA       KIENIVREEMNRIGAQEILMPILQPAELWKQSGRWDDYGP---EMMKLKDRHE---RDFT
SYP_BACSU       NIQQIVREEMEKIDAVEMLMPALQQAETWQESGRWYTYGP---ELMRLKDRHG---REFA
SYP_BACLD       KIQSIVREEMEKINAVEMLMPALQQAETWQESGRWYTYGP---ELMRLKDRHG---REFA
SYP1_BACAN      KVERIVREEMERAGAVELLMPAMQAAELWQESGRWYSYGS---ELMRMKDRNA---REFA
SYP1_BACCZ      KVERIVREEMERAGAVELLMPAMQAAELWQESGRWYSYGS---ELMRMKDRNA---REFA
SYP1_BACHK      KVERIVREEMERAGAVELLMPAMQAAELWQESGRWYSYGS---ELMRMKDRNA---REFA
SYP1_BACC1      KVERIVREEMERAGAVELLMPAMQAAELWQESGRWYSYGS---ELMRMKDRNA---REFA
SYP1_BACCR      KVERIVREEMERAGAVELLMPAMQAAELWQESGRWYSYGS---ELMRMKDRNA---REFA
SYP_GEOKA       KVEAIIREEMNRIGAMELFMPALQPAELWQQSGRWYSYGP---ELMRLKDRHE---RDFA
SYP_LISMF       KIETIIREELEAIGAAELLMPALQPAELWQESGRWNDYGP---ELMRLKDRAS---RDFA
SYP_LISMO       KIETIIREELEAIGAAELLMPALQPAELWQESGRWNDYGP---ELMRLKDRAS---RDFA
SYP_LISIN       KIEAIVREELEAIGAAEMLMPALQPAELWHESGRWADYGP---ELMRLKDRAA---RDFV
SYP_STAA3       NITAIVRQEMERIDSVEILMPALQQAELWEESGRWGAYGP---ELMRLQDRHG---RQFA
SYP_STAA8       NITAIVRQEMERIDSVEILMPALQQAELWEESGRWGAYGP---ELMRLQDRHG---RQFA
SYP_STAAC       NITAIVRQEMERIDSVEILMPALQQAELWEESGRWGAYGP---ELMRLQDRHG---RQFA
SYP_STAAM       NITAIVRQEMERIDSVEILMPALQQAELWEESGRWGAYGP---ELMRLQDRHG---RQFA
SYP_STAAN       NITAIVRQEMERIDSVEILMPALQQAELWEESGRWGAYGP---ELMRLQDRHG---RQFA
SYP_STAAW       NITAIVRQEMERIDSVEILMPALQQAELWEESGRWGAYGP---ELMRLQDRHG---RQFA
SYP_STAAS       NITAIVRQEMERIDSVEILMPALQQAELWEESGRWGAYGP---ELMRLQDRHG---RQFA
SYP_STAAR       NITAIVRQEMERIDSVEILMPALQQAELWEESGRWGAYGP---ELMRLQDRHG---RQFA
SYP_STAAB       NITAIVRQEMERIDSVEILMPALQQAELWEESGRWGAYGT---ELMRLQDRHG---RQFA
SYP_STAHJ       NISKIIREEMESIDAVEILMPALQQAELWEESGRWGAYGP---ELMRLKDRNG---REFA
SYP_STAS1       NIEAIVREEMERIDAVEILMPALQQAELWEESGRWSAYGP---ELMRLQDRNG---REFA
SYP_STAES       NISKIIREEMESIDAVEILMPALQQAELWEESGRWSAYGP---ELMRLKDRNG---REFA
SYP_STAEQ       NISKIIREEMESIDAVEILMPALQQAELWEESGRWSAYGP---ELMRLKDRNG---REFA
SYP_BACHD       KIESIVREELDQTGAQEITMPTLHPAELWQESGRWEKYGD---ELMRLTDRHN---RQFA
SYP_BACSK       KIEAIIREELDAIGAQELTLPSLHPAELWQASGRWEAMGD---ELVRLKDRHN---RDFA
SYP_LACPL       NIEKIIRQEMEKIDAAEMLVPAVIPAELWKATGRYETYGP---ELFKLKNRHD---REFI
SYP_LACSS       NIQAIIKDEMSKIDAVQMQMPGILPAELWEESGRYATYGP---NLFKFKDRHS---RDFI
SYP_ENTFA       KLKTIMREEFEKIDAVEMLMPALLPAELWKESGRYETYGP---NLYRLKDRND---RDYI
SYP_LACS1       KIENIIREEMDRIDAVEMLVPAVVPAELWQESGRYETYGP---TLFKLKDRHE---RDFI
SYP_STRA3       KFKTIMRQEFEKIGAVEMLAPALLTADLWRESGRYETYGE---DLYKLKNRDQ---SDFI
SYP_STRA5       KFKTIMRQEFEKIGAVEMLAPALLTADLWRESGRYETYGE---DLYKLKNRDQ---SDFI
SYP_STRA1       KFKTIMRQEFEKIGAVEMLAPALLTADLWRESGRYETYGE---DLYKLKNRDQ---SDFI
SYP_STRP1       KFKTIMREEFEKIGAVEMLAPALLTADLWRESGRYETYGE---DLYKLKNRDN---SDFI
SYP_STRPM       KFKTIMREEFEKIGAVEMLAPALLTADLWRESGRYETYGE---DLYKLKNRDN---SDFI
SYP_STRP3       KFKTIMREEFEKIGAVEMLAPALLTADLWRESGRYETYGE---DLYKLKNRDN---SDFI
SYP_STRPF       KFKTIMREEFEKIGAVEMLAPALLTADLWRESGRYETYGE---DLYKLKNRDN---SDFI
SYP_STRP8       KFKTIMREEFEKIGAVEMLAPALLTADLWRESGRYETYGE---DLYKLKNRDN---SDFI
SYP_STRP6       KFKTIMREEFEKIGAVEMLAPALLTADLWRESGRYETYGE---DLYKLKNRDN---SDFI
SYP_STRPB       KFKTIMREEFEKIGAVEMLAPALLTADLWRESGRYETYGE---DLYKLKNRDN---SDFI
SYP_STRPC       KFKTIMREEFEKIGAVEMLAPALLTADLWRESGRYETYGE---DLYKLKNRDN---SDFI
SYP_STRPD       KFKTIMREEFEKIGAVEMLAPALLTADLWRESGRYETYGE---DLYKLKNRDN---SDFI
SYP_STRT1       KFKTIMREEFEKIGAVEMLAPALLTADLWRESGRYETYGE---DLYKLKNRDK---SDFI
SYP_STRT2       KFKTIMREEFEKIGAVEMLAPALLTADLWRESGRYETYGE---DLYKLKNRDK---SDFI
SYP_STRMU       KIKKIMREEFDKIGAVEMLAPALLTADLWRESGRYGTYGE---DLYKLKNRDQ---SDFI
SYP_STRPN       KAKNIMRQEFEKIGAVEMLAPALLSAELWRESGRYETYGE---DLYKLKNREK---SDFI
SYP_STRR6       KAKNIMRQEFEKIGAVEMLAPALLSAELWRESGRYETYGE---DLYKLKNREK---SDFI
SYP_LACLA       KLKNIMREEFDEIGAVELLAPSLLTADLWRESGRYDTYGE---DLYKLKNRDN---SDFI
SYP_LACAC       KAESIIEQEMDNINVPEMMMPHLLPATLWQESGRYQKYGA---EMFKLKDRHG---RESL
SYP_LACJO       KAENIIEEEMDNINVPEMIMPHLLPATLWQESGRYKKYGA---EMFKLQDRHG---RESL
SYP_FUSNN       KIENIVREEMDRAGALELLMPVVQPAELWQESGRWDVMGP---EMLRLKDRHE---RDFV
SYP_DEHM1       KIENIIRQEMNKSGCQELAMPVLQPVEIWQQSGREAPFGQ---TLFHLKDRKD---RNLV
SYP_DEHMC       KIENIIRQEMNKAGCQELAMPVLQPVEIWQQSGREAPFGQ---TLFHLKDRKD---RNLV
SYP1_ANADE      KIEAIVREEMNAIGGQEFFLPALHPAEIWKESGRWEVMGD---NMFRLKDRKG---GDYG
SYP_CARHZ       KIMQIIREEMDRQGGQELMLPILQPAELWLETGRWHVYGP---ELFKLKDRHN---RDFC
SYP_MOOTA       KIEQIIREEMDRAGGQEVVLPIIQPAELWQESGRWEVYGE---EMFRLQDRHR---RQFC
SYP_DESHY       KIEQIVREEMDAKGGQEVLLPIIQPAELWRESGRWDLYGQ---ELMRLNDRHN---REFC
SYP_CLOAB       KVENIIREEMNAAGAQEFLASALLPSELWKESGRWEVFGP---EMFKLKDRNE---REFC
SYP_CLOTE       KIEDIVREEMDNAGAQEFLASALLPSELWKESGRWDVFGP---EMFRLQDRNN---REFC
SYP_CLOPE       NVKNIVREEMNNAGAQEFLASALIPAELWQESGRWDAYGA---EMFRLKDRHN---RDFC
SYP_CALS4       KVEEIVREEMDREGSQEVLMSALIPAELFKETGRWDVFGP---EMFKLKDRNE---RDFC
SYP_DESAG       KAASIVRQEMNSAGAQELLMPMVQPADLWQESGRWDFYGK---ELLRISDRHG---RDYC
SYP_DESVH       KVAAIVREEMNRAGAQEVLMPMVQPADLWQETGRWEFYGK---ELLRFRDRND---RDYC
SYP_LAWIP       KAISIIRSEMNRIGAEEILMPMVQPADLWKESGRWDQYGK---ELLRIKDRHD---REYC
SYP_GEOMG       KVEQIVREEMNRAGAIELLMPSVQPAELWQESKRWEQYGK---ELLRFKDRKD---AEFC
SYP_GEOSL       KVETIVREEMDRAGAIELLMPSVQPAELWQESTRWEQYGK---ELLRFKDRKD---AEFC
SYP_PELCD       KVEQIVREEMDRAGAMELLMPMVVPSELWEESGRWEHYGK---ELLRFTDRKD---ASFC
SYP_DESPS       KVENIVREEMNRAGAQEMLMPMVQPADLWKETGRYEKYGP---ELLRFFDRNN---RESC
SYP_SYNAS       KVEQIIREEMNRAGAQEVYLPMVQPAELWQESGRWEHYGK---ELLRFRDRHD---REYC
SYP_MYCTU       NIERVIRDEMNAIGGQEILFPALLPRAPYETTNRWTQYGD---SVFRLKDRRG---NDYL
SYP_MYCBO       NIERVIRDEMNAIGGQEILFPALLPRAPYETTNRWTQYGD---SVFRLKDRRG---NDYL
SYP_MYCPA       RIEHIVREEMNAIGGQEILFPALLPRAPYEATNRWTEYGD---SVFRLQDRRG---NDYL
SYP_NOCFA       KVEDVVRAEMNAIGGQEISLPALLPRDPYETTNRWTEYGD---SLFRLHDRKG---ADYL
SYP_COREF       NIEQVVREEMDAIGGQELLFPGLLPREPYETTQRWTEYGD---SLFRLKDRKG---ADYL
SYP_CORGL       NIEAVVREEMDAIGGQELLFPALLPREPYETTQRWTEYGD---SLFRLKDRKG---ADYL
SYP_CORDI       KVETVVREEMDAIGAQELLFPALLPREPYEQTHRWTEYGD---SLFRLKDRKG---GDYL
SYP_CORJK       NIEAVVREEMNAIGAQEISFPALLPREPYDTTGRWVEYGD---ALFRLKDRKN---ADYL
SYP_THEFY       NVAAVVREEMNRIGAQEVLLPALLPREYYEATGRWTEYGD---TLFRLKDRKG---ADYL
SYP_LEIXX       KIERIIREELAAAGAHEVHFPALLPREPYEITGRWEEYGD---ALFHLKDRKG---ADYL
SYP_CUTAK       RIEAICREEMASIGAQEVSFPALLASDPYKETGRWVEYGD---NLFRLKDRKG---VDML
SYP_BIFLO       KIEAIIREEINGIGAQEVHFPALLPREPYEATHRWEEYGD---NIFRLKDRHE---ADYL
SYP_STRCO       NIERIVREEMDAIGAQEVQLPALLPREPYEATGRWQEYGP---ELFRLQDRKG---GDYL
SYP1_STRAW      NVARVVREEMDAMGGQEVLLPALLPKEPYEATGRWEEYGP---ELFRLKDRKG---AEYL
SYP_TROW8       KIENIIRYEMRQVNAIEVLFPALFSADLFKQSGRWSEYGD---DIFRLKDRRQ---GDYL
SYP_TROWT       KIENIIRYEMGQVNAIEVLFPALFSADLFKQSGRWSEYGD---DIFRLKDRRQ---GDYL
SYP_TREPA       KIEAIIREELEAIGCLECTAPVVTPAELWKESGRWYRMGA---ELLRAKNRLD---HELL
SYP_TREDE       KVEKIIREEMDAIGCLEFKPPVIVPGEIWQESGRWDSMGP---ELLRIKNRLN---QELV
SYP_LEPIC       KIEQIVREEMNSTGALEFDLPILTPSDFWEQSGRWSAMGK---EMFRIQDRHD---LSYA
SYP_LEPIN       KIEQIVREEMNSTGALEFDLPILTPSDFWEQSGRWSAMGK---EMFRIQDRHD---LSYA
SYP_CHLTR       KMTEIIREELNAIGGQEVCLPLLQPAELWEKTGRWKAFLS-EKLLYVLKDREN---KAMC
SYP_CHLTA       KMTEIIREELNAIGGQEVCLPLLQPAELWEKTGRWKAFLS-EKLLYVLKDREN---KAMC
SYP_CHLMU       KMTEIIREELNAIGGQEVCLPLLQSAELWQKTGRWEAFLS-EKLLYVLKDREN---KEMC
SYP_CHLCV       KMMDIVREELNAIGGQELVLPILHPAELWQKTGRWEAFRS-EGLLYTLTDRED---KELC
SYP_CHLFF       KMMDIVREELNAIGGQELMLPILHPAELWQKTGRWEAFRS-EGLLYTLTDRED---KELC
SYP_CHLAB       KMMDIIREELNAIGGQELVLPILHPAELWQKTGRWEAFRS-EGLLYTVKDRED---KEFC
SYP_CHLPN       KMMNIIREELNAIGGQELLLPLLHNAELWQHTGRWEAFTS-EGLLYTLKDREG---KSHC
SYP_NOSS1       KVSQIVREEMNATGAQECLLPQLQPSELWKESGRWDTYTKAEGIMFSLIDRRE---QQLG
SYP_TRIV2       KVSQIVREEMNAAGAQECLLPQLQPSELWKESGRWDTYTKAEGIMFSLIDRRE---QQLG
SYP_SYNP6       KVSQIVREEMDATGAQETLLPQLQPAELWQESGRWETYAKAEGIMFSLDDRQQ---RQLG
SYP_SYNE7       KVSQIVREEMDATGAQETLLPQLQPAELWQESGRWETYTKAEGIMFSLDDRQQ---RQLG
SYP_SYNY3       KVKRIVQEEMNRTGAQECLLPQLQPSELWKMSGRWDTYTESEGIMFALRDRLE---RELG
SYP_THEEB       KVSAIVREEMNRSGALECLLPQLQPAELWQESGRWDTYTKAEGIMFSLTDRAQ---RQLG
SYP_SYNJA       KISDIVREEMNAIGAQECLLPQLQPAEIWRESGRWDVYTQAEGIMFALKDRQG---REQA
SYP_SYNJB       KISEIVRQEMNAIGGQECLLPQLQPAEIWRESGRWDVYTQAEGIMFALKDRQG---REQS
SYP_PROM9       KISKIIEIELNSIGCTKLLLPQLHPANLWKKSERWEGYTAGEGIMFNLKDRQG---KEFG
SYP_PROMP       KISTIIEKELNNIYCSKLLLPQLHPAELWKKSERWEGYTAGEGIMFNLKDRQG---KEFG
SYP_PROMA       KITSIVQEELDSKGCLETLLPQLHPAELWKESGRWDGYTAGEGIMFHLSDRQG---RELG
SYP_PROMT       KITSIVEEELSTKGCLQTLLPQLQPSEIWERSGRWKSYTKGEGIMFSLKDRQG---KELG
SYP_SYNPX       RITTIIREEMNRAGALETLLPQLHPSELWQRSGRWQGYTAGEGIMFHLEDRQG---RELG
SYP_SYNS9       RITAIVRDELNTAGAQETLLPQLHPAELWQRSGRWQGYTAGEGIMFHLEDRQG---RELG
SYP_SYNSC       KITAVVREEMNRAGAQETLLPQLHPAELWQKSGRWQGYTAGEGIMFHLEDRQG---RELG
SYP_PROMM       KITSIVQEEMDATGALETLLPQLQPAELWRRSGRWQGYTAGEGLMFHLEDRQG---RELG
SYP_GLOVI       KVGRIVREEMDATGAQEALFCQLQPAEIWKESGRWTVYTQ-DGTMFTLKDGQGEQAREYG
SYP_HELPY       KIENITHKRMQEHGAQNILMSFVVLASLWEKSGRLDKYGK---ELLVFKDRKD---NDFV
SYP_HELPJ       KIENVTHKRMQEHGAQNILMSFVVLASLWEKSGRLDKYGK---ELLVFKDRKD---NDFV
SYP_CAMJE       KIKNIVKEEMDKAGAQEVNLSFITPASLWQESGRYNVFGK---ELLRFKDRKE---NEFV
SYP_CAMJR       KIKNIVKEEMDKAGAQEVNLSFITPASLWQESGRYNVFGK---ELLRFKDRKE---NEFV
SYP_HELHP       KVRFIVKEEMDKSGAQEILMGFVTPAELWRESGRYEQYGR---ELLRFVDRKE---NEFV
SYP_WOLSU       KIRQVVKEEMDQAGAQEVMLGFVTPAELWRNSGRFEKYGK---ELLRFKDRKE---NDFV
SYP_SHIBS       KVENIVREEMNNAGAIEVSMPVVQPADLWQESGRWEQYGP---ELLRFVDRGE---RPFV
SYP_SHIFL       KVENIVREEMNNAGAIEVSMPVVQPADLWQESGRWEQYGP---ELLRFVDRGE---RPFV
SYP_SHISS       KVENIVREEMNNAGAIEVSMPVVQPADLWQESGRWEQYGP---ELLRFVDRGE---RPFV
SYP_ECOLI       KVENIVREEMNNAGAIEVSMPVVQPADLWQESGRWEQYGP---ELLRFVDRGE---RPFV
SYP_ECO57       KVENIVREEMNNAGAIEVSMPVVQPADLWQESGRWEQYGP---ELLRFVDRGE---RPFV
SYP_SHIDS       KVENIVREEMNNAGAIEVSMPVVQPADLWQESGRWEQYGP---ELLRFVDRGE---RPFV
SYP_ECOL6       KVENIVREEMNNAGAIEVLMPVVQPSELWQESGRWEQYGP---ELLRIADRGD---RPFV
SYP_ECOUT       KVENIVREEMNNAGAIEVLMPVVQPSELWQESGRWEQYGP---ELLRIADRGD---RPFV
SYP_SALPA       KVENIVREEMNNAGAIEVSMPVVQPADLWQESGRWEQYGP---ELLRFVDRGE---RPFV
SYP_SALTI       KVENIVREEMNNAGAIEVSMPVVQPADLWQESGRWEQYGP---ELLRFVDRGE---RPFV
SYP_SALTY       KVENIVREEMNNAGAIEVSMPVVQPADLWQESGRWEQYGP---ELLRFVDRGE---RPFV
SYP_SALCH       KVENIVREEMNNAGAIEVSMPVVQPADLWQESGRWEQYGP---ELLRFVDRGE---RPFV
SYP_YERPE       KVENIVREEMNNAGAIEVSMPVVQPADLWQESGRWEQYGP---ELLRFVDRGE---RPFV
SYP_YERPS       KVENIVREEMNNAGAIEVSMPVVQPADLWQESGRWEQYGP---ELLRFVDRGE---RPFV
SYP_PECAS       KVENIVREEMNNAGAIEVSMPVVQPADLWVESGRWDQYGP---ELLRFVDRGE---RPFV
SYP_SODGM       KVENIVREEMDNAGAIEVSMPVVQPADLWQESGRWVQYGP---ELLRFTDRGA---RAFV
SYP_PHOLL       KVEKIVREEMNNTGAIEISMPVVQPADLWQESGRWEQYGP---ELLRFVDRGD---RPFV
SYP_HAEIN       KVEKVVREEMNKGGAIEVLMPVVQPAELWEESGRWDQYGP---ELLRFEDRGN---RNFV
SYP_HAEI8       KVEKVVREEMNKGGAIEVLMPVVQPAELWEESGRWDQYGP---ELLRFEDRGN---RNFV
SYP_MANSM       KVKNIIREEMNKSGAIEVLMPVVQPAELWQESGRWEQYGL---ELLRFNDRGN---RDFV
SYP_HAEDU       KVENIIREEMNKGGAIEILMPVVQPAELWQESSRWEQYGP---ELLRFADRGK---RDFV
SYP_PASMU       KVEKIIREEMDKSGALEVKMAVTQPAELWQESGRWEEYGP---ELLRFKDRGE---RDFV
SYP_BAUCH       KVENIVREEMNNIGAIEVSMPIVQPANLWLESGRWGQYGP---ELLRFTDRST---RQFL
SYP_VIBVU       KVENIVRQEIDNAGAIETLMPVVQPFELWEETGRSEKMGP---ELLRFTDRHV---RPFV
SYP_VIBVY       KVENIVRQEIDNAGAIETLMPVVQPFELWEETGRSEKMGP---ELLRFTDRHV---RPFV
SYP_VIBPA       KVENIVRQEIDNAGAVETLMPVVQPFELWEETGRSEKMGP---ELLRFTDRHV---RPFV
SYP_ALIF1       KVENIVRQEIDNAGAIETLMPVVQPFELWEETGRSEKMGP---ELLRFTDRHV---RPFV
SYP_VIBCH       KVENIVRQEIDNAGAIETLMPVVQPFELWEETGRSEKMGP---ELLRFTDRHE---RPFV
SYP_PHOPR       KVENIVRQEIDNAGAVEILMPVVQPFELWEETGRSEKMGP---ELLRFTDRHS---RPFV
SYP_SHEON       KVEAIVREEMNKAGAIEILMPMVQPADLWVETGRWDKFGP---ELLRFKDRHN---RDFV
SYP_PSE14       KVEAIVREEMDAAGALEILMPGIQPAELWQESGRWEQYGP---ELMRLVDRHN---REFC
SYP_PSEU2       KVEAIVREEMDAAGALEILMPGIQPAELWQESGRWEQYGP---ELMRLVDRHN---REFC
SYP_PSESM       KVEAIVREEMNAVGALEILMPGIQPAELWQESGRWEQYGP---ELMRLVDRHN---REFC
SYP_PSEF5       KVEAIVREEMNAAGALEVLMPSTQPAELWQESGRWEEYGP---ELLRFKDRHG---RDFC
SYP_PSEPF       KVEAIVREEMDAAGSLEVLMPSTQPAELWQESGRWEEYGP---ELLRIKDRHG---RDFC
SYP_PSEPK       KVEAVVREEMNAAGALEVLMPSIQPAELWQESGRWEQYGP---ELLRLKDRHQ---RDFC
SYP_PSEAE       KVETIVREEMNAAGALEVLMPAVQPAELWQESGRWEQYGP---ELLRLKDRHE---REFC
SYP_CHRSD       KVENIVREEMNRAGAQEVLMPSIQPAELWQESGRWDQYGN---LLLRIRDRHE---RDFC
SYP_PSYA2       KVERIVREEMQNIGAQEVLMPMTQPAELWQMTGRFNDYGP---ELLRFKDRHD---RDFV
SYP_PSYCK       KVERIVREEMQNIGAQEVLMPMTQPAELWQLTGRFNDYGP---ELLRFKDRHD---RDFV
SYP_ACIAD       KVEAIVREEMNRSGALEVFMPVTQPASLWEESGRYVQYGP---ELLRFKDRHD---NPFV
SYP_HAHCH       KVENIVREEMDRSGAQEVLMPAVQPAELWIESGRWEQYGG---ELLRIHDRHN---RDFC
SYP_SACD2       KVETIVREEMDRAGAQEVLMPVVQPAELWEESGRWQQYGP---ELLRINDRHD---RAFC
SYP_COLP3       KVEQIVREEMQRAGGNEILMPMVQPADLWQESGRLDDYGP---ELLRINDRHK---RPFV
SYP_IDILO       KVENVVREEMEAINALEILMPMVQPADLWQESGRWDDYGP---ELLRIKDRNQ---RDFL
SYP_PSEHT       KVENIVREEMNKANAIEMLMPVIQPADLWEESGRWDEFGP---ELMRFTDRHN---RTFA
SYP_HYDCU       KVEAIIRDEMNKAQAQELLMPVVQPMELWEESGRAEAYGP---ELLRFKDRHQ---REFA
SYP_COXBU       KVADVVREEMNRAGALELLMPIVQPASLWQESGRWEAYGA---ELLRIMDRHQ---NGFC
SYP_NITOC       KVENIIREEMDKAGAQEVLMPAVQPAELWRETGRWEQYGP---ELLRFTDRHQ---RFFC
SYP_METCA       RVERVVREEMDRAGALEVLMPVVQPAELWQESGRWEQYGP---ELARLHDRHD---RAFC
SYP_LEGPA       KVENIVREEMNKTHAMELLMPSVQPAELWQETGRWETFGG---QLLTMKDSNQ---REYC
SYP_LEGPL       KVENIVREEMNKTHAMELLMPSVQPAELWQETGRWETFGG---QLLTMKDSNQ---REYC
SYP_LEGPH       KVENIVREEMNKTHAMELLMPSVQPAELWQETGRWETFGG---QLLTMKDSNQ---REYC
SYP_FRATH       KIQNIVRDEMNKAGASELLLPSILPSELLQETHRWDKFGP---ELLKLHDRHN---RDFC
SYP_FRATT       KIQNIVRDEMNKAGASELLLPSILPSELLQETHRWDKFGP---ELLKLHDRHN---RDFC
SYP_BORBR       KIEGIVREEMNAAGAIELLMPVVQPAELWMESGRWEQYGA---ELLRIKDRHQ---RDFV
SYP_BORPE       KIEGIVREEMNAAGAIELLMPVVQPAELWMESGRWEQYGA---ELLRIKDRHQ---RDFV
SYP_BORPA       KIEGIVREEMNAAGAIELLMPVVQPAELWMESGRWEQYGA---ELLRIKDRHQ---RDFV
SYP_BORA1       KVEHIIREEMNASGAIELLMPVVQPAELWQESGRWEQYGQ---ELLRIKDRHQ---RDFV
SYP_AROAE       KVEDIVRDEMNRAGALELTMPLVQPAELWDETGRWEQMGA---EMLRFKDRHQ---RDFA
SYP_RHOFT       KVEQIVREEMNRAGAVELVMPVVQPAELWQETGRFESNGP---ELLRIKDRHG---RDFV
SYP_BURP1       KVEAIVREEMNRAGAIELLMPAVQPAELWQESGRWEQYGP---ELLRFKDRKQ---NEFV
SYP_BURPS       KVEAIVREEMNRAGAIELLMPAVQPAELWQESGRWEQYGP---ELLRFKDRKQ---NEFV
SYP_BURMA       KVEAIVREEMNRAGAIELLMPAVQPAELWQESGRWEQYGP---ELLRFKDRKQ---NEFV
SYP_BURTA       KVEAIVREEMNRAGAIELLMPAVQPAELWQESGRWEQYGP---ELLRFKDRKQ---NEFV
SYP_BURL3       KVEAIVREEMNRAGGIELLMPAVQPAELWQESGRWEQYGP---ELLRFKDRKD---NDFV
SYP_CUPPJ       KVENIVREEMNRAGAVELSMPVIQPAELWQETGRWDKMGP---ELLRLKDRHE---RDFA
SYP_CUPMC       KVENIVREEMNRAGAVELSMPVIQPAELWQETGRWDKMGP---ELLRLKDRHE---RDFA
SYP_RALSO       KVEQIVREEMNASGAVEVLMPVVQPAELWQETGRWDKMGD---EMMRVKDRHE---RDLV
SYP_CHRVO       KVETIIREEMNRAGGIEVSLPVVQPAELWQETGRWDAMGA---ELLRFKDRHE---RDFA
SYP_NEIMA       KVENVVREEMARAGSVELLMPVVQPAELWQESGRWEFYGK---ELLRLKDRHD---RDFC
SYP_NEIMB       KVENVVREEMARAGSVELLMPVVQPAELWQESGRWEFYGK---ELLRLKDRHD---RDFC
SYP_NEIG1       KVENVVREEMARAGSVELLMPVVQPAELWQESGRWEFYGK---ELLRLKDRHE---RDFC
SYP_NITEU       KIEHIIREEMNNSGALELLMPAVHPAELWQETGRWDVFGP---QMLKIQDRHK---HDFC
SYP_NITMU       KVENIVREEMDAAGALELLMPAVQPAELWRETGRWDVFGP---QMLKIRDRHE---RDFC
SYP_THIDA       RVEAVVREEMNRAGAIELLMPAVQPAELWQETGRWAQFGP---QMLKIKDRHE---REFC
SYP_DECAR       KVENIVREEMNNAGALELLMPAVQPAELWQESGRWEQYGP---ELLRFKDRHQ---REFV
SYP_XANAC       KVEAIVREEMNRAGAVEVLFPTIQPRELWDATGRWEKFGG---QLLKIKDRKE---QEFC
SYP_XANC5       KVEAIVREEMNRAGAVEVLFPTIQPRELWDATGRWEKFGG---QLLKIKDRKE---QEFC
SYP_XANOM       KVEAIVREEMDRAGAVEVLFPTIQPRELWDATGRWEKFGG---QLLKIKDRKE---QEFC
SYP_XANOR       KVEAIVREEMDRAGAVEVLFPTIQPRELWDATGRWEKFGG---QLLKIKDRKE---QEFC
SYP_XANC8       KVEAIVREEMNRAGAVEVLFPTIQPRELWDATGRWEKFGG---QLLKIKDRKE---QEFC
SYP_XANCP       KVEAIVREEMNRAGAVEVLFPTIQPRELWDATGRWEKFGG---QLLKIKDRKE---QEFC
SYP_XYLFA       KVEAIVRDEMNRAGAVEMLLPTIQPRELWEESERWEKFGN---QLLKIKDRKQ---AEYC
SYP_XYLFT       KVEAIVRDEMNRAGAVEMLLPTIQPRELWEESERWEKFGS---QLLKIKDRKQ---AEYC
SYP_BUCAI       KIKNIITTEMEKINALEILMPIIQPEYLWKESRRLNLYGE---ELLRFLDRRK---NQFI
SYP_BUCAP       KIKDIIKNEMRKINALEVLMPVVQPKKLWENSGRLSIYGE---ELFQFYDRRN---QKFI
SYP_BUCBP       KVIRIIKNEMKQCGAMEIAMPFLQKKNLWDLSKRVITYGQ---ELFQVTDRTN---KKFI
SYP_BLOFL       KIENIIHEEMNKIGFLEIFMPITQPANLWKQSGRWSEYGL---ELLRFKNRTN---QKFV
SYP_BLOPB       KIENIIREEMSKIGAIEIAMPIVQPARLWKKSGRWTGYGT---ELLRFKNRNN---QEFV
SYP_WIGBR       KIENIIRHEMNKIGAIEILMPIIQPSLIWKNSGRYEEYGL---ELLKFYDRKK---KQFV
                .   :   .:      :              : *          :    :          

SYP_AQUAE       LGPTHEEEITDLVRRVVRSYRQLPVILYQIQVKFRDEKRPRFGLIRAREFIMKDAYSFDT
SYP_THEMA       LGPTHEEIVTDLVKNELRSYKQLPLTLYQIANKYRDEIRPRFGLLRAREFIMKDAYSFHA
SYP_BACSU       LGATHEEVITSLVRDEVKSYKRLPLTLYQIQSKFRDEKRPRFGLLRGREFIMKDAYSFHA
SYP_BACLD       LGATHEEVITSIVRDEVKSYKRLPLTLYQIQSKFRDEKRPRFGLLRGREFIMKDAYSFHS
SYP1_BACAN      LGATHEEVITDLVRDEVKSYKKLPLTLYQIQTKFRDEQRPRFGLLRGREFLMKDAYSFHA
SYP1_BACCZ      LGATHEEVITDLVRDEVKSYKKLPLTLYQIQTKFRDEQRPRFGLLRGREFLMKDAYSFHA
SYP1_BACHK      LGATHEEVITDLVRDEVKSYKKLPLTLYQIQTKFRDEQRPRFGLLRGREFLMKDAYSFHA
SYP1_BACC1      LGATHEEVITDLVRDEVKSYKKLPLTLYQIQTKFRDEQRPRFGLLRGREFLMKDAYSFHA
SYP1_BACCR      LGATHEEVITDLVRDEVKSYKKLPLTLYQIQTKFRDEQRPRFGLLRGREFLMKDAYSFHA
SYP_GEOKA       LGPTHEEMITAIVRDEVKTYKRLPLVLYQIQTKFRDEKRPRFGLLRGREFMMKDAYSFHT
SYP_LISMF       LGPTHEEVITALLRDEVKSYKRLPLTLYQIQTKFRDEKRPRFGLLRGREFIMKDAYSFHA
SYP_LISMO       LGPTHEEVITALLRDEVKSYKRLPLTLYQIQTKFRDEKRPRFGLLRGREFIMKDAYSFHA
SYP_LISIN       LGPTHEELITSLLRDEIKSYKRLPITLYQIQTKFRDEKRPRFGLLRGREFIMKDAYSFHA
SYP_STAA3       LGPTHEELVTSIVRNELKSYKQLPMTLFQIQSKFRDEKRPRFGLLRGREFIMKDAYSFHA
SYP_STAA8       LGPTHEELVTSIVRNELKSYKQLPMTLFQIQSKFRDEKRPRFGLLRGREFIMKDAYSFHA
SYP_STAAC       LGPTHEELVTSIVRNELKSYKQLPMTLFQIQSKFRDEKRPRFGLLRGREFIMKDAYSFHA
SYP_STAAM       LGPTHEELVTSIVRNELKSYKQLPMTLFQIQSKFRDEKRPRFGLLRGREFIMKDAYSFHA
SYP_STAAN       LGPTHEELVTSIVRNELKSYKQLPMTLFQIQSKFRDEKRPRFGLLRGREFIMKDAYSFHA
SYP_STAAW       LGPTHEELVTSIVRNELKSYKQLPMTLFQIQSKFRDEKRPRFGLLRGREFIMKDAYSFHA
SYP_STAAS       LGPTHEELVTSIVRNELKSYKQLPMTLFQIQSKFRDEKRPRFGLLRGREFIMKDAYSFHA
SYP_STAAR       LGPTHEELVTSIVRNELKSYKQLPMTLFQIQSKFRDEKRPRFGLLRGREFIMKDAYSFHA
SYP_STAAB       LGPTHEELVTSIVRNELKSYKQLPMTLFQIQSKFRDEKRPRFGLLRGREFIMKDAYSFHA
SYP_STAHJ       LGPTHEEVVTSIVRDELKSYKQLPLTLFQIQSKFRDEKRPRFGLLRGREFIMKDAYSFHA
SYP_STAS1       LGPTHEEVVTSIVRDELKSYKQLPLTLFQIQSKYRDEKRPRFGLLRGREFIMKDAYSFHA
SYP_STAES       LGPTHEEVVTSLVRDELKSYKQLPLTLFQIQSKYRDEKRPRFGLLRGREFLMKDAYSFHS
SYP_STAEQ       LGPTHEEVVTSLVRDELKSYKQLPLTLFQIQSKYRDEKRPRFGLLRGREFLMKDAYSFHS
SYP_BACHD       LGPTHEEVITSLIRDSINSYKKLPLNVYQIQSKFRDERRPRFGLLRGREFIMKDAYSFHT
SYP_BACSK       LGPTHEEVITSLIKDGIASYKKLPLCVYQVQTKFRDERRPRFGLLRGREFIMKDAYSFHD
SYP_LACPL       LGPTHEETFTSIVRDEIKSYKRLPLTLYQIQAKYRDEDRPRYGLLRGREFIMKDAYSFHA
SYP_LACSS       LGPTHEETFADLVRNNIKSYKKLPLTLYQIQTKYRDEDRPRYGLLRGREFIMQDAYSFSA
SYP_ENTFA       LGPTHEETFTELIRDEINSYKRLPLNLYQIQTKYRDEKRSRSGLLRGREFIMKDGYSFHA
SYP_LACS1       LGPTHEETFTTIVRDAIKSYKKLPLYLYQIQMKYRDENRPRFGLLRGREFLMLDGYSFHV
SYP_STRA3       LGPTHEETFTTLVRDAVKSYKQLPLNLYQIQSKYRDEKRPRNGLLRTREFIMKDGYSFHK
SYP_STRA5       LGPTHEETFTTLVRDAVKSYKQLPLNLYQIQSKYRDEKRPRNGLLRTREFIMKDGYSFHK
SYP_STRA1       LGPTHEETFTTLVRDAVKSYKQLPLNLYQIQSKYRDEKRPRNGLLRTREFIMKDGYSFHK
SYP_STRP1       LGPTHEETFTTLVRDAVKSYKQLPLNLYQIQSKYRDEKRPRNGLLRTREFIMKDGYSFHH
SYP_STRPM       LGPTHEETFTTLVRDAVKSYKQLPLNLYQIQSKYRDEKRPRNGLLRTREFIMKDGYSFHH
SYP_STRP3       LGPTHEETFTTLVRNAVKSYKQLPLNLYQIQSKYRDEKRPRNGLLRTREFIMKDGYSFHH
SYP_STRPF       LGPTHEETFTTLVRDAVKSYKQLPLNLYQIQSKYRDEKRPRNGLLRTREFIMKDGYSFHH
SYP_STRP8       LGPTHEETFTTLVRNAVKSYKQLPLNLYQIQSKYRDEKRPRNGLLRTREFIMKDGYSFHH
SYP_STRP6       LGPTHEETFTTLVRDAVKSYKQLPLNLYQIQSKYRDEKRPRNGLLRTREFIMKDGYSFHH
SYP_STRPB       LGPTHEETFTTLVRDAVKSYKQLPLNLYQIQSKYRDEKRPRNGLLRTREFIMKDGYSFHH
SYP_STRPC       LGPTHEETFTTLVRDAVKSYKQLPLNLYQIQSKYRDEKRPRNGLLRTREFIMKDGYSFHH
SYP_STRPD       LGPTHEETFTTLVRDAVKSYKQLPLNLYQIQSKYRDEKRPRNGLLRTREFIMKDGYSFHH
SYP_STRT1       LGPTHEETFTVLVRDAVKSYKQLPLNLYQIQSKYRDEKRPRNGLLRTREFIMKDAYSFHQ
SYP_STRT2       LGPTHEETFTVLVRDAVKSYKQLPLNLYQIQSKYRDEKRPRNGLLRTREFIMKDAYSFHQ
SYP_STRMU       LGPTHEETFTNLIRDAVKSYKQLPLNLYQIQAKYRDEKRPRNGLLRTREFIMKDGYSFHA
SYP_STRPN       LGPTHEETFTAIVRDSVKSYKQLPLNLYQIQPKYRDEKRPRNGLLRTREFIMKDAYSFHA
SYP_STRR6       LGPTHEETFTAIVRDSVKSYKQLPLNLYQIQPKYRDEKRPRNGLLRTREFIMKDAYSFHA
SYP_LACLA       LGPTHEETMTSLVRDEITSYKKLPLNVYQIAPKFRDEKRPRYGLLRGREFLMKDGYSYHA
SYP_LACAC       LGPTHEETFTEIIAKNLKSYKQMPLALYQIQTKFRDENRPRFGLLRGREFVMLDGYSFAA
SYP_LACJO       LGPTHEETFTEIVAKNLKSYKQMPLALYQIQTKFRDENRPRFGLLRGREFVMLDGYSFAA
SYP_FUSNN       LSPTQEEMITAIIRSDISSYKSLPINLYHIQTKFRDERRPRFGLMRGREFTMKDAYSFHT
SYP_DEHM1       LGPTHEEVITDLASRYIQSYRDLPQRLYQIQTKFRDEPRPRGGLIRVREFIMKDMYSFDA
SYP_DEHMC       LGPTHEEVITDLASRYIQSYRDLPQRLYQIQAKFRDEPRPRGGLIRVREFIMKDMYSFDA
SYP1_ANADE      LGMTHEEIFTAIARDELRSYRQLPQVWYQIQTKFRDEPRPKSGLLRVRQFTMKDAYSFDV
SYP_CARHZ       LGPTHEEIITDLVRREVRSYKELPLLLYQIQNKYRDEKRPRFGLMRGREFIMKDLYSFDR
SYP_MOOTA       LGPTHEEIITALVRSEVTSYKQLPLLLYQIQNKYRDERRPRFGLLRGREFIMKDLYSFDL
SYP_DESHY       LGPTHEEIITDLIRGEIRSYKQLPLLLYQIQNKYRDERRPRFGLMRGREFIMKDLYSFDR
SYP_CLOAB       LGPTHEEVFTDFARSEIKSYKQLPVNLYQIQTKYRDERRPRFGMIRSREFVMKDAYSFDK
SYP_CLOTE       LGPTHEEVFTDIARNEINSYKQLPLNLYQIQTKYRDERRPRFGLMRSREFIMKDAYSFDK
SYP_CLOPE       LGPTHEEVFTDIVRNEIKSYKQLPLNLYQIQTKYRDERRPRFGVMRSREFIMKDGYSFDK
SYP_CALS4       LGPTHEEVFTDLVRNEVKSYRQLPLILYQIQTKFRDERRPRFGVMRSREFIMKDAYSFDA
SYP_DESAG       LGPTHEEVITDLVRGEVRSYRQLPLNLYQIQTKFRDEIRPRFGLMRGREFMMKDAYSFDR
SYP_DESVH       LGPTHEEVITDLVRGEVRSYRQLPINLYQIQTKFRDEIRPRFGLMRGREFVMKDAYSFDR
SYP_LAWIP       LGPTHEEVVTHLLRGEVRSYRQLPINVYQIQTKFRDEIRPRFGLMRAREFLMKDAYSFDQ
SYP_GEOMG       LGPTHEEVITDLVRREVKSYRQLPLNLYQVQSKFRDEIRPRFGLMRGREFIMKDAYSFDV
SYP_GEOSL       LGPTHEEVVTDIVRREVKSYRQMPFNLYQIQAKFRDEIRPRFGLMRGREFIMKDAYSFDV
SYP_PELCD       LGPTHEEVITDLVRNTVRSYRQLPLNLYQIQGKFRDEIRPRFGLMRGREFIMKDAYSFDI
SYP_DESPS       LGPTHEEVITDIVRNELSSYRDLPINLYQIQTKFRDEIRPRFGLMRGREFVMKDAYSFDV
SYP_SYNAS       LGPTHEEVITDLVRHEIKTYRQLPKNLYQIQTKFRDEIRPRFGVMRGREFGMKDAYSFDA
SYP_MYCTU       LGPTHEELFTLTVKGEYSSYKDFPLTLYQIQTKYRDEARPRAGILRAREFVMKDSYSFDI
SYP_MYCBO       LGPTHEELFTLTVKGEYSSYKDFPLTLYQIQTKYRDEARPRAGILRAREFVMKDSYSFDI
SYP_MYCPA       LGPTHEELFTLTVKGEYSSYKDFPVLLYQIQNKYRDEARPRAGILRVREFVMKDSYSFDI
SYP_NOCFA       LGPTHEELFALTVKGEYNSYKDLPVTLYQIQTKYRDEERPRAGILRGREFVMKDSYSFDL
SYP_COREF       LGPTHEEMFASTVKDLYSSYKDFPVTLYQIQTKYRDEERPRAGILRGREFVMKDSYSFDM
SYP_CORGL       LGPTHEEMFAATVKDLYNSYKDFPVTLYQIQTKYRDEERPRAGVLRGREFVMKDSYSFDI
SYP_CORDI       LGPTHEEMFASAVKDMYSSYKDFPVTLYQIQTKYRDEERPRAGILRGREFVMKDSYSFDM
SYP_CORJK       LGPTHEEMFTSVVKSEYNSYKDFPVILYQVQTKYRDEERPRAGILRGREFIMKDSYSFNM
SYP_THEFY       LGPTHEELFTLLVKGEYTSYKDYPVILYQIQEKFRDEARPRAGILRGREFHMKDSYSFDL
SYP_LEIXX       LAPTHEEAFTLLVKDLYSSYKDLPLTIFQIQDKYRDEARPRAGLLRGREFTMKDAYSFDA
SYP_CUTAK       LGPTHEEMFTLMVKDLYSSYKDLPLCLYQIQNKYRDEARPRAGILRGREFVMMDAYSFDV
SYP_BIFLO       LAPTHEEMFTLLVKDMYSSYKDLPVTLYQIQTKYRDEFRPRAGLIRGREFVMKDAYSFTI
SYP_STRCO       LGPTHEEIFTLLVKDQASSYKDLPVILYQIQNKYRDEARPRAGILRGREFLMKDSYSFDV
SYP1_STRAW      LGPTHEEIFTQLVKDQCSSYKDLPVILYQIQAKYRDEARPRAGILRGREFLMKDSYSFDT
SYP_TROW8       LAPTHEEAFTQMMKEICTSYRDLPRTVYQIQDKYRDELRPRAGLLRSREFSMKDAYSFDL
SYP_TROWT       LAPTHEEAFTQMMKEICTSYRDLPRTVYQIQDKYRDELRPRAGLLRSREFSMKDAYSFDL
SYP_TREPA       FSPTAEESFTALVRGDCTSYKHFPLSLYQINAKYRDEIRPRYGLMRAREFTMADAYSFHT
SYP_TREDE       VSPTAEEAFTALLKNELSSYKNYPLLTYQINTKYRDEIRPRYGLMRTREFTMKDAYSFHT
SYP_LEPIC       LGPTHEESFSFLLKPLLKSYKDLPVNVYQIQTKFRDEIRPRFGVIRSREFIMKDAYSFHI
SYP_LEPIN       LGPTHEESFSFLLKPLLKSYKDLPVNVYQIQTKFRDEIRPRFGVIRSREFIMKDAYSFHI
SYP_CHLTR       LAPTHEEVVSEFVAQWLTGREQLPIHLYQIGTKFRDEIRPRFGLMRAKEFLMEDSYTFSD
SYP_CHLTA       LAPTHEEVVSEFVAQWLTGREQLPIHLYQIGTKFRDEIRPRFGLMRAKEFLMEDSYTFSD
SYP_CHLMU       LAPTHEEVVSEFVSQWLTGRKQLPVHLYQIGTKFRDEIRPRFGLMRAKEFLMEDSYTFSD
SYP_CHLCV       LAPTHEEVVSMFVSQWLSGRKQLPIHLYQIATKFRDEIRPRFGLMRAREFLMEDSYTFSD
SYP_CHLFF       LAPTHEEVVTMFVSQWLSGRKQLPIHLYQIATKFRDEIRPRFGLMRAREFLMEDSYTFSD
SYP_CHLAB       LAPTHEEIVSMFVSQWLSGRKQLPIHLYQIATKFRDEIRPRFGLMRAKEFLMEDSYTFSD
SYP_CHLPN       LAPTHEEVICSFVAQWLSSKRQLPLHLYQIATKFRDEIRPRFGLIRSRELLMEDSYTFSD
SYP_NOSS1       LGPTHEEVITAIARDMIRSYRQLPLHLYQLQTKFRDEIRPRFGLMRGREFIMKDGYSFHV
SYP_TRIV2       LGPTHEEVITAIARDMIRSYRQLPLHLYQLQTKFRDEIRPRFGLMRGREFIMKDGYSFHV
SYP_SYNP6       LGPTHEEVITAVARDLIRSYRQLPQNLYQIQTKFRDEIRPRFGLMRGREFIMKDAYSFHA
SYP_SYNE7       LGPTHEEVITAVARDLIRSYRQLPQNLYQIQTKFRDEIRPRFGLMRGREFIMKDAYSFHA
SYP_SYNY3       LGPTHEEVITAIAKEMIRSYRQLPVNLYQIQTKFRDEIRPRFGLMRGREFIMKDAYSFHS
SYP_THEEB       LGPTHEEVITALAKDLIRSYRQLPVHLYQIQTKFRDEIRPRFGLMRGREFIMKDGYSFHA
SYP_SYNJA       LGPTHEEVITLLARDLIRSYRQLPQILYQIQTKFRDEIRPRFGLLRGREFLMKDAYSFHA
SYP_SYNJB       LGPTHEEVITLLARDLIRSYRQLPQTLYQIQTKFRDEIRPRFGLMRGREFIMKDAYSFHA
SYP_PROM9       LAPTHEEVITSIASEIINSYKQLPQCFYQIQTKFRDEIRPRFGLMRSREFIMKDGYSFHS
SYP_PROMP       LAPTHEEVITSIASEMINSYKQLPLCFYQIQTKFRDEIRPRFGLMRSREFIMKDAYSFHS
SYP_PROMA       LGPTHEEVITKIANEFLQSYKQLPVNLYQIQTKFRDEIRPRFGLMRSREFIMKDAYSFHA
SYP_PROMT       LGPTHEEVITQIISQTIHSYKQLPINIFQIQTKFRDEIRPRFGLMRSREFIMKDAYSFHA
SYP_SYNPX       LGPTHEEVITSLAGELLRSYRQLPVNLYQVQTKFRDEIRPRFGLMRGREFIMKDAYSFHA
SYP_SYNS9       LGPTHEEVVTSLAGELLQSYKQLPVNLYQVQTKFRDEIRPRFGLMRGREFIMKDAYSFHA
SYP_SYNSC       LGPTHEEVITSLAGELLRSYRQLPVNLYQIQTKFRDEIRPRFGLMRGREFIMKDAYSFHA
SYP_PROMM       LGPTHEEVITSLAGDLLRSYRQLPVTLYQIQSKFRDEIRPRFGLMRGREFIMKDAYSFHS
SYP_GLOVI       LGPTHEEAVCDFVRASLNSYKQLPFHLYQVQTKFRNEKRPRFGLMRGREFIMKDGYSFHA
SYP_HELPY       LSPTLEENITEIAANFIKSYKQLPVHLYQIHTKFRDEIRPRFGLVRAREFIMKDGYSFHE
SYP_HELPJ       LSPTLEENITEIAANFIKSYKQLPVHLYQIHTKFRDEIRPRFGLVRAREFIMKDGYSFHE
SYP_CAMJE       LGPTHEEAMLSLVKNKITSYKQLPLHLYQIGLKFRDEARPRFGLLRCREFLMKDGYSFHA
SYP_CAMJR       LGPTHEEAMLSLVKNKITSYKQLPLHLYQIGLKFRDEARPRFGLLRCREFLMKDGYSFHA
SYP_HELHP       LGPTHEEVITHIAKNTIKSYKQLPLHLYQIHSKFRDELRPRFGLMRGREFIMKDGYSFHS
SYP_WOLSU       LGPTHEEMVVELAKGYVKSYKQLPLHLYQIHLKFRDEIRPRFGLMRGREFVMKDGYSFHA
SYP_SHIBS       LGPTHEEVITDLIRNELSSYKQLPLNFYQIQTKFRDEVRPRFGVMRSREFLMKDAYSFHT
SYP_SHIFL       LGPTHEEVITDLIRNELSSYKQLPLNFYQIQTKFRDEVRPRFGVMRSREFLMKDAYSFHT
SYP_SHISS       LGPTHEEVITDLIRNELSSYKQLPLNFYQIQTKFRDEVRPRFGVMRSREFLMKDAYSFHT
SYP_ECOLI       LGPTHEEVITDLIRNELSSYKQLPLNFYQIQTKFRDEVRPRFGVMRSREFLMKDAYSFHT
SYP_ECO57       LGPTHEEVITDLIRNELSSYKQLPLNFYQIQTKFRDEVRPRFGVMRSREFLMKDAYSFHT
SYP_SHIDS       LGPTHEEVITDLIRNELSSYKQLPLNFYQIQTKFRDEVRPRFGVMRSREFLMKDAYSFHT
SYP_ECOL6       LGPTHEEVITDLIRNELSSYKQLPLNFYQIQTKFRDEVRPRFGVMRSREFLMKDAYSFHT
SYP_ECOUT       LGPTHEEVITDLIRNELSSYKQLPLNFYQIQTKFRDEVRPRFGVMRSREFLMKDAYSFHT
SYP_SALPA       LGPTHEEVITDLVRNELSSYKQLPLNFFQIQTKFRDEVRPRFGVMRSREFLMKDAYSFHT
SYP_SALTI       LGPTHEEVITDLVRNELSSYKQLPLNFFQIQTKFRDEVRPRFGVMRSREFLMKDAYSFHT
SYP_SALTY       LGPTHEEVITDLVRNELSSYKQLPLNFFQIQTKFRDEVRPRFGVMRSREFLMKDAYSFHT
SYP_SALCH       LGPTHEEVITDLVRNELSSYKQLPLNFFQIQTKFRDEVRPRFGVMRSREFLMKDAYSFHT
SYP_YERPE       LGPTHEEVITDLIRGEINSYKQLPLNFFQIQTKFRDEVRPRFGVMRAREFLMKDAYSFHT
SYP_YERPS       LGPTHEEVITDLIRGEINSYKQLPLNFFQIQTKFRDELRPRFGVMRAREFLMKDAYSFHT
SYP_PECAS       LGPTHEEVITDLIRNEVSSYKQLPLNFFQIQTKFRDEVRPRFGVMRSREFLMKDAYSFHT
SYP_SODGM       LGPTHEEVITDLIRNEVSSYKQLPLNFYQIQTKFRDEVRPRFGVMRSREFVMKDAYSFHT
SYP_PHOLL       LGPTHEEVITDLIRNEVSSYKQLPLTLFQIQTKFRDEVRPRFGVMRSREFLMKDAYSFHA
SYP_HAEIN       LGPTHEEVITDLVRREVSSYKQLPLNLYQIQTKFRDEVRPRFGVMRSREFIMKDAYSFHT
SYP_HAEI8       LGPTHEEVITDLVRREVSSYKQLPLNLYQIQTKFRDEVRPRFGVMRSREFIMKDAYSFHT
SYP_MANSM       LGPTHEEVITDLVRREVSSYKQLPLNLYQIQTKFRDEVRPRFGVMRSREFIMKDAYSFHT
SYP_HAEDU       LGPTHEEVITDLVRRELSSYKQLPLNLYQIQTKFRDEVRPRFGVMRSREFVMKDAYSFHT
SYP_PASMU       IGPTNEEVITDLVRRELSSYKQLPLNLYHIQTKFRDEVRPRFGVMRSREFVMKDAYSFHT
SYP_BAUCH       LGPTHEEVITDLIRNEVKSYKQLPLNLFQIKTKFRDEVRPRYGVMRSREFIMKDAYSFHT
SYP_VIBVU       LSPTAEEVITALVRNEVSSYKQLPINLYQIQTKFRDERRPRFGVMRAREFCMMDAYSFDI
SYP_VIBVY       LSPTAEEVITALVRNEVSSYKQLPINLYQIQTKFRDERRPRFGVMRAREFCMMDAYSFDI
SYP_VIBPA       LSPTAEEVITSLVRNEVSSYKQLPLNLYQIQTKFRDERRPRFGVMRAREFCMMDAYSFDI
SYP_ALIF1       LSPTAEEVITSLVRNEVSSYKQLPLNLYQIQTKFRDERRPRFGVMRAREFCMMDAYSFDI
SYP_VIBCH       LSPTAEEVITALVRNEVSSYKQLPLNLYQIQTKFRDERRPRFGVMRAREFCMMDAYSFDI
SYP_PHOPR       LSPTAEEVVTSLVRNEISSYKQLPLNLYQIQTKFRDERRPRFGVMRAREFSMMDAYSFDI
SYP_SHEON       LGPTHEEVITDLIRKEVSSYKQLPLNLYQIQTKFRDEVRPRFGVMRSREFLMKDAYSFHL
SYP_PSE14       LGPTHEEVITDLARNELNSYKQLPINMYQIQTKFRDEIRPRFGLMRGREFVMKDAYSFHA
SYP_PSEU2       LGPTHEEVITDLARNELNSYKQLPINMYQIQTKFRDEIRPRFGLMRGREFVMKDAYSFHA
SYP_PSESM       LGPTHEEVITDLARNELNSYKQLPINMYQIQTKFRDEIRPRFGLMRGREFVMKDAYSFHA
SYP_PSEF5       AGPTHEEVITDLARNELSSYKQLPLNLYQIQTKFRDEIRPRFGLMRGREFIMKDAYSFHA
SYP_PSEPF       AGPTHEEVITDLMRNELSSYKQLPINLYQIQTKFRDEIRPRFGLMRGREFIMKDSYSFHA
SYP_PSEPK       VGPTHEEVITDLARNELSSYKQLPLNLYQIQTKFRDEIRPRFGLMRGREFIMKDAYSFHA
SYP_PSEAE       VGPTHEEVITDLARNELNSYKQLPINFYQIQTKFRDEIRPRFGLMRGREFIMKDAYSFHL
SYP_CHRSD       YGPTHEEVITDLVRNEIRSYKQLPSNFYQIQTKFRDETRPRFGVMRAREFIMKDAYSFDI
SYP_PSYA2       LGPTHEEVITNLAQGELRSYKQLPITFFQIQNKFRDEIRPRFGVMRAREFTMKDAYSFHV
SYP_PSYCK       LGPTHEEVITNLAQGELRSYKQLPITFFQIQNKFRDEIRPRFGVMRAREFTMKDAYSFHV
SYP_ACIAD       LGPTHEEVITDLARNELKSYKQLPINFYQIQTKFRDEIRPRFGVMRSREFIMKDAYSFHV
SYP_HAHCH       VGPTHEEVITDLIRNELKSYKQLPANFYQIQMKFRDERRPRFGIMRAREFLMKDAYSFHV
SYP_SACD2       LGPTHEEVITDLIRNELKSYKQLPANFYQIQTKFRDEVRPRFGVMRAREFLMKDAYSFHA
SYP_COLP3       LGPTHEEVVTKLVANELSSYKQLPLNVFQIQSKFRDEIRPRFGVMRGREFLMKDAYSFHL
SYP_IDILO       LGPTHEEIISQLVRKEVSSYKQLPLTLFQIQTKFRDEIRPRFGVMRAREFLMKDAYSFHL
SYP_PSEHT       LGPTHEEVITDFVRKEISSYKQLPISLYQIQTKVRDERRPRFGVMRAREFTMKDAYSFHL
SYP_HYDCU       LGPTHEEIITDLVRKEIRSYKQLPANFYQIQTKFRDEIRPRFGVMRSREFIMKDAYSFHM
SYP_COXBU       FGPTHEEVITDIARQELKSYKQLPLNFYQIQTKFRDEIRPRFGVMRSREFLMKDAYSFDL
SYP_NITOC       FGPTHEEVITDLIRREIRSYKQLPANFYQIQLKFRDEIRPRFGVMRSREFLMKDAYSFHP
SYP_METCA       LGPTHEEIITDLARNELKSYRQLPVNFYQIQTKFRDEIRPRFGVMRAREFVMKDAYSFHL
SYP_LEGPA       FGPTHEEVITDIMRNELQSYKQLPVNFYQIQTKFRDEIRPRFGVMRAREFIMKDAYSFHL
SYP_LEGPL       FGPTHEEVITDIMRNELQSYKQLPVNFYQIQTKFRDEIRPRFGVMRAREFIMKDAYSFHL
SYP_LEGPH       FGPTHEEVITDIMRNELQSYKQLPVNFYQIQTKFRDEIRPRFGVMRAREFIMKDAYSFHL
SYP_FRATH       YGPTHEEPIVDMARDTIKSYKQLPLNLYQIQTKFRDEIRPRFGVMRAREFIMKDAYSFHE
SYP_FRATT       YGPTHEEPIVDMARDTIKSYKQLPLNLYQIQTKFRDEIRPRFGVMRAREFIMKDAYSFHE
SYP_BORBR       LQPTSEEVITDIARNEIQSYRQLPLNFYHIQTKFRDERRPRFGLMRGREFTMKDAYSFDR
SYP_BORPE       LQPTSEEVITDIARNEIQSYRQLPLNFYHIQTKFRDERRPRFGLMRGREFTMKDAYSFDR
SYP_BORPA       LQPTSEEVITDIARNEIQSYRQLPLNFYHIQTKFRDERRPRFGLMRGREFTMKDAYSFDR
SYP_BORA1       LQPTSEEVITDIARNEIHSYRQLPVNFFHIQTKFRDERRPRFGVMRGREFTMKDAYSFDR
SYP_AROAE       LQPTSEEVVTDIARQELKSYRQLPKNFYQIQTKFRDERRPRFGVMRGREFTMKDAYSFDR
SYP_RHOFT       VQPTSEEVVTDIARQEIKSYKQLPKNLYQIQTKFRDERRPRFGLMRGREFIMKDAYSFDR
SYP_BURP1       IGPTHEEVVTDIARNQIKSYRQMPVNFYQIQTKFRDEIRPRFGVMRGREFIMKDAYSFDK
SYP_BURPS       IGPTHEEVVTDIARNQIKSYRQMPVNFYQIQTKFRDEIRPRFGVMRGREFIMKDAYSFDK
SYP_BURMA       IGPTHEEVVTDIARNQIKSYRQMPVNFYQIQTKFRDEIRPRFGVMRGREFIMKDAYSFDK
SYP_BURTA       IGPTHEEVVTDIARNQIKSYRQMPVNFYQIQTKFRDEIRPRFGVMRGREFIMKDAYSFDK
SYP_BURL3       IGPTHEEVITDIARNQIKSYRQMPVNFYQIQTKFRDEIRPRFGVMRGREFIMKDAYSFDK
SYP_CUPPJ       VQPTSEEVVTDIARSEIRSYKQLPVNFYQIQTKFRDERRPRFGIMRGREFTMKDAYSFDR
SYP_CUPMC       VQPTSEEVVTDIARTEIRSYKQLPVNFYQIQTKFRDERRPRFGIMRGREFTMKDAYSFDR
SYP_RALSO       IQPTSEEVVTDIARTEIRSYKQMPVNFYQIQTKFRDERRPRFGIMRGREFTMKDAYSFDR
SYP_CHRVO       LQPTAEEVITDIARRELRSYRALPKNFYQIQTKFRDERRPRFGVMRGREFTMKDAYSFDR
SYP_NEIMA       MGPTCEEVIADIVRKEINSYKQLPKNFYHIQTKFRDEVRPRFGVMRAREFVMKDAYSFHA
SYP_NEIMB       MGPTCEEVIADIVRKEINSYKQLPKNFYHIQTKFRDEVRPRFGVMRAREFVMKDAYSFHA
SYP_NEIG1       MGPTCEEVIADIVRKEINSYKQLPKNFYHIQTKFRDEVRPRFGVMRAREFVMKDAYSFHA
SYP_NITEU       FGPTHEEVIVDIARREIKSYRQLPINFYQIQTKFRDEIRPRFGVMRAREFIMKDAYSFHA
SYP_NITMU       FGPTHEEVITDIARREIKSYRQLPLNFYQIQTKFRDEVRPRFGVMRAREFVMKDAYSFHT
SYP_THIDA       FGPTHEEVITDLARREIKSYRQLPLNFYQIQTKFRDEIRPRFGVMRAREFLMKDAYSFHA
SYP_DECAR       IGPTHEEVITDVVRRDVKSYRQLPIHLYQIQTKFRDEIRPRFGVMRGREFLMKDGYSFHA
SYP_XANAC       YSPTAEEAAAEFARQEINSYKQLPLNFYQIQTKFRDEIRPRFGVMRAREFLMKDAYSFHL
SYP_XANC5       YSPTAEEAAAEFARQEINSYKQLPLNFYQIQTKFRDEIRPRFGVMRAREFLMKDAYSFHL
SYP_XANOM       YSPTAEEAAAEFARQEINSYKQLPLNFYQIQTKFRDEIRPRFGVMRAREFLMKDAYSFHL
SYP_XANOR       YSPTAEEAAAEFARQEINSYKQLPLNFYQIQTKFRDEIRPRFGVMRAREFLMKDAYSFHL
SYP_XANC8       YTPTAEEAAAEFARQEINSYKQLPLNFYQIQTKFRDEIRPRFGVMRAREFLMKDAYSFHL
SYP_XANCP       YTPTAEEAAAEFARQEINSYKQLPLNFYQIQTKFRDEIRPRFGVMRAREFLMKDAYSFHL
SYP_XYLFA       YSPTAEEAVTDYVRQELTSYKQLPVNLYQIQTKFRDEIRPRFGVMRAREFVMKDAYSFHL
SYP_XYLFT       YSPTAEEAVTDYVRQELTSYKQLPVNLYQIQTKFRDEIRPRFGVMRAREFVMKDAYSFHL
SYP_BUCAI       LGPTNEEVVTNFIGSEIHSYKQLPLTVYQIQTKFRDEIRPRFGIIRTREFTMKDAYSFHI
SYP_BUCAP       LGPTNEEVVTNFIRNEINSFKELPLIIYQIQTKFRDEIRPRFGIVRSREFIMKDAYSFHI
SYP_BUCBP       LGPTHEEMITYFIKNELQSYKQLPLILYQIQTKFRDEIRPRFGIIRTKEFMMKDAYSFHI
SYP_BLOFL       LGPTHEEMITDLVCNEILSHKQFPIKLYQINTKYRDEARPQFGVIRSKEFIMKDGYSFHI
SYP_BLOPB       LGPTHEEMVSEIICKETMLYKQFPLIVYQIHTKYRDEARPRSGVIRAREFIMKDGYSFHI
SYP_WIGBR       LAPTHEEVISKIILKEINFNKVFPINFYQIYSKFRDEARPRCGTMRSKEFVMKDSYSFHL
                   * **             .  *   :::  * *:* *.: * :* ::: * * *::  

SYP_AQUAE       DDMSAMISYEAMKFAYQRIFNKLRLNVIMAEADVGQIGG-KM-SHEFIAFTD--------
SYP_THEMA       SWESLDETYEQFKKAYSRIMERLGVRYMIIEAETGAIGG-NA-SHEFVVPAK--------
SYP_BACSU       SAESLDETYQKMYEAYSNIFARCGINVRPVIADSGAMGG-KD-THEFMALSA--------
SYP_BACLD       SAESLDETYNDMYQAYTNVFTRCGLNFRPVIADSGAMGG-KD-THEFMALSD--------
SYP1_BACAN      TQESLDEVYDRLYKAYSNIFARCGLNFRAVIADSGAMGG-KD-THEFMVLSD--------
SYP1_BACCZ      TQESLDEVYDRLYKAYSNIFARCGLNFRAVIADSGAMGG-KD-THEFMVLSD--------
SYP1_BACHK      TQESLDEVYDRLYKAYSNIFARCGLNFRAVIADSGAMGG-KD-THEFMVLSD--------
SYP1_BACC1      TQESLDEVYDRLYKAYSNIFARCGLNFRAVIADSGAMGG-KD-THEFMVLSD--------
SYP1_BACCR      TQESLDEVYDRLYKAYSNIFARCGLNFRAVIADSGAMGG-KD-THEFMVLSD--------
SYP_GEOKA       SKESLDETYNNMYEAYANIFRRCGLNFRAVIADSGAIGG-KD-THEFMVLSD--------
SYP_LISMF       TSESLDEVYNLMHQAYSNIFTRCGLEFRSVIADSGSIGG-NE-SKEFMALSD--------
SYP_LISMO       TSESLDEVYNLMHQAYSNIFTRCGLEFRSVIADSGSIGG-NE-SKEFMALSD--------
SYP_LISIN       TSESLDETFELMHQAYSNIFSRCGLEFRSVIADSGSIGG-NE-SKEFMALSD--------
SYP_STAA3       DEASLDQTYQDMYQAYSRIFERVGINARPVVADSGAIGG-SH-THEFMALSA--------
SYP_STAA8       DEASLDQTYQDMYQAYSRIFERVGINARPVVADSGAIGG-SH-THEFMALSA--------
SYP_STAAC       DEASLDQTYQDMYQAYSRIFERVGINARPVVADSGAIGG-SH-THEFMALSA--------
SYP_STAAM       DEASLDQTYQDMYQAYSRIFERVGINARPVVADSGAIGG-SH-THEFMALSA--------
SYP_STAAN       DEASLDQTYQDMYQAYSRIFERVGINARPVVADSGAIGG-SH-THEFMALSA--------
SYP_STAAW       DEASLDQTYQDMYQAYSRIFERVGINARPVVADSGAIGG-SH-THEFMALSA--------
SYP_STAAS       DEASLDQTYQDMYQAYSRIFERVGINARPVVADSGAIGG-SH-THEFMALSA--------
SYP_STAAR       DEASLDQTYQDMYQAYSRIFERVGINARPVVADSGAIGG-SH-THEFMALSA--------
SYP_STAAB       DEASLDQTYQDMYQAYSRIFERVGINARPVVADSGAIGG-SH-THEFMALSA--------
SYP_STAHJ       DEASLDETYQDMYNAYDRIFKRVGINARPVVADSGAIGG-NH-THEFMALSE--------
SYP_STAS1       DEDSLDASYQDMYNAYGRIFKRVGINARPVVADSGAIGG-SH-THEFMALSE--------
SYP_STAES       DEASLDATYQDMYQAYSRIFKRVGINARPVVADSGAIGG-SH-THEFMALSE--------
SYP_STAEQ       DEASLDATYQDMYQAYSRIFKRVGINARPVVADSGAIGG-SH-THEFMALSE--------
SYP_BACHD       GGESLDEMYKVMYDAYSRIFRRAGLNVRPVIADSGAIGG-KD-THEFMALAD--------
SYP_BACSK       SPESLDEAYWQMHGAYSRIFTRVGLEFRPVIADSGAMGG-KD-THEFMALAS--------
SYP_LACPL       DEASLDDTFQDMAQAYQNIFERVGLKFRSIIGDGGAMGG-KD-SREYSAIAP--------
SYP_LACSS       NEADLDTTFQQMRQAYTNIFERCGLDFRAIVGDAGAMGG-KD-SMEFSAIAE--------
SYP_ENTFA       DEASLDQSYRDYEKAYSRIFERCGLEFRAIIGDGGAMGG-KD-SKEFMAISE--------
SYP_LACS1       DDASMEKVFNDTDKAYQRIFERCGLDFRGIIADSGAMGG-NR-SKEFQAIAE--------
SYP_STRA3       DYEDLDVTYEDYRKAYEAIFTRAGLDFKGIIGDGGAMGG-KD-SQEFMAVTPNRTDLNRW
SYP_STRA5       DYEDLDVTYEDYRKAYEAIFTRAGLDFKGIIGDGGAMGG-KD-SQEFMAVTPNRTDLNRW
SYP_STRA1       DYEDLDVTYEDYRKAYEAIFTRAGLDFKGIIGDGGAMGG-KD-SQEFMAVTPNRTDLNRW
SYP_STRP1       NYEDLDVTYEDYRQAYEAIFTRAGLDFKGIIGDGGAMGG-KD-SQEFMAITPARTDLDRW
SYP_STRPM       NYEDLDVTYEDYRQAYEAIFTRAGLDFKGIIGDGGAMGG-KD-SQEFMAVTPARTDLDRW
SYP_STRP3       NYEDLDVTYEDYRQAYEAIFTRAGLDFKGIIGDGGAMGG-KD-SQEFMAITPARTDLDRW
SYP_STRPF       NYEDLDVTYEDYRQAYEAIFTRAGLDFKGIIGDGGAMGG-KD-SQEFMAITPARTDLDRW
SYP_STRP8       NYEDLDVTYEDYRQAYEAIFTRAGLDFKGIIGDGGAMGG-KD-SQEFMAITPARTDLDRW
SYP_STRP6       NYEDLDVTYEDYRQAYEAIFTRAGLDFKGIIGDGGAMGG-KD-SQEFMAITPARTDLDRW
SYP_STRPB       NYEDLDVTYEDYRQAYEAIFTRAGLDFKGIIGDGGAMGG-KD-SQEFMAITPARTDLDRW
SYP_STRPC       NYEDLDVTYEDYRQAYEAIFTRAGLDFKGIIGDGGAMGG-KD-SQEFMAITPARTDLDRW
SYP_STRPD       NYEDLDVTYEDYRQAYEAIFTRAGLDFKGIIGDGGAMGG-KD-SQEFMAITPARTDLDRW
SYP_STRT1       NYEDLDVTYEDYRKAYEAIFTRAGLEFKAIIGDGGAMGG-KD-SQEFMAVTPERTDLNRW
SYP_STRT2       NYEDLDVTYEDYRKAYEAIFTRAGLEFKAIIGDGGAMGG-KD-SQEFMAVTPERTDLNRW
SYP_STRMU       DYDSLDATYEDYRKAYEAIFTRVGLDFKAIIGDGGAMGG-KD-SQEFMAVTPDRTDLEHW
SYP_STRPN       NYDSLDSVYDEYKAAYERIFTRSGLDFKAIIGDGGAMGG-KD-SQEFMAITSARTDLDRW
SYP_STRR6       NYDSLDSVYDEYKAAYERIFTRSGLDFKAIIGDGGAMGG-KD-SQEFMAITSARTDLDRW
SYP_LACLA       DQDSLDETYNDYKKAYEKIFERAGLNFKPIIADAGAMGG-KD-SQEFIAITDDRINLEKW
SYP_LACAC       TREQLDQQFDDQKSAYKRIFKRAGVTVHPVIADSGTMGG-KN-STEFQAPAA--------
SYP_LACJO       TREQLDEQFDDQKSAYLKIFNRAGVTVHPVIADSGTMGG-KN-STEFQAPAA--------
SYP_FUSNN       SQESLDEEFLNMRDTYTRIFTRCGLKFRPVDADSGNIGG-SG-SQEFQVLAE--------
SYP_DEHM1       SPEGLDESYQTMKQAYENVYRRCGLESMVIDADSGAIGG-KA-SHEFMIVAE--------
SYP_DEHMC       SPEGLDDSYQTMKQAYESVYRRCGLESMVIDADSGAIGG-KA-SHEFMIVAE--------
SYP1_ANADE      DRAGLDKSYEDQRQAYEKIFTRCGLDFVAVQAHSGSMGG-SE-SSEFMVRTD--------
SYP_CARHZ       DEEGLEISYRKMYEAYTNVFTRCGLKFRAVEADAGAIGG-ST-THEFMVLAN--------
SYP_MOOTA       DQEGLNQSYRKMYQAYSNVFRRCGLDFRPVQADSGAIGG-NY-SHEFMALAT--------
SYP_DESHY       DEAGLAESYKKMYDAYTRIFTRCGLSFRPVEADAGAIGG-TGGTHEFMVLAE--------
SYP_CLOAB       DNEGLDVSYNKMYEAYTKIFKRCNVSCSAVAADSGAMGG-SG-SAEFMVKSE--------
SYP_CLOTE       DYEDLDVSYKKMYEAYHNIFIRCGLECNCVEADSGAMGG-AG-SAEFMVKSE--------
SYP_CLOPE       DQEGLDLAYEKMRKAYVNIFNRCGLDAKAVAADSGAIGG-SG-SAEFMVKSE--------
SYP_CALS4       DWEGLDESFNKMYRAYCRIFDRCGLKYLVVEADPGAMGG-RD-SKEFMVISS--------
SYP_DESAG       DAQGLDLSYRAMYEAYMKIFSRMGLKFRAVEADSGSIGG-SF-SHEFMVLAE--------
SYP_DESVH       DQSGCDESYKAMYAAYQRIFSRLGLRFRAVEADSGSIGG-SF-SHEFMVLAD--------
SYP_LAWIP       DNEGADISYHTMFDAYKAIFTCMALDFRAVEADSGSIGG-NF-SHEFMVIAD--------
SYP_GEOMG       SSEAADTSYDKMYQAYRRIFQRCGLKFRAVEADTGSIGG-SS-SHEFMVLAD--------
SYP_GEOSL       DSSASDLSYDKMYQAYRRIFQRCGLKFRAVEADTGSIGG-SS-SHEFMVLAD--------
SYP_PELCD       DEAGADVAYEKMYQAYRRIFERCGLKFRAVEADTGNIGG-SS-SHEFMVLAA--------
SYP_DESPS       DDEQANLSYDKMFEAYKRIFTRCGLQFRPVQADSGAIGG-SH-SHEFMVLAK--------
SYP_SYNAS       DEEGAEISYQKMFEAYKRIFARCGLRFRPVEADSGTIGG-SF-SHEFMVMAD--------
SYP_MYCTU       DAAGLKAAYHAHREAYQRIFDRLQVRYVIVSAVSGAMGG-SA-SEEFLAESP--------
SYP_MYCBO       DAAGLKAAYRAHREAYQRIFDRLQVRYVIVSAVSGAMGG-SA-SEEFLAESP--------
SYP_MYCPA       DDAGLKAAYHAHREAYQRIFARLQVRYVIVSAVSGAMGG-SA-SEEFLAESP--------
SYP_NOCFA       DEDGLKASYNAHREAYQRIFDRLGVKYVIVAATSGAMGG-SA-SEEFLADSP--------
SYP_COREF       TDAGLEESYARHRAAYQRIFDRLGIEYVICKATSGAMGG-SA-SEEFLAVSA--------
SYP_CORGL       SDAGLDESYAKHRAAYQRIFDRLGLEYAICQATSGAMGG-SA-SEEFLAVSE--------
SYP_CORDI       SDAGLEDSYQRHREAYQRILDRLGVEYVICAATSGAMGG-SA-SEEFLAVSD--------
SYP_CORJK       DDEGLEESYQLHRKAYQNIFDRLGIKYAICSATSGAMGG-SA-SEEFLAVAA--------
SYP_THEFY       DDEGLQRSYEAHRQAYIRIFDRLGLEYVIVKATSGAMGG-SA-SEEFLAIAP--------
SYP_LEIXX       TDAGLDVSYQAQRDAYERIFARLGLDFVIVQADAGAMGG-SR-SEEFLHPTP--------
SYP_CUTAK       AQEGLDEAYQAQRDAYIRIFNRLGFDYAIVKAMSGPMGG-SR-SEEFLAVAA--------
SYP_BIFLO       DEEGMRKAYYDERGAYERIFQRLDLKYVPVFAMSGPMGG-SA-SEEFLAPMP--------
SYP_STRCO       ADEGLAESYALHRAAYQRIFERLGLDYRIVAATAGAMGG-SK-SEEFLAPAE--------
SYP1_STRAW      ADEGLAQSYALHREAYIKIFNRLGLDHRIVSAVSGAMGG-SA-SEEFLAPAP--------
SYP_TROW8       DEKGLRQSYEAQKRAYKKIFDRLEIDYVIVKANAGAMGG-SV-SEEFLHPTE--------
SYP_TROWT       DEKGLRQSYEAQKRAYKKIFDRLKIDYVIVKANAGAMGG-SV-SEEFLHPTE--------
SYP_TREPA       DCACLARTYEKFAHAYRAIFRRIGLSVIAVHAHLGAMGG-QE-SEEFMVESA--------
SYP_TREDE       NDKSLDEAYLSFEKAYIKIFKRCGLTVIGVKADSGAMGG-SG-SQEFMVESS--------
SYP_LEPIC       DDSSLDDTYQAMRVAYRKIFDRCGLKTIPVQADSGSMGG-SA-SEEFMVVSP--------
SYP_LEPIN       DDSSLDDTYQAMRVAYRKIFDRCGLKTIPVQADSGSMGG-SA-SEEFMVVSP--------
SYP_CHLTR       SPEQMEEQYAKLRLAYQRIFDRLNLKYVIVAADGGKIGK--GKSEEFHVLCS--------
SYP_CHLTA       SPEQMEEQYAKLRLAYQRIFDRLNLKYVIVAADGGKIGK--GKSEEFHVLCS--------
SYP_CHLMU       SPEQMEEQYAKLRLAYQRIFDRLNLKYVIVTADGGKIGK--GKSEEFHVLCS--------
SYP_CHLCV       SPEQMNEQYAKLRQAYQNIFDRLEIKYVIVEADGGKIGK--GKSEEFHVLCS--------
SYP_CHLFF       SPEQMNEQYDKLRRAYQKIFDRLEIKYVIVEADGGKIGK--GKSEEFHVLCS--------
SYP_CHLAB       SPEQMNEQYAKLRQAYQNIFDRLEIQYVIVEADGGKIGK--GKSEEFHVLSS--------
SYP_CHLPN       SPEQMNEQYEKLRSAYSKIFDRLGLAYVIVTADGGKIGK--GKSEEFQVLCS--------
SYP_NOSS1       DEDSLKKTYQDMYQAYSNMLRRAGLAFRPVEADSGAIGG--SGSTEFMVLAE--------
SYP_TRIV2       DEDSLKKTYQDMYQAYSNMLRRAGLAFRPVEADSGAIGG--SGSTEFMVLAE--------
SYP_SYNP6       DEESLRQTYAAMDQAYRNIFRRCGLQFRAVEADSGAIGG--SASQEFMILAD--------
SYP_SYNE7       DEESLRQTYAAMDQAYRNIFRRCGLQFRAVEADSGAIGG--SASQEFMILAD--------
SYP_SYNY3       DEASLKATYGAMDQAYRNIFSRCGLDFRPVDADSGAIGG--SGSQEFMVLAD--------
SYP_THEEB       DVASLKETYQVMYDTYSRILQRCGLTFRAVEADSGAIGG--SGSHEFMVLAA--------
SYP_SYNJA       NEESLRQTYQDMYRAYGRILRRCGLEFCVVEADAGAIGGPSAASQEFMVLAS--------
SYP_SYNJB       NEESLRQTYQDMYRAYSRILRRCGLEFRVVDADAGAIGGPSAASQEFMVLAS--------
SYP_PROM9       SEKDLASFYEKVGNAYENIFKSCGLETVGVEADSGAIGG--ASSKEFMVTAD--------
SYP_PROMP       SKEDLASFYEKMEKAYENIFKNCGLDTVGVDADSGAIGG--AASKEFMVTAD--------
SYP_PROMA       DETNLKETYLEMNDAYEKIFKRCGLETVAVDADSGAIGG--AESREFMVTAE--------
SYP_PROMT       NENDLQSTYSDMRNAYENIFTKCGLDFVCVDADSGAIGG--AASQEFMVTAE--------
SYP_SYNPX       DEADLQATYAVMDQAYRRIFERCGLEAVPVDADSGAIGG--AASQEFMVTAE--------
SYP_SYNS9       NEADLQNTYLEMDQAYRRIFERCGLAAVPVDADSGAIGG--AASQEFMVTAD--------
SYP_SYNSC       SEADLRETYGAMDQAYRRIFERCGLDAVPVDADSGAIGG--AASQEFMVTAD--------
SYP_PROMM       CEADLAMTYRAMDEAYQRIFSRCGLETVAVEADSGAIGG--ASSQEFMVTAD--------
SYP_GLOVI       TPESLDETYRAMYRAYTNMFRRCGLDFRAVEADSGAIGG--SGSHEFMALCD--------
SYP_HELPY       DAESLDKEFLNTQSAYKEILSDLGLDFRIVEADSGAIGG--SKSREFVVLTE--------
SYP_HELPJ       DAESLDKEFLNTQSAYKEILSDLGLDFRIVEADSGAIGG--SKSREFVVLTE--------
SYP_CAMJE       NEEDLGREFELMYKTYSQILQRMGLDFRAVEADSGAIGG--SGSKEFMVLAK--------
SYP_CAMJR       NEEDLGREFELMYKTYSQILQRMGLDFRAVEADSGAIGG--SGSKEFMVLAK--------
SYP_HELHP       NYADLNREFDVMEATYKRILQRMGLEFKVVEADSGAIGG--SGSKEFMVLAP--------
SYP_WOLSU       NEADLIREFELMEATYKRIFTRLGLDFRVVEADSGAIGG--SGSKEFMVLAQ--------
SYP_SHIBS       SQESLQETYDAMYAAYSKIFSRMGLDFRAVQADTGSIGG--SASHEFQVLAQ--------
SYP_SHIFL       SQESLQETYDAMYAAYSKIFSRMGLDFRAVQADTGSIGG--SASHEFQVLAQ--------
SYP_SHISS       SQESLQETYDAMYAAYSKIFSRMGLDFRAVQADTGSIGG--SASHEFQVLAQ--------
SYP_ECOLI       SQESLQETYDAMYAAYSKIFSRMGLDFRAVQADTGSIGG--SASHEFQVLAQ--------
SYP_ECO57       SQESLQETYDAMYAAYSKIFSRMGLDFRAVQADTGSIGG--SASHEFQVLAQ--------
SYP_SHIDS       SQESLQETYDAMYAAYSKIFSRMGLDFRAVQADTGSIGG--SASHEFQVLAQ--------
SYP_ECOL6       SQESLQETYDAMYAAYSKIFSRMGLDFRAVQADTGSIGG--SASHEFQVLAQ--------
SYP_ECOUT       SQESLQETYDAMYAAYSKIFSRMGLDFRAVQADTGSIGG--SASHEFQVLAQ--------
SYP_SALPA       SQESLQETYDAMYAAYSRIFSRMGLDFRAVQADTGSIGG--NASHEFQVLAQ--------
SYP_SALTI       SQESLQETYDAMYAAYSRIFSRMGLDFRAVQADTGSIGG--NASHEFQVLAQ--------
SYP_SALTY       SQESLQETYDAMYAAYSRIFSRMGLDFRAVQADTGSIGG--NASHEFQVLAQ--------
SYP_SALCH       SQESLQETYDAMYAAYSRIFSRMGLDFRAVQADTGSIGG--NASHEFQVLAQ--------
SYP_YERPE       TQESLQETYDAMYTAYSKIFSRMDLNFRAVLADTGSIGG--SASHEFQVLAE--------
SYP_YERPS       TQESLQETYDAMYTAYSKIFSRMDLNFRAVLADTGSIGG--SASHEFQVLAE--------
SYP_PECAS       SQESLQATYDTMYAAYSKIFSRMDLDFRAVQADTGSIGG--NASHEFQVLAS--------
SYP_SODGM       SQASLQATYDAMYQAYSAIFTRMGLEFRAVQADTGSIGG--SASHEFQVLAG--------
SYP_PHOLL       TQTSLQETYDNMYEAYSKIFTRIGLDFRAVLADTGSIGG--SASHEFQVLAA--------
SYP_HAEIN       TQESLQATYDVMYQVYSNIFNRLGLDFRAVQADTGSIGG--SASHEFQVLAS--------
SYP_HAEI8       TQESLQATYDVMYQVYSNIFRRLGLDFRAVQADTGSIGG--SASHEFQVLAS--------
SYP_MANSM       TKESLQATYDVMYQTYSNIFTRLGLDFRAVQADTGSIGG--SASHEFQVLAS--------
SYP_HAEDU       TPESLQQTYEVMYQVYHRIFTRLGLDFRTVQADTGSIGG--SASHEFQVLAS--------
SYP_PASMU       THECLQKTYDVMYETYSNIFNRLGLDFRAVQADTGSIGG--SASHEFQVLAQ--------
SYP_BAUCH       SQQSLQATYDLMYYTYNTIFNRIGLDVRTVQADPGSIGG--HLSHEFLALVS--------
SYP_VIBVU       DKAGLEKSYQAMHDAYCKAFDRMGLEYRPVLADSGAIGG--NGSQEFHVLAE--------
SYP_VIBVY       DKAGLEKSYQAMHDAYCKAFDRMGLEYRPVLADSGAIGG--NGSQEFHVLAE--------
SYP_VIBPA       DKAGLEKSYQAMHDAYCKAFDRMGLEYRPVLADSGAIGG--SGSQEFHVLAD--------
SYP_ALIF1       NKEGLQKSYDAMHDAYCKAFDRMGLEYRPVLADSGAIGG--SGSQEFHVLAE--------
SYP_VIBCH       DKAGLEKSYEAMHVAYCKAFDRMGLDYRPVLADTGAIGG--NGSHEFHVLAE--------
SYP_PHOPR       DKEGLEKSYQAMHDAYCKAFDRMGLEYRPVLADSGAIGG--SGSQEFHVLAE--------
SYP_SHEON       DMDTLNETYEAMYQAYSNILSRMGLAFRPVLADTGSIGG--SMSHEFHVLAQ--------
SYP_PSE14       DHASLQVTYDRMHLAYSNIFTRLGLKFRPVEADNGSIGG--AGSHEFHVLAE--------
SYP_PSEU2       DHESLQVTYDRMHLAYSNIFTRLGLKFRPVEADNGSIGG--AGSHEFHVLAE--------
SYP_PSESM       DNASLQVTYDRMHLAYSNVFSRLGLKFRPVEADNGSIGG--AGSHEFHVLAE--------
SYP_PSEF5       DQASLQVTYDRMHQAYCNVFTRLGLKFRPVEADNGSIGG--AGSHEFHVLAE--------
SYP_PSEPF       DQASLQVTYDRMHDAYCNIFTRLGLKFRPVEADNGSIGG--AGSHEFHVLAE--------
SYP_PSEPK       DQASLQETYDRMHQAYSNVFTRLGLDFRPVQADTGSIGG--SYSHEFHVLAE--------
SYP_PSEAE       SQDSLQQTYDGMYQAYSKIFSRLGLDFRPVQADNGSIGG--SGSHEFHVLAN--------
SYP_CHRSD       DQAGLQRSYDAMYDAYMRIFTRLGLDFRAVEADNGDIGG--SGSHEFQVLAD--------
SYP_PSYA2       DQASLAKTYDDMYDAYTRIFTRLGLDFRAVQADTGSIGG--FASHEFHVLAD--------
SYP_PSYCK       DQASLAKTYDEMYDAYTRIFTRLGLDFRAVQADTGSIGG--FASHEFHVLAD--------
SYP_ACIAD       DQASLQETYDNMYDTYCRIFTRLGLDFRPVQADTGSIGG--SGSHEFHVLAD--------
SYP_HAHCH       NQESLDETYMVMYDAYTRIFTRFGLDFRPVQADSGSIGG--SSSHEFHVLAN--------
SYP_SACD2       SQECLQETYDIMHAAYCKIFDRIGLDYRPVLADTGSIGG--TGSHEFHVLAD--------
SYP_COLP3       EDECLEKTYQIMFDAYCRIFERLELNFRPVLADTGSIGG--EKSHEFHVLAD--------
SYP_IDILO       TDESLQKTYDDMYKAYCRIFERLGLDYRPVIADTGSIGG--SHSHEFHVLAS--------
SYP_PSEHT       SDECLDATYQVMHKAYCNIFERLNLDYRPVIADTGSIGG--SVSHEFHVLAE--------
SYP_HYDCU       DKDSLQKTYEDMYDTYNRIFTRLGLDFRPVQADTGSIGG--EGSHEFHVLAD--------
SYP_COXBU       DEKGMQAAYEKMFDAYRRIFTRLGLNFRAVLADTGAIGG--DYSHEFQVLAD--------
SYP_NITOC       DQTSLAQTYNQMYETYSRIFDRIGLTFRAVQADTGAIGG--KTSHEFHVLAA--------
SYP_METCA       DQESLAQTYDAMYVAYSNIFSRLGLRFRPVLADTGAIGG--SHSHEFHVLAD--------
SYP_LEGPA       SLESLQETYKDMYQAYCRIFDRMGLKYRAVEADTGAIGG--SASHEFQVLAE--------
SYP_LEGPL       SLESLQETYKDMYQAYCRIFDRMGLKYRAVEADTGAIGG--SASHEFQVLAE--------
SYP_LEGPH       SLESLQETYKDMYQAYCRIFDRMGLKYRAVEADTGAIGG--SASHEFQVLAE--------
SYP_FRATH       NSQCLRNTYNTMYATYCNILDKIGLAYRPVKADTGAIGG--DNSHEFQVLAN--------
SYP_FRATT       NSQCLRNTYNTMYATYCNILDKIGLAYRPVKADTGAIGG--DNSHEFQVLAN--------
SYP_BORBR       DEAGAQRSYDIMYAAYQRIFQRLGLEFRAVAADTGSIGG--SRSHEFQVIAD--------
SYP_BORPE       DEAGAQRSYDIMYAAYQRIFQRLGLEFRAVAADTGSIGG--SRSHEFQVIAD--------
SYP_BORPA       DEAGAQRSYDIMYAAYQRIFQRLSLEFRAVAADTGSIGG--SRSHEFQVIAD--------
SYP_BORA1       DEAGAGRSYDIMFDAYHRIFRRLGLAFRAVAADTGSIGG--SRSHEFQVIAD--------
SYP_AROAE       DVAAAGRSYDAMYAAYCRIFDRLGLTYRAVAADTGAIGG--DRSHEFQVIAD--------
SYP_RHOFT       DQASAKASYQVMAAAYRRIFDRFGLTYRAVAADSGAIGG--DLSEEFQVIAA--------
SYP_BURP1       DHESLKESYKKMYDAYVRIFTRIGLEFRPVAADNGSIGG--SGSHEFHVIAD--------
SYP_BURPS       DHESLKESYKKMYDAYVRIFTRIGLEFRPVAADNGSIGG--SGSHEFHVIAD--------
SYP_BURMA       DHESLKESYKKMYDAYVRIFTRIGFEFRPVAADNGSIGG--SGSHEFHVIAD--------
SYP_BURTA       DHESLKESYKKMYDAYVRIFTRIGLEFRPVAADNGSIGG--SGSHEFHVIAD--------
SYP_BURL3       DAAGLNESYRKMYDAYVRIFTRLGLEFRAVAADSGSIGG--NFSHEFHVIAD--------
SYP_CUPPJ       DAEGLKKSYENMYDAYVRIFQRFGLEFRAVAADNGAIGG--SGSHEFHVIAD--------
SYP_CUPMC       DIDGLKASYQNMYDAYVRIFQRFGLEFRAVAADNGAIGG--SGSHEFHVIAD--------
SYP_RALSO       DAEGLKVSYEKMYGAYTRIFQRFGLEFRAVAADNGAIGG--SGSHEFHVIAD--------
SYP_CHRVO       SAEDAGKSYDNMYAAYRRIFDRLGLTYRAVAADTGAIGG--DRSHEFQVIAD--------
SYP_NEIMA       DYASLQTTYDAMYDAYCRIFTRLGLEFRPVAADTGSIGG--TGSHEFQVLAE--------
SYP_NEIMB       DYASLQTTYQDMYDAYCRIFTRLGLAFRPVAADTGSIGG--TGSHEFQVLAE--------
SYP_NEIG1       DYASLQATYDAMYDAHCRIFTRLGLAFRPVAADTGSIGG--TGSHEFQVLAE--------
SYP_NITEU       DVDSLEQTYRLMQETYSRIFTRIGLKFRAVAADTGAIGG--SGSHEFHVLAD--------
SYP_NITMU       DIPSLEETYQAMHVAYCRIFDRLGLKFRPVKADTGAIGG--SSSHEFHVLAD--------
SYP_THIDA       SRESLAATYQAMYDAYGRIFTRLGLRFRAVAADTGAIGG--SASHEFHVLAD--------
SYP_DECAR       SFDDLKREYGNMYDTYSRIFSRLGLKFRAVAADTGSIGG--TGSHEFHVLAD--------
SYP_XANAC       TDEDMAREYDNMRAAYTRIFTRLGLDFRAVQADSGAIGG--DASQEFHVIAD--------
SYP_XANC5       TDEDMAREYDNMRAAYTRIFTRLGLDFRAVQADSGAIGG--DASQEFHVIAD--------
SYP_XANOM       TDADMAREYDNMRAAYTRIFTRLGLDFRAVQADSGAIGG--DASQEFHVIAD--------
SYP_XANOR       TDADMAREYDNMRAAYTRIFTRLGLDFRAVQADSGAIGG--DASQEFHVIAD--------
SYP_XANC8       TDADMAREYDNMRAAYIRIFTRLGLEFRAVQADSGAIGG--DASQEFHVIAE--------
SYP_XANCP       TDADMAREYDNMRAAYIRIFTRLGLEFRAVQADSGAIGG--DASQEFHVIAE--------
SYP_XYLFA       NDADLVREYENMRATYTRIFTRLGLEFRAVQADSGAIGG--DASQEFHVIAD--------
SYP_XYLFT       NDADLVREYENMRATYTRIFTRLGLEFRAVQADSGAIGG--DASQEFHVIAD--------
SYP_BUCAI       NQSCLENTYNKFYDSYINIFKKMNLNFCAVKADSGSMGG--NISHEFQAFSQ--------
SYP_BUCAP       NKHCLEKTYNDFYQSYINIFNKIKIQFRAVNADSGSMGG--SISHEFQALSE--------
SYP_BUCBP       NMLSLEKTYNLMYQTYIKIFKKMKLKFYAVEADSGLMGG--LKSHEFQAPSN--------
SYP_BLOFL       HQKSLEDTYYNIYQQYHIIFKRIGLKFCVVQADPGNIGG--IVSHEFQAYYN--------
SYP_BLOPB       NQKSLQNTYNNMYQTYHTIFNRIGLNFCVVQAEPGKIGG--ALSHEFQAYSE--------
SYP_WIGBR       NEKSLEKTYHIMQETYKKIFNRLNLDYFVIRAKTGKIGG--FISHEFHAYYN--------
                        :      :        .      .  * :*     : *:             

SYP_AQUAE       ------------------------------YGEAKVAYCEN----CGYAANAEIVPLP--
SYP_THEMA       ------------------------------IGETNVLFCEK----CGYQASDEKAEYKG-
SYP_BACSU       ------------------------------IGEDTIAYSDE----SQYAANIEMAEVLH-
SYP_BACLD       ------------------------------VGEDTIAYSDQ----SSYAANIEMAEVKE-
SYP1_BACAN      ------------------------------VGEDTIAYSDT----SDYAANIEMAPVVA-
SYP1_BACCZ      ------------------------------VGEDTIAYSDT----SDYAANIEMAPVVA-
SYP1_BACHK      ------------------------------VGEDTIAYSDT----SDYAANIEMAPVVA-
SYP1_BACC1      ------------------------------VGEDTIAYSDT----SDYAANIEMAPVVA-
SYP1_BACCR      ------------------------------VGEDTIAYSDT----SDYAANIEMAPVVA-
SYP_GEOKA       ------------------------------IGEDTIAYSDA----SDYAANIEMAPVVA-
SYP_LISMF       ------------------------------IGEDTIAYSDA----SDYAANTEMAPVLY-
SYP_LISMO       ------------------------------IGEDTIAYSDA----SDYAANTEMAPVLY-
SYP_LISIN       ------------------------------IGEDTIAYSDA----SDYAANTEMAPVLY-
SYP_STAA3       ------------------------------IGEDTIVYSKE----SDYAANIEKAEVVY-
SYP_STAA8       ------------------------------IGEDTIVYSKE----SDYAANIEKAEVVY-
SYP_STAAC       ------------------------------IGEDTIVYSKE----SDYAANIEKAEVVY-
SYP_STAAM       ------------------------------IGEDTIVYSKE----SDYAANIEKAEVVY-
SYP_STAAN       ------------------------------IGEDTIVYSKE----SDYAANIEKAEVVY-
SYP_STAAW       ------------------------------IGEDTIVYSKE----SDYAANIEKAEVVY-
SYP_STAAS       ------------------------------IGEDTIVYSKE----SDYAANIEKAEVVY-
SYP_STAAR       ------------------------------IGEDTIVYSKE----SDYAANIEKAEVVY-
SYP_STAAB       ------------------------------IGEDTIVYSKE----SDYAANIEKAEVVY-
SYP_STAHJ       ------------------------------IGEDTIVYSEH----SDYAANIEKAEVVY-
SYP_STAS1       ------------------------------IGEDTIVYSEQ----SDYAANIEKAEVVY-
SYP_STAES       ------------------------------IGEDTIVYSNE----SDYAANIEKAEVVY-
SYP_STAEQ       ------------------------------IGEDTIVYSNE----SDYAANIEKAEVVY-
SYP_BACHD       ------------------------------VGEDTIAYSDQ----SDYAANIEMAAVKV-
SYP_BACSK       ------------------------------VGEDTVVYSDG----SDYAANLEMAKAAL-
SYP_LACPL       ------------------------------VGEDTIVYSDA----SDYAANLEMARSLY-
SYP_LACSS       ------------------------------IGEDTIVYSDQ----SDYAANLEMATGVR-
SYP_ENTFA       ------------------------------IGEDTICYSTE----SDYAANLEMATSLY-
SYP_LACS1       ------------------------------VGEDTIAYSDS----SDYAANIEMAKNLR-
SYP_STRA3       LVLDKTIPSIDDIPEDVLEEIKVELSAWLVSGEDTIAYSTE----SSYAANLEMATNEY-
SYP_STRA5       LVLDKTIPSIDDIPEDVLEEIKVELSAWLVSGEDTIAYSTE----SSYAANLEMATNEY-
SYP_STRA1       LVLDKTIPSIDDIPEDVLEEIKAELSAWLVSGEDTIAYSTE----SSYAANLEMATNEY-
SYP_STRP1       VVLDKSIASMDDIPKEVLEDIKAELAAWMISGEDTIAYSTE----SSYAANLEMATNEY-
SYP_STRPM       VVLDKSIASMDDIPKEVLEDIKAELAAWMISGEDTIAYSTE----SSYAANLEMATNEY-
SYP_STRP3       VVLDKSIASMDDIPKEVLEEIKAELAAWMISGEDTIAYSTK----SSYAANLEMATNEY-
SYP_STRPF       VVLDKSIASMDDIPKEVLEEIKAELAAWMISGEDTIAYSTE----SSYAANLEMATNEY-
SYP_STRP8       VVLDKSIASMDDIPKEVLEEIKAELAAWMISGEDTIAYSTE----SSYAANLEMATNEY-
SYP_STRP6       VVLDKSIASMDDIPKEVLEEIKAELAAWMISGEDTIAYSTE----SSYAANLEMATNEY-
SYP_STRPB       VVLDKSIASMDDIPKEVLEEIKAELAAWMISGEDTIAYSTE----SSYAANLEMATNEY-
SYP_STRPC       VVLDKSIASMDDIPKEVLEEIKAELAAWMISGEDTIAYSTE----SSYAANLEMATNEY-
SYP_STRPD       VVLDKSIASMDAIPKEVLEEIKAELAAWMISGEDTIAYSTE----SSYAANLEMATNEY-
SYP_STRT1       VVLDKSIASLDEIPEDVMEEIKNELTSWLVAGEDTIAYSTE----SSYAANLEMATNAY-
SYP_STRT2       VVLDKSIASLDEIPEDVMEEIKNELTSWLVAGEDTIAYSTE----SSYAANLEMATNAY-
SYP_STRMU       LVLDKAIGSIEEIPADVLKEIKQELSSWLISGEDTIAYSSE----SDYAANLEMATSEY-
SYP_STRPN       VVLDKSVASFDEIPAEVQEEIKAELLKWIVSGEDTIAYSSE----SSYAANLEMATNEY-
SYP_STRR6       VVLDKSVVSFDEIPVEVQEEIKAELLKWIVSGEDTIAYSSE----SSYAANLEMATNEY-
SYP_LACLA       LVLSKNITSIEEIPESVLSEIKEELGKWLIAGEDTIVYAEG----GDYAANIEMASSQF-
SYP_LACAC       ------------------------------IGEDTIATNEK----GTYAANLEMAKSID-
SYP_LACJO       ------------------------------IGEDTIATNEK----GTYAANLEMAKSID-
SYP_FUSNN       ------------------------------SGEDEIIYSDG----SEYAANIEKAVSEL-
SYP_DEHM1       ------------------------------SGEDSIIYCPK----CNYAANAEKAVFK--
SYP_DEHMC       ------------------------------SGEDSIIYCPK----CSYAANAEKAVFK--
SYP1_ANADE      ------------------------------AGEDLVAACPR----CRYAANTETATSR--
SYP_CARHZ       ------------------------------SGEAVVVYCPDDN--CGYAANLEKAETK--
SYP_MOOTA       ------------------------------AGEALLVYCRE----CDYAANVEIAVAK--
SYP_DESHY       ------------------------------SGEAAVVYCPD----CDYAANVEKAECK--
SYP_CLOAB       ------------------------------IGEDEIAFCTE----CNYAANIEKAPA---
SYP_CLOTE       ------------------------------VGEDEIAFCDS----CGYGANIEKAPA---
SYP_CLOPE       ------------------------------VGEDDVVFCTA----CDYAANIEKAPS---
SYP_CALS4       ------------------------------VGEAVIAYCDS----CGYAANEEKAEC---
SYP_DESAG       ------------------------------TGEDTIAFCHD----CDYSANVERAEVV--
SYP_DESVH       ------------------------------TGEDTLAVCTA----CEYAANVERAEVT--
SYP_LAWIP       ------------------------------SGEDTIAFCRK----CDWAANIEHAATL--
SYP_GEOMG       ------------------------------SGEDAIVSCTA----CEYAANVEKAEARLF
SYP_GEOSL       ------------------------------SGEDAIVSCTQ----CEYAANVEKAEARPA
SYP_PELCD       ------------------------------SGEDAIVSCGQ----CEYAANIEKAEVALT
SYP_DESPS       ------------------------------TGEDTIVVCKD----CEYAANMEKAEVKLV
SYP_SYNAS       ------------------------------SGEDGLVFCAT----CSYAANLEKAEVHPP
SYP_MYCTU       ------------------------------SGEDAFVRCLE----SGYAANVEAVVTARP
SYP_MYCBO       ------------------------------SGEDAFVRCLE----SGYTANVEAVVTARP
SYP_MYCPA       ------------------------------VGEDTFVRCLE----SGYAANVEAVITARP
SYP_NOCFA       ------------------------------VGEDTYVICRE----SGYAANVEAVVTPAP
SYP_COREF       ------------------------------NGEDTFVRATD----GDFAANVEAVVTQPG
SYP_CORGL       ------------------------------NGEDTFVRSTS----GNYAANVEAVVTQPG
SYP_CORDI       ------------------------------NGEDTFVRATE----GPYAANVEAVVTQPG
SYP_CORJK       ------------------------------NGEDTFVRSTE----SDYAANVEAVVTQVP
SYP_THEFY       ------------------------------TGEDTFVRSTG----SDYAANVEAVVTPAP
SYP_LEIXX       ------------------------------IGEDTFVRSA-----GGYAANVEAFTTVAP
SYP_CUTAK       ------------------------------NGEDTFVRSS-----GGYAANVEAVRMAVP
SYP_BIFLO       ------------------------------IGEDTFALAP-----SGKAWNVEALSTPEL
SYP_STRCO       ------------------------------AGEDTFADCPN----CDYAANTEAITFRLT
SYP1_STRAW      ------------------------------AGEDTFVDCPA----CDYAANTEAVTFVAP
SYP_TROW8       ------------------------------MGDDTFVVTA-----DGSAFNAEVYVTLPG
SYP_TROWT       ------------------------------MGDDTFVVTA-----DGSAFNAEVYVTPPG
SYP_TREPA       ------------------------------VGDNTLLLCPH----CTYAANCEKAVGQRP
SYP_TREDE       ------------------------------VGDDTLLLCPS----CGYAANEEKAACAP-
SYP_LEPIC       ------------------------------IGEETLLLCNS----CGYSSNSEKTPLILK
SYP_LEPIN       ------------------------------IGEETLLLCNS----CGYSSNSEKTPLILK
SYP_CHLTR       ------------------------------LGEDTICVS------GSYGANVEAAQAIPP
SYP_CHLTA       ------------------------------LGEDTICVS------GSYGANVEAAQAIPP
SYP_CHLMU       ------------------------------LGEDTICVS------GSYGANIEAAQAIPP
SYP_CHLCV       ------------------------------LGEDTICVS------GAYGANIEAAVSQPP
SYP_CHLFF       ------------------------------LGEDTICVS------GDYGANIEAAVALPV
SYP_CHLAB       ------------------------------LGEDTLCVS------GHYGANIEAAVAQPP
SYP_CHLPN       ------------------------------LGEDTICVS------GSYGANIEAAVSIPP
SYP_NOSS1       ------------------------------AGEDEVLYTDD----GKYAANVEKAVSLPA
SYP_TRIV2       ------------------------------AGEDEVLYTDD----GKYAANVEKAVSLPA
SYP_SYNP6       ------------------------------AGEDEILYTED----GRYAANVEKAVSLPA
SYP_SYNE7       ------------------------------AGEDEILYTED----GRYAANVEKAVSLPA
SYP_SYNY3       ------------------------------AGEDEILYTED----GLYSANVEKAVSLAP
SYP_THEEB       ------------------------------AGEDEVLYTAD----GQYAANVEKAVSLPP
SYP_SYNJA       ------------------------------AGEDEILYTPD----GSYAANVEKAVSLPP
SYP_SYNJB       ------------------------------AGEDEILYTPD----GSYAANVEKAVSIPP
SYP_PROM9       ------------------------------AGEDSILFTQS----GSYAANIEKAVSIPS
SYP_PROMP       ------------------------------AGEDSILFTES----GSYAANIEKAVSLPS
SYP_PROMA       ------------------------------AGEDLILLSPD----KKYAANQEKAISKFA
SYP_PROMT       ------------------------------SGEDLILISSD----SKYGANQEKAVSIIE
SYP_SYNPX       ------------------------------AGEDLILISDD----GAYAANQEKAVSIPD
SYP_SYNS9       ------------------------------AGEDLILLSDD----GTYAANQEKAISTPS
SYP_SYNSC       ------------------------------AGEDLILISDD----GQYAANLEKAVSIPS
SYP_PROMM       ------------------------------AGEDLILISGD----GHYAANQEKAVSHPP
SYP_GLOVI       ------------------------------IGEDTILYCDA----AGYAANVEKAVSLVS
SYP_HELPY       ------------------------------CGEDTIVVCQN----CDYAANIEIAKRSKR
SYP_HELPJ       ------------------------------CGEDTIVVCQN----CDYAANIEIAKRSKR
SYP_CAMJE       ------------------------------NGEDDILICEN----CDYAANVEAAKRAKK
SYP_CAMJR       ------------------------------NGEDDILICEN----CDYAANVEAAKRAKK
SYP_HELHP       ------------------------------CGEDTIVVCKG----CEYGANIEASKRAPR
SYP_WOLSU       ------------------------------SGEDTIAVCDS----CEYAANIEAAKRRAK
SYP_SHIBS       ------------------------------SGEDDVVFSDT----SDYAANIELAEAIA-
SYP_SHIFL       ------------------------------SGEDDVVFSDT----SDYAANIELAEAIA-
SYP_SHISS       ------------------------------SGEDDVVFSDT----SDYAANIELAEAIA-
SYP_ECOLI       ------------------------------SGEDDVVFSDT----SDYAANIELAEAIA-
SYP_ECO57       ------------------------------SGEDDVVFSDT----SDYAANIELAEAIA-
SYP_SHIDS       ------------------------------SGEDDVVFSDT----SDYAANIELAEAIA-
SYP_ECOL6       ------------------------------SGEDDVVFSDT----SDYAANIELAEAIA-
SYP_ECOUT       ------------------------------SGEDDVVFSDT----SDYAANIELAEAIA-
SYP_SALPA       ------------------------------SGEDDIVFSDV----SDYAANIELAEAIA-
SYP_SALTI       ------------------------------SGEDDIVFSDV----SDYAANIELAEAIA-
SYP_SALTY       ------------------------------SGEDDIVFSDV----SDYAANIELAEAIA-
SYP_SALCH       ------------------------------SGEDDIVFSDV----SDYAANIELAEAIA-
SYP_YERPE       ------------------------------SGEDDIVFSTG----SDYAANIEFAEALA-
SYP_YERPS       ------------------------------SGEDDIVFSTG----SDYAANIEFAEALA-
SYP_PECAS       ------------------------------SGEDDIVFSTE----SDYAANIELAEAVA-
SYP_SODGM       ------------------------------SGEDDIVFSTA----SDYAANIELAEAVA-
SYP_PHOLL       ------------------------------SGEDDIVFSTE----SNYAANIELAEAVA-
SYP_HAEIN       ------------------------------SGEDDVVFSTE----SDFAANIELAEAIA-
SYP_HAEI8       ------------------------------SGEDDVVFSTE----SDFAANIELAEAIA-
SYP_MANSM       ------------------------------SGEDDVVFSTE----SDYAANIELAEAIA-
SYP_HAEDU       ------------------------------SGEDDIVFSTE----SDFAANIELAEAVA-
SYP_PASMU       ------------------------------SGEDDVVFSTE----SDFAANIELAEAVA-
SYP_BAUCH       ------------------------------NYEDQMLLIDA----SHKATERNLP-----
SYP_VIBVU       ------------------------------SGEDLIAFSTE----SDYAANIEKAEAVA-
SYP_VIBVY       ------------------------------SGEDLIAFSTE----SDYAANIEKAEAVA-
SYP_VIBPA       ------------------------------SGEDLIAFSTE----SDYAANIEKAEALA-
SYP_ALIF1       ------------------------------SGEDLIAFSTE----SDYAANIEKAEAVA-
SYP_VIBCH       ------------------------------SGEDLIAFSTE----SDYAANIEKAEAVA-
SYP_PHOPR       ------------------------------SGEDLIAFSSD----SDYAANIEKAEALA-
SYP_SHEON       ------------------------------SGEDLIAYSTG----SDYAANIEKAESPM-
SYP_PSE14       ------------------------------SGEDDIVFSDG----SDYAANIEKAEAVP-
SYP_PSEU2       ------------------------------SGEDDIVFSDG----SDYAANIEKAEAIP-
SYP_PSESM       ------------------------------SGEDDIVFSNG----SDYAANIEKAEAVP-
SYP_PSEF5       ------------------------------SGEDDIVFSNG----SDYAANIEKAEAVP-
SYP_PSEPF       ------------------------------SGEDDIVFSNG----SDYAANIEKAEAVP-
SYP_PSEPK       ------------------------------SGEDDVIFSDS----SDYAANIEKAEAIP-
SYP_PSEAE       ------------------------------SGEDDIVFSDS----SDYAANIEKAEAVP-
SYP_CHRSD       ------------------------------SGEDAVIFSTG----SDYAANIEKAEALPA
SYP_PSYA2       ------------------------------SGEDDIAFSDS----SEYAANVELAESVC-
SYP_PSYCK       ------------------------------SGEDDIAFSDS----SEYAANVELAESVS-
SYP_ACIAD       ------------------------------SGEDDIVFSTE----SDYAANVEKAEAVL-
SYP_HAHCH       ------------------------------SGEDLIAFSTE----SDYAANLEKAEALT-
SYP_SACD2       ------------------------------SGEDDIAFSTE----SNFAANVELAEALA-
SYP_COLP3       ------------------------------SGEDDIAFSDA----SDFAANIEKAEALA-
SYP_IDILO       ------------------------------SGEDAIAFSDS----SDYAANVEMAEALA-
SYP_PSEHT       ------------------------------SGEDAIAFSDG----SDYAANIEKAEALA-
SYP_HYDCU       ------------------------------SGEDDIAFSSD----SDYAANIELAEALA-
SYP_COXBU       ------------------------------VGEDTVVYSDE----SDYAANIEKAAAQA-
SYP_NITOC       ------------------------------SGEDAIAFSDK----STYAANVELAAALP-
SYP_METCA       ------------------------------SGEDAIAFSTV----SDYAANVEQAEALA-
SYP_LEGPA       ------------------------------SGEDLIFYSDA----SDYAANIEQATSLK-
SYP_LEGPL       ------------------------------SGEDLIFYSDA----SDYAANIEQATSLK-
SYP_LEGPH       ------------------------------SGEDLIFYSDA----SDYAANIEQATSLK-
SYP_FRATH       ------------------------------AGEDIICYSNG----SDYAANIELATYAKP
SYP_FRATT       ------------------------------AGEDIICYSNG----SDYAANIELATYAKS
SYP_BORBR       ------------------------------TGEDLIVYNPE----SDYAANIELAEAPAL
SYP_BORPE       ------------------------------TGEDLIVYNPE----SDYAANIELAEAPAL
SYP_BORPA       ------------------------------TGEDLIVYNPE----SDYAANIELAEAPAL
SYP_BORA1       ------------------------------TGEDLLVFNPD----SDYAANIELAEAVSL
SYP_AROAE       ------------------------------TGEDAIVYCPG----SDYAANIELAEALPL
SYP_RHOFT       ------------------------------TGEDAIVYCPG----SDYAANMEKAEALAP
SYP_BURP1       ------------------------------TGEDAIAYCPT----SDFAANVEAAEALPL
SYP_BURPS       ------------------------------TGEDAIAYCPT----SDFAANVEAAEALPL
SYP_BURMA       ------------------------------TGEDAIAYCPT----SDFAANVEAAEALPL
SYP_BURTA       ------------------------------TGEDAIAYCPT----SDFAANVEAAEALPL
SYP_BURL3       ------------------------------TGEDAIAYCPT----SEFAANIEAAEALPL
SYP_CUPPJ       ------------------------------TGEDAIVYCPT----SDYAANMEAAEALPL
SYP_CUPMC       ------------------------------TGEDAIVYCPT----SDYAANMEAAEALPL
SYP_RALSO       ------------------------------TGEDAIVYSPD----SDYAANIEAAEALAP
SYP_CHRVO       ------------------------------TGEDAIVYCPT----SEYAANIELAEAVAP
SYP_NEIMA       ------------------------------SGEDVIAYSDT----SDYAANVELAPTLPL
SYP_NEIMB       ------------------------------SGEDVIAYSDT----SDYAANIELAPTLPL
SYP_NEIG1       ------------------------------SGEDVIAYSDT----SDYAANIELAPTLPL
SYP_NITEU       ------------------------------SGEDAIAFCPA----SDYAANIELAEAVPH
SYP_NITMU       ------------------------------SGEDAIAFCSD----SDYAANVEMAESLPP
SYP_THIDA       ------------------------------SGEDLIAYCPD----SDYAANVELAEALAP
SYP_DECAR       ------------------------------SGEDDIAFCPD----SGYAANVELAEAMAP
SYP_XANAC       ------------------------------SGEDSLAFSTG----SDYAANVEAASAAPP
SYP_XANC5       ------------------------------SGEDSLAFSTG----SDYAANVETASAAPP
SYP_XANOM       ------------------------------SGEDSLAFSTG----SDYAANVETASAALP
SYP_XANOR       ------------------------------SGEDSLAFSTG----SDYAANVETASAALP
SYP_XANC8       ------------------------------SGEDSLAFSTG----SDYAANVETASAALP
SYP_XANCP       ------------------------------SGEDSLAFSTG----SDYAANVETASAALP
SYP_XYLFA       ------------------------------SGEDVLAFSTG----SDYAANIEAAIAATP
SYP_XYLFT       ------------------------------SGEDVLAFSTG----SDYAANIEAAIAATP
SYP_BUCAI       ------------------------------NGEDEIVFSNDK----LYSSNMNMAESIET
SYP_BUCAP       ------------------------------NGEDEIVFSKNT----AYASNINTAKSMQS
SYP_BUCBP       ------------------------------TGEDVIVLSTQS----NYLANIQVATSIQN
SYP_BLOFL       ------------------------------NTQNETAIFTETFNKDMSNINTRKNNDIVI
SYP_BLOPB       ------------------------------NGEDSIAVPMIP---DNNLIDFQLSNDVIP
SYP_WIGBR       ------------------------------KSDVLINSYKKI---------FDKNN--II
                                                :                           

SYP_AQUAE       --------KPEEEKEEEK------PMEKVHTPNVHTIEELSKFLDVHPSK----------
SYP_THEMA       --------EYTQEQEEEK------PLKKVPTPGVKTIEEVSEFLGVPPSK----------
SYP_BACSU       --------QEVPSDEEPK------ALEKVHTPNVKTIEELTAFLQVSAEA----------
SYP_BACLD       --------TDAGEQAEMK------ELQEVHTPSVKTIEEVAAFLGISPSD----------
SYP1_BACAN      --------TYTKSDEAEK------ELEKVATPDQKAIEEVSAFLNIEADK----------
SYP1_BACCZ      --------TYTKSDEAEK------ELEKVATPDQKAIEEVSAFLNIEADK----------
SYP1_BACHK      --------TYTKSDEAEK------ELEKVATPDQKAIEEVSAFLNIEADK----------
SYP1_BACC1      --------TYTKSDEAEK------ALEKVATPDQKAIEEVSAFLNIEAEK----------
SYP1_BACCR      --------TYTKSDEAEK------ALEKVATPDQKAIEEVSAFLNIEADK----------
SYP_GEOKA       --------TYEKSDEPPA------ELKKVATPGQKTIAEVASHLQISPER----------
SYP_LISMF       --------MEKKSHELEK------DMEKVATPDQKSIADIVEFLEVPIEK----------
SYP_LISMO       --------MEKKSHELEK------DLEKVATPDQKSITDIVGFLEVPIEK----------
SYP_LISIN       --------MEKKSHELEK------ELEKVATENQKTIADIVEFLEVPIEK----------
SYP_STAA3       --------EPNHKHTTVQ------PLEKIETPNVKTAQELADFLGRPVDE----------
SYP_STAA8       --------EPNHKHTTVQ------PLEKIETPNVKTAQELADFLGRPVDE----------
SYP_STAAC       --------EPNHKHTTVQ------PLEKIETPNVKTAQELADFLGRPVDE----------
SYP_STAAM       --------EPNHKHSTVQ------PLEKIETPNVKTAQELADFLGRPVDE----------
SYP_STAAN       --------EPNHKHSTVQ------PLEKIETPNVKTAQELADFLGRPVDE----------
SYP_STAAW       --------EPNHKHSTVQ------PLEKIETPNVKTAQELADFLGRPVDE----------
SYP_STAAS       --------EPNHKYSTVQ------PLEKIETPNVKTAQELADFLGRPVDE----------
SYP_STAAR       --------EPNHKHTTVQ------PIEKIETPNVKTAQELADFLGRPVDE----------
SYP_STAAB       --------EPNHKHTTVQ------SLEKIETPNVKTAQELADFLGRPVDE----------
SYP_STAHJ       --------HPNEKHTEVA------ELEKVETPNVKTAQELADFLNRPVDE----------
SYP_STAS1       --------QANEKHEDLQ------PLTKIETPNIHTAQELATFLDKPLDE----------
SYP_STAES       --------HPSHKHSALA------ELTKVETPNVKTAQEVAEYLKRPLDE----------
SYP_STAEQ       --------HPSHKHSALA------ELTKVETPNVKTAQEVAEYLKRPLDE----------
SYP_BACHD       --------NYTRPDEPLL------ERELVDTGDAKTIRAVAERLSVQEEK----------
SYP_BACSK       --------PEAPSVQAHG------LLEKRATPEAKTVDEAAEALGFDADD----------
SYP_LACPL       --------VPKKSHASLK------DMEKIDTPGVGTIDELAEFLKVGADQ----------
SYP_LACSS       --------PGQSSTDVQL------EMEKVATGDAHSIEEVAARLEVPAQK----------
SYP_ENTFA       --------TPKKSHETQL------DLEKIATPEVGTIAEVANFFEVEPQR----------
SYP_LACS1       --------IPKQSHETPK------DLEKVATPNAKTIVEVAEFLGTDTQN----------
SYP_STRA3       --------KPSTKAATFE------EVTRVETPNCKSIDEVAGFLSIDENQ----------
SYP_STRA5       --------KPSTKAATFE------EVTKVETPNCKSIDEVAGFLSIDENQ----------
SYP_STRA1       --------KPSTKAATFE------EVTKVETPNCKSIDEVAGFLSIDKNQ----------
SYP_STRP1       --------KPSSKVAAED------ALAEVETPHCKTIDEVAAFLSVDETQ----------
SYP_STRPM       --------KPSSKVAAED------ALAEVETPHCKTIDEVAAFLSVDETQ----------
SYP_STRP3       --------KPSSKVAAED------ALAEVETPHCKTIDEVAAFLSVDETQ----------
SYP_STRPF       --------KPSSKVAAED------ALAEVETPHCKTIDEVAAFLSVDETQ----------
SYP_STRP8       --------KPSSKVAAED------ALVEVETPHCKTIDEVAAFLSVDETQ----------
SYP_STRP6       --------KPSSKVAAED------ALAEVETPHCKTIDEVAAFLSVDETQ----------
SYP_STRPB       --------KPSSKVAAED------ALAEVETPHCKTIDEVAAFLSVDETQ----------
SYP_STRPC       --------KPSSKVAAED------ALAEVETPHCKTIDEVAAFLSVDETQ----------
SYP_STRPD       --------KPSSKVAAED------ALAEVETPHCKTIDEVAAFLSVDETQ----------
SYP_STRT1       --------TPATKVVTQE------EVSRVETPGCKSIDDVAAFLNIPEEQ----------
SYP_STRT2       --------TPATKVVTQE------EVSRVETPGCKSIDDVAAFLNIPEEQ----------
SYP_STRMU       --------KPNNKVVSHE------DIQRIETPNCKTIDEVAAFLEIDPTQ----------
SYP_STRPN       --------KPSNRVVAEE------EVTRVATPDVKSIDEVAAFLNVPEEQ----------
SYP_STRR6       --------KPSNRVVAEE------EVTRVATPDVKSIDEVAAFLNVPEEQ----------
SYP_LACLA       --------EPNVAYTEEL------ELEKVATPGAKTIDEVSKFLEIDEEQ----------
SYP_LACAC       --------TFKQEPEEAK------ELTKVATPACDTIKKLAEFLDVPATR----------
SYP_LACJO       --------TFKQEPEEAK------DLAKVATPGMDTIEKLADFLKVPSTR----------
SYP_FUSNN       --------INPPK-EELK------EVELVHTPDCPTIESLAKYLDVPLER----------
SYP_DEHM1       -------KKTLPKEP-PK------DLEEVATPGQKTISEVAAFLSLKPEN----------
SYP_DEHMC       -------KKTLPKET-LK------DLEEVATPGQKAISDVARFLAVKPEN----------
SYP1_ANADE      -------VAAEADGPGLA------APEKFPTPGVVTIEALEQAPHSVPARR---------
SYP_CARHZ       -------FTPEV-IGTPA------EIQKVATPNVKTVDEVAEFLKVEKKQ----------
SYP_MOOTA       -------ALPMIATENPA------PLKEVATPGQKTVAEICTFLEVTPDR----------
SYP_DESHY       -------PAPMAVDAPIG------AYRSVDTPGTKTIEQVAEFLKVSKSD----------
SYP_CLOAB       -------VPEKADKEELG------ELKKVETPHAKTIEELVEFFGVDSKK----------
SYP_CLOTE       -------ISEKFDQEELK------ELAKIETPNVKTIDQLIKFLEINPAK----------
SYP_CLOPE       -------TPEHGEKEELM------EVEKVETPAVKSIEDLAKFFECSPKK----------
SYP_CALS4       -------LIESRD-EEML------EIEKVYTPNVKTIEELVDFLKISPSK----------
SYP_DESAG       -------CTLDECDAPVA------GVEEVHTPDRHTVEEVCEFMNVPAAA----------
SYP_DESVH       -------GTPCTRPA-AA------ALAEVPTPGAHTIEEVSAFLGVPADM----------
SYP_LAWIP       -------PPQTKALTLEK------SMEEVVTPGQHTIKAVSTFLTIPEQQ----------
SYP_GEOMG       -------PSEHA--EPR-------ELEKVETPQKRSVEEVTTFLGIPASS----------
SYP_GEOSL       -------PAEHA--EPR-------PLEKVETPAKRSVEEVTAFLGIPSSA----------
SYP_PELCD       -------ASDTP--VAAA------ELARVDTPGCKSIEEVAAFLKVDKER----------
SYP_DESPS       -------ATEND--EALA------ELEKIETPGKRKVNAVCDFLQITPQQ----------
SYP_SYNAS       -------EKMEISNDEML------LLTEVHTPNARTIDEVCAFLNVTPQE----------
SYP_MYCTU       ------DTLPIDGLPEAV---------VHDTGDTPTIASLVAWANEADL----GRTVTAA
SYP_MYCBO       ------DTLPIDGLPEAV---------VHDTGDTPTIASLVAWANEADL----GRTVTAA
SYP_MYCPA       ------DPQPVEGLPEAV---------VHDTGDTPTIATLVDWANRAGL----GRAVTAA
SYP_NOCFA       ------EPQPIEGRPAAV---------VHDTPDTPTIASLVEWANAAGIAEQFGRPVTAA
SYP_COREF       ------QERPIEGLPEAV---------VHETPVSETIETLVAWANSIGVTVD-GREVQAS
SYP_CORGL       ------VERDIEGLPEAV---------TYETPVSETIDALVDWANSIDVQIE-GREVTAA
SYP_CORDI       ------VERPLEQAPEAV---------EYETPNAETIEALVQWAQSAGVTVE-DRSVAAA
SYP_CORJK       ------PAQPIEGQPEAK---------EYETPDSETIEALVEWANSEGITID-GRAVEAA
SYP_THEFY       ------PERPIDGLPEAR---------VHHTPNTPTIESLVEFLNNAGL----GRTFTAA
SYP_LEIXX       ------PARPFEGLPSPE---------VHDTPNAPTIQALVEVANEQSP-RPDGRVWTAA
SYP_CUTAK       ------DPLPIDGLPEAE---------VVDTPDARTIESLVRIANEVRP-RAD-RPWTGA
SYP_BIFLO       ------PEIDASTTPAAS---------KEATPDAKTIDNMIERANADHPRTD-GREWQAS
SYP_STRCO       ------PVDATD-VPAAE---------DIPTPDTPTIETLAASLG-----------VEAS
SYP1_STRAW      ------AVESVE-HPAVE---------ELDTPDTPTIESLAEYLG-----------VPAS
SYP_TROW8       ------PAIDYSNAPEAE---------DCETPGVISIPDLVNHMNSSGR--FIGRVIESS
SYP_TROWT       ------PAIDYSNAPEAE---------DCETPGVISIPDLVNHMNSSGR--FIGRVIESS
SYP_TREPA       LPD--THDTHLKDEHEGSDLKTPAAMREVHTPHVKTIEELEHFLHVPAH-----------
SYP_TREDE       -----DKEQGNGNMPQGS----ALSIEEIDTPNVKTIEDLTAFLKTESS-----------
SYP_LEPIC       ------KENGSAKFSEKK---------EISTPGKKTISEVSTLLGVSES-----------
SYP_LEPIN       ------KENSSAKFSEKK---------EISTPGKKTISEVSTLLGVSES-----------
SYP_CHLTR       S-------YVYDSNLLPV--------EEVATPNIRTIEDLEVFFNTPKHK----------
SYP_CHLTA       S-------YVYDSNLLPV--------EEVATPNIRTIEDLEVFFNTPKHK----------
SYP_CHLMU       S-------YTYSSELLPM--------KEVATPNVRTIEDLETFFNTPRQQ----------
SYP_CHLCV       Q-------YTYDKEHLPI--------EEVATPDVRTMEHLQDFFSLPSHK----------
SYP_CHLFF       Q-------YTYDKEFLPI--------EEVATPDVRTIENLQDFFSIPPYR----------
SYP_CHLAB       Q-------YTYDKDYLPI--------EEVDTPDVRTIENLQDFFSVPPYR----------
SYP_CHLPN       Q-------HAYDREFLPV--------EEVATPGITTIEALANFFSIPLHK----------
SYP_NOSS1       --------DAEPSQFTTF--------EKRETPGTETIEKVTQFLKASPTQ----------
SYP_TRIV2       --------DAEPSQFTAF--------EKRETPGTETIEKVTQFLKASPTQ----------
SYP_SYNP6       --------EAIASAFTTF--------EKRETPGTDTIASLCEFLKADPTQ----------
SYP_SYNE7       --------EAIASAFTTF--------EKRETPGTDTIASLCEFLKADPTQ----------
SYP_SYNY3       --------DAKPSPFSGY--------KKQSAPNTATIAKMCQCLDCDASN----------
SYP_THEEB       --------DAVPTTYKTV--------ATLDTPNAATIDALVEQLQCHPTQ----------
SYP_SYNJA       --------PAADSPYTTF--------QVLDTPGTETIEKLANFLKISPTL----------
SYP_SYNJB       --------PAAESPYTAF--------QVLDTPGTETIEKLAAFLKISSTL----------
SYP_PROM9       --------QPIPLKNNIS--------GWIETPEQKTILEVCKNNNLDPSQ----------
SYP_PROMP       --------KEIPLIRSHE--------EWIETPNQKSIVDICQNNNLDASQ----------
SYP_PROMA       --------DPIFLDKKEP--------CIIQTNGQRTIKELCDNQGFHPSQ----------
SYP_PROMT       --------EGKLLEPNKP--------SIIKTPNQKTIDELCNYNDFHPSQ----------
SYP_SYNPX       --------AVASLPPAAL--------TLLKTPGQTTIEGLCTAQAWQPGQ----------
SYP_SYNS9       --------KAIPLEGASM--------ELISTPDETSIDVLCRSHGWHQSQ----------
SYP_SYNSC       --------AASPLPDGPE--------ESIPTPGLGSIESLCDTKCWDPSQ----------
SYP_PROMM       --------KAIPLPASKV--------ALLDTPEQGTIETLCTAQGLVPSQ----------
SYP_GLOVI       --------DPEAIGPGSY--------AVKSTPGIRTVEQQAAMLGVPISR----------
SYP_HELPY       PEP--------LNVPKAQ-------LAKFPTPNTTSAQSVAEFFKTEPYF----------
SYP_HELPJ       TEP--------LMSPSA--------LAKFPTPNTTSAPSVAEFFKTEPYF----------
SYP_CAMJE       TCQ-------DERPEANY-------ASKFHTPNIKTIDSLAQFFKINAFY----------
SYP_CAMJR       TCQ-------DERPEANY-------ASKFHTPNIKTIDSLAQFFKINAFY----------
SYP_HELHP       TAPRPNEIKYDSNAPQAA-------FARFFTPDIKNIESLSAFFKVDKFW----------
SYP_WOLSU       KV--------DSPAPIAS-------FSKFKTPEVKSIEALAEFFKVDPFY----------
SYP_SHIBS       -------PKEPRAAATQE-------MTLVDTPNAKTIAELVEQFNLPIEK----------
SYP_SHIFL       -------PKEPRAAATQE-------MTLVDTPNAKTIAELVEQFNLPIEK----------
SYP_SHISS       -------PKEPRAAATQE-------MTLVDTPNAKTIAELVEQFNLPIEK----------
SYP_ECOLI       -------PKEPRAAATQE-------MTLVDTPNAKTIAELVEQFNLPIEK----------
SYP_ECO57       -------PKEPRAAATQE-------MTLVDTPNAKTIAELVEQFNLPIKK----------
SYP_SHIDS       -------PKEPRAAATQE-------MTLVDTPNAKTIAELVEQFNLPIKK----------
SYP_ECOL6       -------PKEPRAAATQE-------MTLVDTPNAKTIAELVEQFNLPIEK----------
SYP_ECOUT       -------PKEPRAAATQE-------MTLVDTPNAKTIAELVEQFNLPIEK----------
SYP_SALPA       -------PQTPRAAATQE-------MTLVDTPNAKTIAELVEQFNLPIEK----------
SYP_SALTI       -------PQTPRAAATQE-------MTLVDTPNAKTIAELVEQFNLPIEK----------
SYP_SALTY       -------PQTPRAAATQE-------MTLVDTPNAKTIAELVEQFNLPIEK----------
SYP_SALCH       -------PQTPRAAATQE-------MTLVDTPNAKTIAELVEQFNLPIEK----------
SYP_YERPE       -------PTEPRAPATEE-------LRIVDTPNAKTIAELVEQFKLPIEK----------
SYP_YERPS       -------PTEPRAPATEE-------LRIVDTPNAKTIAELVEQFKLPIEK----------
SYP_PECAS       -------PKLGRAEAKEE-------LRLIDTPNAKTIAELVEQFKLPVEK----------
SYP_SODGM       -------PAAARAAPGED-------MRLVNTPDARTIAELVAQFSLPVEK----------
SYP_PHOLL       -------PAHDRAVPTED-------MHLVDTPNAKTIAELVEQFNLPIEK----------
SYP_HAEIN       -------IGE-RQAPTAE-------MCLVDTPNAKTIAELVEQFNLPIEK----------
SYP_HAEI8       -------IGE-RQAPTAE-------MCLVDTPNAKTIAELVEQFNLPIEK----------
SYP_MANSM       -------VGE-RAQPGAA-------MQLVDTPNAKTIAELVEQFNLPIEK----------
SYP_HAEDU       -------MGE-SKPATEA-------MVLIDTPNAKTIAELVAQFDLAIEK----------
SYP_PASMU       -------LGE-RGAATEE-------LRVVDTPNAKTIAELVEQFNQPIEK----------
SYP_BAUCH       ---------------SEN-------LQLVDAPGIYTLTELVKLFNLPIEK----------
SYP_VIBVU       -------PAVERAAPTQE-------MTLVDTPNAKTIAELVEQHGIAIEK----------
SYP_VIBVY       -------PAVERAAPTQE-------MTLVDTPNAKTIAELVEQHGISIEK----------
SYP_VIBPA       -------PAVERAEPTQE-------MTLVDTPNAKTIAELVEQHGLPIEK----------
SYP_ALIF1       -------PTTERAAPTQE-------MTTVDTPNAKTIAELVEQHGIAIEK----------
SYP_VIBCH       -------PAIERPAPTQA-------MTLVDTPNAKTIAELVEQHGLPIEK----------
SYP_PHOPR       -------PTAELAAATQE-------MELVDTPNAKTIAELVEQHGLAIEK----------
SYP_SHEON       -------PTETRGAATKE-------LRLVDTPNAKTIAELVEQFGLDITK----------
SYP_PSE14       -------REKARPAATEE-------LRLIDTPNAKTIAQLVEGFDLPIEK----------
SYP_PSEU2       -------REKTRPAATEE-------LRLIDTPNTKTIAQLVEGFGLPIEK----------
SYP_PSESM       -------REKARAAATEE-------LRLVDTPNAKTIAQLVEGFGLPIEK----------
SYP_PSEF5       -------RETSRPAPAEE-------LRLVDTPDTKTIAALVEKFNLPIEK----------
SYP_PSEPF       -------RETSRAAPSEE-------LRLVDTPDTKTIAALVEKFNLPIEK----------
SYP_PSEPK       -------RETVRPAPTEE-------LRLVDTPNAKTIAQLVENHGLPIEK----------
SYP_PSEAE       -------RESARGSATED-------MRLVDTPNTKTIAALVDGFQLPIEK----------
SYP_CHRSD       PLG----ETPERPAPQEE-------LRLVDTPNARTIATLVEQHGLPIEK----------
SYP_PSYA2       -------TAERQPATMA--------RENVDTVNMPTCEAVAEYLNVELAT----------
SYP_PSYCK       -------MAERQPATMA--------RENIDTVNMPTCEAVAEHLNVPLAT----------
SYP_ACIAD       -------VGERAAPAQA--------LSIVDTPNQKTIADVCTFLNADPKQ----------
SYP_HAHCH       -------TLKQAPAPSKD-------MAKVATPGQRTIESVSEFLNLPAEQ----------
SYP_SACD2       -------PAKQTAEPLP--------REEVATPNVKTIEDVAKLLDVPTTQ----------
SYP_COLP3       -------PAGERAEPTQT-------LTKVATPNVKSMDDLVQCLSVDLKT----------
SYP_IDILO       -------PAGERPAPNQK-------VEKHEVQG-DELAAVLQPLSVESQQ----------
SYP_PSEHT       -------PSEPRPAATKE-------LKAFPTPDAKTINELKKHYGVKPHR----------
SYP_HYDCU       -------PRGERAAATEE-------LTKVETPNKHSIEDVCDFLQLKKKK----------
SYP_COXBU       -------PQGERVKPVAE-------MKKIATPGVRTIKQLADKANILPEK----------
SYP_NITOC       -------PTDKPASPKET-------LSLIETPGQCTIKEISQFLNIPSSR----------
SYP_METCA       -------PTAPRPAPTAA-------LLKVETPGKKSIAEVSEFLGVPPHQ----------
SYP_LEGPA       -------PPKANQACNET-------ITLVDTPNQKTIDEVASFLGIASNQ----------
SYP_LEGPL       -------PPKANQSCNET-------ITLVDTPNKKTIDEVASFLGIASNQ----------
SYP_LEGPH       -------PLKANQPCNET-------ITLVDTPNQKTIDEVASFLGIASNQ----------
SYP_FRATH       -------DLSKRVNSQNT-------IEKIHTPNIKTIEKLCKEMSFDIKK----------
SYP_FRATT       -------DLSKRVNSQNT-------IEKIHTPNIKTIEKLCKEMSFDIKK----------
SYP_BORBR       L--------ATRAAPGQD-------LEAVPTPGAAKCEDVAKLLDLPLAR----------
SYP_BORPE       L--------ATRAAPGQD-------LEAVPTPGAAKCEDVAKLLDLPLAR----------
SYP_BORPA       L--------AARAAPAQD-------LEAVPTPGAAKCEDVAKLLGLPLAR----------
SYP_BORA1       L--------TERARPAEA-------LQEVATPGAAKCEAVAELLGLPLSQ----------
SYP_AROAE       L--------ATRAAPAQA-------LEKTPTPGRTTCEEVAKLLGVPLET----------
SYP_RHOFT       S--------GPRAAPKQA-------FAKTATPGKSTCADVAELLQVPLQH----------
SYP_BURP1       L--------ASRAAPAEA-------MQKVATPGKAKCEAVAELMGIPLER----------
SYP_BURPS       L--------ASRAAPAEA-------MQKVATPGKAKCEAVAELMGIPLER----------
SYP_BURMA       L--------ASRAAPAEA-------MQKVATPGKAKCEAVAELMGIPLER----------
SYP_BURTA       L--------ASRAAPAEA-------MQKVATPGKAKCEAVAELMGIPLER----------
SYP_BURL3       I--------AERAAPAEA-------MEKVATPGKAKCEAVAELLAIPLER----------
SYP_CUPPJ       V--------AERAAPTQA-------LEKTFTPEKVKCEQVAEFLGIPLER----------
SYP_CUPMC       L--------ATRAAPAEE-------LKKTSTPEKAKCEHVAEFLGIPLER----------
SYP_RALSO       A--------MPRGAATEA-------LTKTHTPKRAKCEAVAEQLGIALQR----------
SYP_CHRVO       A--------GERPAASAA-------LAKVHTPKVKTIAELVDFLKIDIKQ----------
SYP_NEIMA       K--------GERTAAQAE-------LVKVHTPNVKTIESLVEFLNIPVEQ----------
SYP_NEIMB       K--------GERAAAQAE-------LVKVHTPNVKTIDSLVDFLSIPIEK----------
SYP_NEIG1       K--------GERAAAQAV-------LTKVHTPNVKTIESLVEFLNIPVEQ----------
SYP_NITEU       G--------IPRKEPAGI-------MAKIATPDRKSCQDVADFLGIPVEQ----------
SYP_NITMU       A--------GLREAAAGE-------MQKVRTIAQKTCEEVAAYLNVSIEQ----------
SYP_THIDA       A--------AARGAPQEA-------MREVETPKQTTCEDVAALLGIPLAR----------
SYP_DECAR       N--------EARAAASTL-------MEKTHTPGKMACADVAKFLELPLDR----------
SYP_XANAC       ---------APRAAASEA-------MQQVATPTQKTCEDVAQLLGIALQR----------
SYP_XANC5       ---------APRAAASEA-------MQQVATPTQKTCEDVAQLLGIALQR----------
SYP_XANOM       ---------APRAAASEA-------MQQVATPTQKTCEDVAQLLGIALQR----------
SYP_XANOR       ---------APRAAASEA-------MQQVATPTQKTCEDVAQLLGIALQR----------
SYP_XANC8       ---------APRPAAGET-------LQRVDTPTQKTCEDVAQLLGLPLQR----------
SYP_XANCP       ---------APRPAAGET-------LQRVDTPTQKTCEDVAQLLGLPLQR----------
SYP_XYLFA       ---------GPRLTANET-------LQKVSTPTQKRCEDVAALLDIPLQR----------
SYP_XYLFT       ---------GPRLTANET-------LQKVSTPTQKRCEDVAALLDIPLQR----------
SYP_BUCAI       ---------IDFFKKKYS------SCLIKNKTNTKKSIIMSEKLNTPLIN----------
SYP_BUCAP       ---------INFLKEK--------NRIIPNQIKSKKCTKNFNEFKKPIKN----------
SYP_BUCBP       N-------HIKYSTNNYF------KKIKILRNNNDIYKKLSNTPNFKKSN----------
SYP_BLOFL       N-------NIHILNTIQT------IKLTSADFHNLIIMRLINYYKSFIQE----------
SYP_BLOPB       I-------KIQPKTAVET------MQLIAAP-NIRSVEELINQFNLPIHQ----------
SYP_WIGBR       N-------KFKKKIEIKN------LIEINAE-DILLTSDLAKKFNIDIKQ----------
                                                                            

SYP_AQUAE       -IMKAVLYIVNEK--------------------EPVLVLIRGDREIDENKLEKVLG----
SYP_THEMA       -IVKSLLYKGRE---------------------GYVMVLIRGDLELNEAKLKAHLK----
SYP_BACSU       -CIKSVLFKAD---------------------DRFVLVLVRGDHEVNDIKVKNLLH----
SYP_BACLD       -CIKSMLMKAD---------------------GRFVLVLTRGDHEVNDVKVKNLLQ----
SYP1_BACAN      -CIKSMVFKVD---------------------EKLVVVLVRGDHEVNDVKVKNVYG----
SYP1_BACCZ      -CIKSMVFKVD---------------------EKLVVVLVRGDHEVNDVKVKNVYG----
SYP1_BACHK      -CIKSMVFKVD---------------------EKLVVVLVRGDHEVNDVKVKNVYG----
SYP1_BACC1      -CIKSMVFKVD---------------------EKLVVVLVRGDHEVNDVKVKNVYG----
SYP1_BACCR      -CIKSMVFKVD---------------------EKLVVVLVRGDHEVNDVKVKNVYG----
SYP_GEOKA       -CIKSLLFNVD---------------------GRYVLVLVRGDHEANEVKVKNVLD----
SYP_LISMF       -TMKSMLYQVD---------------------DEVIMVLVRGDHEVNDIKIKNALD----
SYP_LISMO       -TMKSMLYQVD---------------------DEVIMVLVRGDHEVNDIKIKNALD----
SYP_LISIN       -TMKSMLYQVD---------------------EEVIMVLVRGDHEVNDIKIKNALD----
SYP_STAA3       -IVKTMIFKVD---------------------GEYIMVLVRGHHEINDIKLKSYFG----
SYP_STAA8       -IVKTMIFKVD---------------------GEYIMVLVRGHHEINDIKLKSYFG----
SYP_STAAC       -IVKTMIFKVD---------------------GEYIMVLVRGHHEINDIKLKSYFG----
SYP_STAAM       -IVKTMIFKVD---------------------GEYIMVLVRGHHEINDIKLKSYFG----
SYP_STAAN       -IVKTMIFKVD---------------------GEYIMVLVRGHHEINDIKLKSYFG----
SYP_STAAW       -IVKTMIFKVD---------------------GEYIMVLVRGHHEINDIKLKSYFG----
SYP_STAAS       -IVKTMIFKVD---------------------GEYIMVLVRGHHEINDIKLKSYFG----
SYP_STAAR       -IVKTMIFKVD---------------------GEYIMVLVRGHHEINDIKLKSYFG----
SYP_STAAB       -IVKTMIFKVD---------------------GEYIMVLVRGHHEINDIKLKSYFG----
SYP_STAHJ       -IVKSMIFKID---------------------GEFIMFLIRGHHELNDVKVKAFFE----
SYP_STAS1       -ITKSMVFKID---------------------GEFIMVLVRGHHELNDIKLKAYFG----
SYP_STAES       -IVKTMIFKID---------------------GEFIMFLVRGHHELNEVKLKSYFG----
SYP_STAEQ       -IVKTMIFKID---------------------GEFIMFLVRGHHELNEVKLKSYFG----
SYP_BACHD       -IIKSLLVSID---------------------DEWALILLRGDHELNDIKLKHALG----
SYP_BACSK       -IFKALVVVVD---------------------DVLSLFILRGNDELNEVKALHELG----
SYP_LACPL       -LVKSILFIAD---------------------DQPVMALVRGDHEVNDVKLKNYLG----
SYP_LACSS       -IIKSVLFIAD---------------------EKPVLVLVRGDYEVNDVKLKNFLD----
SYP_ENTFA       -IIKSVLFIAD---------------------EEPVMVLVRGDHDVNDVKLKNFLG----
SYP_LACS1       -EIKTLLFIAD---------------------DEPVVVLMRGIDEVNEVKLKNHLG----
SYP_STRA3       -TIKTLLFIAD---------------------EQPVVALLVGNDQVNDVKLKNYLA----
SYP_STRA5       -TIKTLLFIAD---------------------EQPVVALLVGNDQVNDVKLKNYLA----
SYP_STRA1       -TIKTLLFIAD---------------------EQPVVALLVGNDQVNDVKLKNYLA----
SYP_STRP1       -TIKTLLFVAD---------------------NEPVVALLVGNDHINTVKLKNYLA----
SYP_STRPM       -TIKTLLFVAD---------------------NEPVVALLVGNDHINTVKLKNYLA----
SYP_STRP3       -TIKTLLFVAD---------------------NEPVVALLVGNDHINTVKLKNYLA----
SYP_STRPF       -TIKTLLFVAD---------------------NEPVVALLVGNDHINTVKLKNYLA----
SYP_STRP8       -TIKTLLFVAD---------------------NEPVVALLVGNDHINTVKLKNYLA----
SYP_STRP6       -TIKTLLFVAD---------------------NEPVVALLVGNDHINTVKLKNYLA----
SYP_STRPB       -TIKTLLFVAD---------------------NEPVVALLVGNDHINTVKLKNYLA----
SYP_STRPC       -TIKTLLFVAD---------------------NEPVVALLVGNDHINTVKLKNYLA----
SYP_STRPD       -TIKTLLFVAD---------------------NEPVVALLVGNDHINTVKLKNYLA----
SYP_STRT1       -TIKTLLFTAD---------------------DEPVVALLVGNDQVNDVKLKNYLA----
SYP_STRT2       -TIKTLLFTAD---------------------DEPVVALLVGNDQVNDVKLKNYLA----
SYP_STRMU       -TIKTLLFIAD---------------------DEPVVALLVGNDQVNEVKLKNYLG----
SYP_STRPN       -TIKTLFYIAD---------------------GELVAALLVGNDQLNEVKLKNHLG----
SYP_STRR6       -TIKTLFYIAD---------------------GELVAALLVGNDQLNEVKLKNHLG----
SYP_LACLA       -TVKTLVYHAD---------------------DELVVVLLNGNDQLNEVKLTNYLG----
SYP_LACAC       -IVKSILYIAD---------------------DQKVLVLIRGDKQINEVKLGHVLD----
SYP_LACJO       -IVKSILYIAD---------------------DQKVLVLIRGDKEINEVKLGHILD----
SYP_FUSNN       -TVKALTYKDMG-T------------------DEIYMVLIRGDFEVNEVKLKNILN----
SYP_DEHM1       -TLKAVFYMAD---------------------GKFVMAVIRGDLDINEIKLKNLLK----
SYP_DEHMC       -TLKAVFYMAD---------------------GKFVMAVIRGDLDINEIKLKNLLK----
SYP1_ANADE      -QLKTLVYMAD---------------------ERPVIAVVRGDQELNEAKLQTATG----
SYP_CARHZ       -ILKSVLFKAD---------------------DGYVLAVVRGDREVNEVKVKNQVD----
SYP_MOOTA       -LIKTLFYEAD---------------------GQLIAALVRGDRELNEVKLQNHLG----
SYP_DESHY       -LVKSLLYQGD---------------------DKLILVLVRGDREINEIKVNNALGP---
SYP_CLOAB       -FVKTIIYRAE---------------------NKVVAVMVRGDREVNETKVKNAVG----
SYP_CLOTE       -LVKTLIYKVD---------------------DKVVAVAIRGDREANEIKIINALGG---
SYP_CLOPE       -IAKTLIFQAD---------------------DKVVAVVLRGDREANEVKIANAIGE---
SYP_CALS4       -FVKTLIYKAK---------------------GKVVAALVRGDRDINETKLLNVLSIR--
SYP_DESAG       -LIKTLLYVAD---------------------GEPVAALVRGDRELNEAKLKNLLR----
SYP_DESVH       -LVKTLLFVAD---------------------GEPVAALVRGDRELNEVKLKNLLG----
SYP_LAWIP       -IIKTILYTID---------------------NKPVAVLVRGDREVNEVKVKNMLD----
SYP_GEOMG       -LVKTLLCVAD---------------------GEPVAALVRGDHDLNEIKLKHLLG----
SYP_GEOSL       -LVKTLLVVAD---------------------GTPVAALVRGDHDLNEIKLKHLLG----
SYP_PELCD       -LVKTLIVQTDA--------------------GETLAVLLRGNHELNDIKLCRLLG----
SYP_DESPS       -LVKTMVFEAD---------------------GEAVAVLVRGDREVEEVKLKNLLG----
SYP_SYNAS       -IVKTLIFNAD---------------------GNPVAVLVRGDEEVNEIKVKNYLK----
SYP_MYCTU       DTLKNVLIKVRQPGGDTE----------------LLAIGVPGDREVDDKRLGAALE----
SYP_MYCBO       DTLKNVLIKVRQPGGDTE----------------LLAIGVPGDREVDDKRLGAALE----
SYP_MYCPA       DTLKNVLLKVRQPGGDWE----------------LLAIGLPGDREVDDKRLGAALE----
SYP_NOCFA       DTLKNVMVKLRHPDGKTE----------------IVGIGVPGDREVDDKRLGASVE----
SYP_COREF       DTLKCIVVKTREPGAEEW---------------ELTGVLVPGDREVDMKRLEASLE----
SYP_CORGL       DTLKCIVVKVREPGAEEA---------------ELTGILLPGDREVDMKRLEASLE----
SYP_CORDI       DTLKCLLVKITQPGAEEA---------------ELAGILLPGDREVDMKRLEASVE----
SYP_CORJK       DTLKCIVIKVNDPTLDEEGK---------PRGESLAGVLVPGNREVDMKRLEASME----
SYP_THEFY       DTLKNVMVKTRAPGEKEW---------------ELLGIGVPGDREVDMKRLEASLA----
SYP_LEIXX       DTLKNVVLALTHLDGTRE----------------LVVVGLPGDREVDLKRAEVAFA----
SYP_CUTAK       DTLKNVVFMVAHPDGTRE----------------PLAIGLPGDRDVDEKRLEAVLE----
SYP_BIFLO       DILKNVVITVKHPEDEEHDE---------PW-REVIVVGVPGDRTVDMKRLEAQFA----
SYP_STRCO       ATLKNLLVKVDGE---------------------IVAVGVPGDREVDMDKVEAHFA----
SYP1_STRAW      ATLKNLLVKADGE---------------------IVAVGVPGDREVDLGKLGEHLA----
SYP_TROW8       DCLKCLLFRIEYAEVQNGNPGNLVVKKILERGFEYIGFLVPGDRNVDLKRAQVALS----
SYP_TROWT       DCLKCLLFRIEYAEVQNGNPSNLVVKKILERGFEYIGFLVPGDRNVDLKRAQVALS----
SYP_TREPA       RCIKTLIYRIDTV----------PQAAGH-----FVAVCIRGDLELNESKLEALLR----
SYP_TREDE       SFIKTLIYRVENSEILGNAE-NGKKAAKNENKTVLIAVCIRGDLEVNEAKLKSSLK----
SYP_LEPIC       ETIKAVALKSEKK---------------------KILVFLRGDLELNLHKLHSLLK----
SYP_LEPIN       ETIKAVALKSEKK---------------------KILVFLRGDLELNLHKLHSLLK----
SYP_CHLTR       -ILKTLVVKTCQKD----------------SEK-FFAICIRGDRQINLTKVASFLQVDD-
SYP_CHLTA       -ILKTLVVKTRQKD----------------SEK-FFAICIRGDRQINLTKVASFLQVDD-
SYP_CHLMU       -IIKTLVVKVHKKG----------------SEQ-FFAICIRGDRQVNLTKVSSFLQADD-
SYP_CHLCV       -IIKTLVVKLSYGE----------------KDK-FVAISIRGDRQINLTKIRSKLNADE-
SYP_CHLFF       -IMKTLVVKLSYGE----------------KNT-FVAIGIRGDRQINLTKIRSKLNADE-
SYP_CHLAB       -IMKTLVVKLSYGE----------------KEK-FTAIGIRGDRQINLTKIGSKLNADA-
SYP_CHLPN       -ILKTLVVKLSYSN----------------EEK-FIAIGMRGDRQVNLVKVASKLNADD-
SYP_NOSS1       -IVKNVLYQTAYDN----------------GVTVLVLVIIRGDQEVNEVKLQNELTKLAA
SYP_TRIV2       -IVKNVLYQTVYDN----------------GVTVLVLVIIRGDQEVNEVKLQNELTKLAP
SYP_SYNP6       -VVKQVLYQAVFDN----------------GKLLPILISIRGDQSVNEIKLTNELTRRAA
SYP_SYNE7       -VVKQVLYQAVFDN----------------GKLLPILISIRGDQSVNEIKLTNELTRRAA
SYP_SYNY3       -VVKNVLYQAVYNS----------------GKAVLVLVSIRGDQEVNEVKLTNELTKLAP
SYP_THEEB       -IVKNVLYRAVFDN----------------GRVGLVLVSIRGDQEVNSVKLHNTLTSLAP
SYP_SYNJA       -IVKNVLYQALYDN----------------GLRVVVLLSIRGDQEVNEVKLANHLNRLAE
SYP_SYNJB       -IVKNVLYQALYDN----------------GLRVAVLLSIRGDQEVNEVKLANHLSRLAE
SYP_PROM9       -IIKVVVFLAKFEI----------------KSEVPILACIRGDQHINEVKLFNLINKLH-
SYP_PROMP       -IIKVVIFLAKFED----------------KSEVPILACIRGDQNINEVKLFNLINKKY-
SYP_PROMA       -ILKVIILLAVLEK----------------NDLQPILVSIRGDQELNEVKLINAVSKYL-
SYP_PROMT       -IVKVLAYLATCDD----------------NKKYPVLVSIRGDQEINDIKLSNKISQEL-
SYP_SYNPX       -LVKVLLLLAQLED----------------GQQQPVLVSLRGDQDLNEVKLVNAVSRRS-
SYP_SYNS9       -LIKVLLFIARLDD----------------GVEQPLLISLRGDQDLNEVKLINAVGRLS-
SYP_SYNSC       -VVKVLLFVATLDD----------------ETLQPLLVSLRGDQELNPTKVVNAVSRTL-
SYP_PROMM       -VVKVLVMLARFED----------------GELQPVLVSIRGDQQLNEVKLINALSREL-
SYP_GLOVI       -IVKNIVYVALYAE----------------ADPRPVLVSIRGDRHINETKLKNRL-----
SYP_HELPY       -VLKALVRKVIHKD-----------------KETLACFFVRGDDNLEEVKALNALNIIG-
SYP_HELPJ       -VLKALVNKVIHKD-----------------KETLACFFVRGDDNLEETKALNTLNLLG-
SYP_CAMJE       -TIKAVVKKAIYEN-----------------ESKLVVFFIRGSDDLQEVKAQNTCSAL--
SYP_CAMJR       -TIKAVVKKAIYEN-----------------ESKLVVFFIRGSDDLQEVKAQNACSAL--
SYP_HELHP       -TIKAIVKKAIKANN----------------ESELVYFFVRGDDEGEETKMLNAINKHT-
SYP_WOLSU       -TLKVVVKKAFFDGG----------------KSELAFFFLRGCDSLQETKACNAIGAN--
SYP_SHIBS       -TVKTLLVKAVEGS-----------------SFPLVALLVRGDHELNEVKAEKLPQVA--
SYP_SHIFL       -TVKTLLVKAVEGS-----------------SFPLVALLVRGDHELNEVKAEKLPQVA--
SYP_SHISS       -TVKTLLVKAVEGS-----------------SFPLVALLVRGDHELNEVKAEKLPQVA--
SYP_ECOLI       -TVKTLLVKAVEGS-----------------SFPQVALLVRGDHELNEVKAEKLPQVA--
SYP_ECO57       -TVKTLLVKAVEGS-----------------SFPLVALLVRGDHELNEVKAEKLPQVA--
SYP_SHIDS       -TVKTLLVKAVEGS-----------------SFPLVALLVRGDHELNEVKAEKLPQVA--
SYP_ECOL6       -TVKTLLVKAVEGS-----------------SFPLVALLVRGDHELNEVKAEKLPQVA--
SYP_ECOUT       -TVKTLLVKAVEGS-----------------SFPLVALLVRGDHELNEVKAEKLPQVA--
SYP_SALPA       -TVKTLLVKAVKDS-----------------KSPLVALLVRGDHELNEVKAEKLPHVA--
SYP_SALTI       -TVKTLLVKAVKDS-----------------KSPLVALLVRGDHELNEVKAEKLPHVA--
SYP_SALTY       -TVKTLLVKAVKDS-----------------KSPLVALLVRGDHELNEVKAEKLPHVA--
SYP_SALCH       -TVKTLLVKAAKDS-----------------KSTLVALLVRGDHELNEVKAEKLPHVA--
SYP_YERPE       -TVKTLLVHAHEES-----------------GHKLVALLVRGDHDLNEIKAEKLPQVA--
SYP_YERPS       -TVKTLLVHAHEES-----------------GHKLVALLVRGDHDLNEIKAEKLPQVA--
SYP_PECAS       -TVKTLLVKATEES-----------------GHQLVALLVRGDHELNEIKAEKIAQVA--
SYP_SODGM       -TVKTLLVRAREDA-----------------GHPLVALMVRGDHHLNDVKAEKLPQVA--
SYP_PHOLL       -TVKTLMVHAAEGT-----------------SHKLIALLVRGDHELNEIKAEKLSLVA--
SYP_HAEIN       -TVKTLIVKGADEN------------------QPLVALIIRGDHELNEIKAQKHPLVA--
SYP_HAEI8       -TVKTLIVKGADEN------------------QPLVALIIRGDHELNEIKAQKHPLVA--
SYP_MANSM       -TVKTLIVKGATEE------------------QPLVALIIRGDHDLNEIKAEKLPEVA--
SYP_HAEDU       -TVKTLIVKGANET------------------APLVALILRGDHELNEIKAQKHPLVA--
SYP_PASMU       -TVKTLVVHATEES-----------------GHKLVALLVRGDHELNEIKAEKVDIVA--
SYP_BAUCH       -IAQIIIVHAQQNA-----------------LYPLVALMVRGDHSINYAQVEKLPQVA--
SYP_VIBVU       -TVKTLFVKASDAI-----------------EAPIVALIIRGDHELNEIKAENLAEVA--
SYP_VIBVY       -TVKTLFVKASDAI-----------------EAPIVALIIRGDHELNEIKAENLAEVA--
SYP_VIBPA       -TVKTLFVKASDEI-----------------DAPIIALIVRGDHELNEVKAENLPQVA--
SYP_ALIF1       -TVKTLFVKASDEV-----------------DADIIALIIRGDHELNEVKAENLPQVA--
SYP_VIBCH       -TVKTLFVKASDEI-----------------DAPIVALIIRGDHELNEIKAEKLAEVA--
SYP_PHOPR       -TVKTLFVKASDEI-----------------DADIVALIIRGDHELNEVKAENLPQVA--
SYP_SHEON       -TVKTLIVKGATE------------------EAPLVALIVRGDHELNEIKADKLDLVA--
SYP_PSE14       -TVKTLVVHAAEE-------------------GKLIALIIRGDHELNEIKASQLEQVA--
SYP_PSEU2       -TVKTLVVHAAEE-------------------GKLIALIIRGDHELNEIKASQLEQVA--
SYP_PSESM       -TVKTLVVHAAEE-------------------GKLIALIIRGDHELNEIKASQQELVA--
SYP_PSEF5       -TIKTLIVHAEEP-------------------GKLIALIIRGDHELNEIKAANQPGVA--
SYP_PSEPF       -TIKTLIVHAEEE-------------------GKLIALIIRGDHELNEIKAANQPGVA--
SYP_PSEPK       -TVKTLIVRGAEE-------------------GKLIALIVRGDHELNEIKATKLEQVA--
SYP_PSEAE       -TIKTLVVHGAEE-------------------GTLVALIVRGDHELNEIKAANQPLVA--
SYP_CHRSD       -TIKTLMVHGSEG-------------------G-LVALLVRGDHELNEVKAENLPEVA--
SYP_PSYA2       -TVKTLIVQGHTPE----------------GEPQLIAVVLRGDHTLNTIKAEKIEEAN--
SYP_PSYCK       -TVKTLIVQGHTPE----------------GEPQLIAVVLRGDHTLNTIKAEKIEEAN--
SYP_ACIAD       -SVKALLVQGNADEK---------------GNVPVIALFLRGDHELNEIKAEHHPLIA--
SYP_HAHCH       -TVKTLLVLGEAEEG---------------KPAPIIALVLRGDHVLNEIKAEKLPGVA--
SYP_SACD2       -TVKTLIVKGVENED---------------GKHTLVALVLRGDHALNDIKAIKLAHVA--
SYP_COLP3       -TVKTLLVVGATVEG---------------EAETVVALVLRGDHQLNEIKAEHLPQVA--
SYP_IDILO       -ATKSFIVKAA--DD---------------IDSEYVQLVLRADHELNTVKAEKLAQVA--
SYP_PSEHT       -GVKTLIVYAAPDEN---------------GVRGLVALVLRGDHDLNELKAEKHPLVD--
SYP_HYDCU       -VAKTLVVKGA---T---------------EEHPVVALVIRGDHDLNEIKAEKLDLVA--
SYP_COXBU       -GVKTLIVKGDESS--------------------LIALILRGDHELNDVKAQHLPGVA--
SYP_NITOC       -CIKTLLVQGSEGE--------------------LVALALRGDHELNAVKAQKLPQVA--
SYP_METCA       -ILKTVAVMQTIVDDDGL------------DRDMFVTVLLRGDHELNEVK---LGKVL--
SYP_LEGPA       -TIKTLIVKGKE--------------------HPMVALVLRGDDELNEVKATKHPLVH--
SYP_LEGPL       -TIKTLIVKGKE--------------------HPMVALVLRGDDELNEVKATKHPLVH--
SYP_LEGPH       -TIKTLIVKGKE--------------------HPMVALVLRGDDELNEVKAIKHPLVH--
SYP_FRATH       -TIKTMVIKDAGGN--------------------FFALVIRGDHELNETKINKLDQII--
SYP_FRATT       -TIKTMVIKDAGGN--------------------FFALVIRGDHELNETKINKLDQII--
SYP_BORBR       -TIKSIVLAVDQPEG----------------PAQVWLLLLRGDHELNEIKAGKLPGL---
SYP_BORPE       -TIKSIVLAVDQPEG----------------PAQVWLLLLRGDHELNEIKAGKLPGL---
SYP_BORPA       -TIKSIVLAVDQPEG----------------PAQVWLLLLRGDHELNEIKAGKLPGL---
SYP_BORA1       -TVKSIVLATESEKD----------------GVQIWLVLLRGDHELNEVKVGKVPGL---
SYP_AROAE       -TVKSLVLATDDVDDTNKP-----------AGVTVWLLLVRGDHELNEVKAGKIPGLK--
SYP_RHOFT       -TVKSLVLATDTLNKEGAI-----------VKTQIWLLLLRGDHDMNEVKVGKLPGL---
SYP_BURP1       -TIKSIVLATDNEGAE----------------PTIWLLMLRGDHDLNEIKTAKLPGL---
SYP_BURPS       -TIKSIVLATDNEGAE----------------PTIWLLMLRGDHDLNEIKTAKLPGL---
SYP_BURMA       -TIKSIVLATDNEGAE----------------PTIWLLMLRGDHDLNEIKTAKLPGL---
SYP_BURTA       -TIKSIVLATDNEGAE----------------PTVWLLMLRGDHDLNEIKTAKLPGL---
SYP_BURL3       -TIKSIVLATDNEGAE----------------PTIWLVMLRGDHDLNEIKVSKLPGL---
SYP_CUPPJ       -NVKSIVLAKDTEAG-----------------AEIWLLLIRADHELNEVKASKVPGL---
SYP_CUPMC       -TVKSIVLATDSDAG-----------------AQIWLLLIRGDHELNEVKASKVPGL---
SYP_RALSO       -TVKSIVLAKDVEGGE----------------PQIWLLLLRGDHELNEIKASKVPGL---
SYP_CHRVO       -TVKAVVVEGEQDEAV--------------------LMLVRGDHELNEVKAQKVAGIK--
SYP_NEIMA       -TLKSIVVEGENEGE-------------------IVLLLLRGDHEFNDIKAEKLAGVK--
SYP_NEIMB       -TLKSIVVEGENEGE-------------------LILLLLRGDHEFNDIKAEKLAGVK--
SYP_NEIG1       -TLKSIVVEGENEGE-------------------LVLLLLRGDHEFNDIKAEKLAGVK--
SYP_NITEU       -TLKALAVTA---------------------GGKFYLLLLRGDHQLNETKVRKIPFL---
SYP_NITMU       -TVKTLAVMA---------------------NGGMHLLLLRGDHHLNETKVRKIPFL---
SYP_THIDA       -TVKLIAVMA---------------------GERMVVVLLRGDHMLNEVKLAKIEGL---
SYP_DECAR       -IVKSIAVMSEKEDG----------------SQTFALLLLRGDHELNEIKASKIAAI---
SYP_XANAC       -TVKSVAVMTQ---------------------AGFVLVLVRGDHAVNEIKLAKVPGL---
SYP_XANC5       -TVKSVAVMTQ---------------------AGFVLVLVRGDHAVNEIKLAKVPGL---
SYP_XANOM       -TVKSVAVMTE---------------------AGFVLALVRGDHAVNEIKLAKVPGL---
SYP_XANOR       -TVKSVAVMTE---------------------AGFVLALVRGDHAVNEIKLAKVPGL---
SYP_XANC8       -TVKSIAVMTT---------------------AGFVLVLVRGDHAVNELKLAKVAGM---
SYP_XANCP       -TVKSIAVMTT---------------------AGFVLVLVRGDHAVNELKLAKVAGM---
SYP_XYLFA       -VVKSIAVMTD---------------------SGFFLALLRGDHTLNDIKLSKLPGL---
SYP_XYLFT       -VVKSIAVMTD---------------------SGFFLALLRGDHTLNDIKLSKLPGL---
SYP_BUCAI       -QIQTFLIQTKIN-----------------DITSIAALLIRGDHELNFFKVEKIDIIN--
SYP_BUCAP       -FIKTILVRTKIN-----------------NQPSLAALLIRQEHELNLFKIEEIDIIE--
SYP_BUCBP       -TIKTILVKTKNF-----------------SKHLFVAILIREDHTINEYKLSKINEIE--
SYP_BLOFL       -TIKNIIIYIKNK----------------NNIYNLHRIATQAYEKFNDLKLVKIPDII--
SYP_BLOPB       -FVKTIIVRAKNKHI--------------NNDYSLLGLVIRADHQISLKKIAMIPQIH--
SYP_WIGBR       -IIKILLVHSIEK------------------NHPFIAIAIREDHEIDLQKVENLNQVK--
                   : .                                        .  :          

SYP_AQUAE       --------TDNFRLATDEEVQELLGTKKGFIGIFN-------------------------
SYP_THEMA       --------DQSLRMATPEEILKDFGVPVGFIGPIG-------------------------
SYP_BACSU       --------AEVVELATHEEVIQQLGTEPGFVGPVG-------------------------
SYP_BACLD       --------AEIIEFASAEEVAEITGTEPGFVGPVG-------------------------
SYP1_BACAN      --------ASVVELASHEEVKELLNCEVGSLGPIG-------------------------
SYP1_BACCZ      --------ASVVELASHEEVKELLNCEVGSLGPIG-------------------------
SYP1_BACHK      --------ASVVELASHEEIKELLNCEVGSLGPIG-------------------------
SYP1_BACC1      --------ASVVELASHEEVKELLNCEVGSLGPIG-------------------------
SYP1_BACCR      --------ASVVELASHEEVKALLNWEVGSLGPIN-------------------------
SYP_GEOKA       --------ATVVELATPEETERVMNAPIGSLGPIG-------------------------
SYP_LISMF       --------ATNVELVDPAVAVELLGANFGSLGPIN-------------------------
SYP_LISMO       --------ATNVELVDPAVAVELLGANFGSLGPIN-------------------------
SYP_LISIN       --------ATNVELVDPNVAFELLGANFGSLGPIG-------------------------
SYP_STAA3       --------TDNIELATQDEIVNLVGANPGSLGPV--------------------------
SYP_STAA8       --------TDNIELATQDEIVNLVGANPGSLGPV--------------------------
SYP_STAAC       --------TDNIELATQDEIVNLVGANPGSLGPV--------------------------
SYP_STAAM       --------TDNIELATQDEIVNLVGANPGSLGPV--------------------------
SYP_STAAN       --------TDNIELATQDEIVNLVGANPGSLGPV--------------------------
SYP_STAAW       --------TDNIELATQDEIVNLVGANPGSLGPV--------------------------
SYP_STAAS       --------TDNIELATQDEIVNLVGANPGSLGPV--------------------------
SYP_STAAR       --------TDNIELATQDEIVNLVGANPGSLGPV--------------------------
SYP_STAAB       --------TDNIELATQDEIVNLVGANPGSLGPV--------------------------
SYP_STAHJ       --------TDNVEMATQEEIVNLLGANPGSLGPV--------------------------
SYP_STAS1       --------TDNIELASEDEIVNLLGAKPGSLGPV--------------------------
SYP_STAES       --------TEHVEMATPDEIVNLVDANPGSLGPI--------------------------
SYP_STAEQ       --------TEHVEMATPDEIVNLVDANPGSLGPI--------------------------
SYP_BACHD       --------ASDIRLATEEEVLEVIGTEVGTIGPV--------------------------
SYP_BACSK       --------AKTLRMASEEEVVAAFGATPGSIGPV--------------------------
SYP_LACPL       --------ADFLEMATPEQAQQYLGASFGSLGPVN-------------------------
SYP_LACSS       --------ADFLDLATAEQVQATMNAPMGSIGPVN-------------------------
SYP_ENTFA       --------ADFLDEATEEDARRVLGAGFGSIGPVN-------------------------
SYP_LACS1       --------AIDLRPAEEEEAVKFLGANFGSLGPVG-------------------------
SYP_STRA3       --------ADFLEPASEEQAKEIFGAGFGSLGPVN-------------------------
SYP_STRA5       --------ADFLEPASEEQAKEIFGAGFGSLGPVN-------------------------
SYP_STRA1       --------ADFLEPASEEQAKEIFGAGFGSLGPVN-------------------------
SYP_STRP1       --------ADFLEPASEEEARAFFGAGFGSLGPVN-------------------------
SYP_STRPM       --------ADFLEPASEEEARAFFGAGFGSLGPVN-------------------------
SYP_STRP3       --------ADFLEPASEEEARAFFGAGFGSLGPVN-------------------------
SYP_STRPF       --------ADFLEPASEEEARAFFGAGFGSLGPVN-------------------------
SYP_STRP8       --------ADFLEPASEEEARAFFGAGFGSLGPVN-------------------------
SYP_STRP6       --------ADFLEPASEEEARAFFGAGFGSLGPVN-------------------------
SYP_STRPB       --------ADFLEPASEEEARAFFGAGFGSLGPVN-------------------------
SYP_STRPC       --------ADFLEPASEEEARAFFGAGFGSLGPVN-------------------------
SYP_STRPD       --------ADFLEPASEEEARAFFGAGFGSLGPVN-------------------------
SYP_STRT1       --------ADFLKPATEDEARQVFGANFGSLGPVN-------------------------
SYP_STRT2       --------ADFLKPATEDEARQVFGANFGSLGPVN-------------------------
SYP_STRMU       --------ADFLEPANEEEAREIFSASFGSLGPVN-------------------------
SYP_STRPN       --------ADFFDVASEEEVANVVQAGFGSLGPVG-------------------------
SYP_STRR6       --------ADFFDVASEEEVANVVQAGFGSLGPVG-------------------------
SYP_LACLA       --------ASFIEAASEAEVEEKFGAHFGSLGPIG-------------------------
SYP_LACAC       --------ADDIHEANTEDLKEITGSEKGGVGPVN-------------------------
SYP_LACJO       --------ADEVRTANADELVEITGSEKGGVGPIN-------------------------
SYP_FUSNN       --------AVEVEMATDEEIEKI-GLKKGYIGPYK-------------------------
SYP_DEHM1       --------CNDLRLAEDSEVKA-AGIAAGFASPVG-------------------------
SYP_DEHMC       --------CNDLRLAEDGEVKA-AGVVAGSASPVG-------------------------
SYP1_ANADE      --------AQVVRPAHAEEIPPLMGAHAGSLGAVR-------------------------
SYP_CARHZ       --------CLVLELASPQEVEEVLGAEYGSIGPVG-------------------------
SYP_MOOTA       --------CRHLLLADPERVRKATGAPVGFVGPVG-------------------------
SYP_DESHY       --------FINLQLAGPEAVLEKLGCEPGYVGPIG-------------------------
SYP_CLOAB       --------SVDVELADEKTVKKATGAEVGFAGPIG-------------------------
SYP_CLOTE       --------AVNFEMADEETIKKATNSEVGFAGPIG-------------------------
SYP_CLOPE       --------VIELEMASEEAVKEATGAAVGFAGPMG-------------------------
SYP_CALS4       --------EEELELADGALVEEVTGAKVGFAGPLG-------------------------
SYP_DESAG       --------ADTLELASPEQVREWTGAPVGFAGPVG-------------------------
SYP_DESVH       --------ADSLELATPEQVEAWTGAPVGFAGPVG-------------------------
SYP_LAWIP       --------ATVITMATPEQVHQWTGAPVGFAGPVG-------------------------
SYP_GEOMG       --------CEELEMASEEIVERVTGAPVGFAGPVG-------------------------
SYP_GEOSL       --------CETLEMANEEMVTRVTGAPVGFAGPVG-------------------------
SYP_PELCD       --------CNEITLAPDDVVGKVTGAAPGFAGPVD-------------------------
SYP_DESPS       --------VADVELMDDKAVFDATGVPTGYLGPVA-------------------------
SYP_SYNAS       --------CQELELAMDDMIQDVTGAPRGFAGAIG-------------------------
SYP_MYCTU       --------PADYALLDDDDFAKHPFLVKGYIGP---------------------------
SYP_MYCBO       --------PADYALLDDDDFAKHPFLVKGYIGP---------------------------
SYP_MYCPA       --------PAEYVLLDDADFARYPFLVKGYIGP---------------------------
SYP_NOCFA       --------PAEVELLTDADFAANPFLVKGYIGP---------------------------
SYP_COREF       --------PAEVELAVEADFAKYPFLVKGYVGP---------------------------
SYP_CORGL       --------PAEVELAVESDFADNPFLVKGYVGP---------------------------
SYP_CORDI       --------PAEVELASEEDFKNNPFLVKGYVGP---------------------------
SYP_CORJK       --------PAQVELADEADFKKNPFLVKGYVGP---------------------------
SYP_THEFY       --------PAEVALLDEEDFAKHPFLVRGYIGP---------------------------
SYP_LEIXX       --------PAGVEAATEDDFAANPGLVKGYIGPWSAGGPVL-------------------
SYP_CUTAK       --------PAVVEPFTEEDFAANPQLVKGYIGP-----GAL-------------------
SYP_BIFLO       --------PAELEEATEEDLKQHPELVPGYIGPMVLGPQAE-------------------
SYP_STRCO       --------PAAVELVTAEDFVGRPDLVRGYVGP---------------------------
SYP1_STRAW      --------PAVVELVTAEDFEGRDDLVRGYVGP---------------------------
SYP_TROW8       --------PLTIEPADNRVFECNPSFVRGSIGP---------------------------
SYP_TROWT       --------PLTIEPADNRVFECNPSFVRGSIGP---------------------------
SYP_TREPA       --------VPSVVLATEQEVYALSGTPVGFIGPVGLAQRAAAAYAARTPAFFPSAAEPAS
SYP_TREDE       --------ASDAILASDTEVEEATGTIVGFAGPVGLKN----------------------
SYP_LEPIC       --------IADSEPMTDLEIREL-GLIPGFISPIAPNDK---------------------
SYP_LEPIN       --------IADSEPMTDLEIREL-GLIPGFISPIAPNDK---------------------
SYP_CHLTR       -----------CELASEEEILKHLHVEKGFIGP---------------------------
SYP_CHLTA       -----------CELASEEEILKHLHVEKGFIGP---------------------------
SYP_CHLMU       -----------CELASDEEIIKHLHVEKGFIGP---------------------------
SYP_CHLCV       -----------CILASDEELQQHLGTEKGFIGP---------------------------
SYP_CHLFF       -----------CALASDEEIQNNLGTEKGFVGP---------------------------
SYP_CHLAB       -----------CSLASDEEIQKHLGVEKGFIGP---------------------------
SYP_CHLPN       -----------IALASDEEIERVLGTEKGFIGP---------------------------
SYP_NOSS1       NYGAKAIISLTVPSAENQQTWTAKPLPLGYIAPNIADEYIAA------------------
SYP_TRIV2       NYGAKAIINLTVPSAENQQTWTAKSLPLGYIAPDIADEYIAA------------------
SYP_SYNP6       DYGAKTVIALTVPDAEALKKWTAAPLPLGYLGPDLADSAIAV------------------
SYP_SYNE7       DYGAKTVIALTVPDAEALKKWTAAPLPLGYLGPDLADSAIAV------------------
SYP_SYNY3       HYESTNILSLTVPDEKEQQKWAAKPLPLGYISPGISDDYIAT------------------
SYP_THEEB       NYGATKLLDLRLADAHTAQEWAATPIPFGYIGPDLEDAVIKA------------------
SYP_SYNJA       RYQANKLLKLTLADAEIQKSWQGDPIPVGYIAPDLPDSCLGR------------------
SYP_SYNJB       RYQASKLLKLALADAEIQNSWQGDPIPVGYIAPDLPDSCLGR------------------
SYP_PROM9       ---SSNLLHLQKIEDIKIIEKNLVNFPLGFIGPDLDNETIKA------------------
SYP_PROMP       ---ISNLIHLKIVDDNAIINKNLINFPLGFIGPDINDETIKI------------------
SYP_PROMA       ---KKSVISIKTITKEQLDSQKLLDIPLGFVGPDLKDSYLNK------------------
SYP_PROMT       ---KQNVLDIRIISNEDMQKQGISNIPFGFIGPDLSDNLLAQ------------------
SYP_SYNPX       ---EQGVLDCRPISPDDLQRQGINTIPFGFIGPDLADKVLAD------------------
SYP_SYNS9       ---GQEVLDCRPIQTEDLNKQGIDTIPLGFIGPDLDDGVLRS------------------
SYP_SYNSC       ---NKGVLDCRPITPDYTNRQQIDPIPFGSIGPDLSDDVLKG------------------
SYP_PROMM       ---NKGVLDVAPISADQITAQKLEAWPFGAIGPDLDDALLSG------------------
SYP_GLOVI       -----DCLDVRLADEAELAAW--VEVKPGFVGPDAPIAGV--------------------
SYP_HELPY       -------ANALELREASQKDLDNVGLIAGFIGPYG-------------------------
SYP_HELPJ       -------ANALELREANEEDLNKAGLIAGFIGPYG-------------------------
SYP_CAMJE       -----------ELVDASEEELKKAGLVAGFIGFVG-------------------------
SYP_CAMJR       -----------ELVDASEEELEKAGLVAGFIGFVG-------------------------
SYP_HELHP       -------NCYLALEDASVEEIQAAGLEVGFIGAYG-------------------------
SYP_WOLSU       -----------ELLDVSEEELIKAGLEPGFIGPYA-------------------------
SYP_SHIBS       ---------SPLTFATEEEIRAVVKAGPGSLGP---VNMPI-------------------
SYP_SHIFL       ---------SPLTFATEEEIRAVVKAGPGSLGP---VNMPI-------------------
SYP_SHISS       ---------SPLTFATEEEIRAVVKAGPGSLGP---VNMPI-------------------
SYP_ECOLI       ---------SPLTFATEEEIRAVVKAGPGSLGP---VNMPI-------------------
SYP_ECO57       ---------SPLTFATEEEIRAVVKAGPGSLGP---VNMPI-------------------
SYP_SHIDS       ---------SPLTFATEEEIRAVVKAGPGSLGP---VNMPI-------------------
SYP_ECOL6       ---------SPLTFATEEEIRAVVKAGPGSLGP---VNMPI-------------------
SYP_ECOUT       ---------SPLTFATEEEIRAVVKAGPGSLGP---VNMPI-------------------
SYP_SALPA       ---------SPLTFATEEEIRAVINAGPGSLGP---VNMPI-------------------
SYP_SALTI       ---------SPLTFATEEEIRAVINAGPGSLGP---VNMPI-------------------
SYP_SALTY       ---------SPLTFATEEEIRAVINAGPGSLGP---VNMPI-------------------
SYP_SALCH       ---------SPLTFATEEEIRAVINAGPGSLGP---VNMPI-------------------
SYP_YERPE       ---------KPLTFASEEEIRAAIGAGPGSLGP---VNLSL-------------------
SYP_YERPS       ---------KPLTFASEEEIRAAIGAGPGSLGP---VNLSL-------------------
SYP_PECAS       ---------SPLTFATEEEIRAIIGAGPGSLGP---VKLDI-------------------
SYP_SODGM       ---------APLTFASEEEIRLAVGAGPGSLGP---VNLPL-------------------
SYP_PHOLL       ---------SPLTFATEEEIRSIVGAGPGSLGP---VNLPI-------------------
SYP_HAEIN       ---------DPLEFADETEIKAKIGSGVGSLGA---VNLNI-------------------
SYP_HAEI8       ---------DPLEFADETEIKAKIGAGVGSLGA---VNLNI-------------------
SYP_MANSM       ---------SPFEFADEADIKAKIGAGVGSLGP---VNLNI-------------------
SYP_HAEDU       ---------EPLAFADEDEIKAKIGVSVGYLGP---VNLAI-------------------
SYP_PASMU       ---------SPLQFATDEEIRAVVGAGTGSLGP---INLPM-------------------
SYP_BAUCH       ---------SPLVFATEDEIRLAIGVGSSSLGP---INLPL-------------------
SYP_VIBVU       ---------TPLEMATEEEMRELIGAGAGSLGP---VGLKL-------------------
SYP_VIBVY       ---------TPLEMATEEEMRELIGAGAGSLGP---VGLKL-------------------
SYP_VIBPA       ---------SPLEMASEEEIRELIGAGPGSLGP---VGLEL-------------------
SYP_ALIF1       ---------SPLEMADEAQLRDLIGAGAGSLGP---VGLEL-------------------
SYP_VIBCH       ---------SPLEMASEEEIRALIGAGPGSLGP---VGLKL-------------------
SYP_PHOPR       ---------SPLEMAEEAEIRALIGAGPGSLGP---VGLEL-------------------
SYP_SHEON       ---------SPLEFAPEALIRDAIGAGPGSLGP---VGLNM-------------------
SYP_PSE14       ---------SPLVMASEAELRDAIGAGAGSLGP---LNLPL-------------------
SYP_PSEU2       ---------NPLVMASEAELRDAIGAGAGSLGP---LNLPL-------------------
SYP_PSESM       ---------SPLVMASEAELRDAIGAGAGSLGP---LNLPL-------------------
SYP_PSEF5       ---------SPLVMASDAELRDAIGAGAGSLGP---LNLPL-------------------
SYP_PSEPF       ---------SPLVMASDAELRDAIGAGAGSLGP---LNLPL-------------------
SYP_PSEPK       ---------DPLVMATEAELRDAIGAGAGSLGP---LNLPL-------------------
SYP_PSEAE       ---------SPLVFASEAEIRAAIGAGPGSLGP---VNLPI-------------------
SYP_CHRSD       ---------APLTMASEEEIRAAVGAGPGSLGP---VNLDM-------------------
SYP_PSYA2       ---------VPLTMATEEELKAA-GLHKGYIG----VELDM-------------------
SYP_PSYCK       ---------VPLMMATEEELKAA-GLHKGYIG----VELNM-------------------
SYP_ACIAD       ---------APLTFATEAQLQEL-GLTAGYVGPQGLVEKGL-------------------
SYP_HAHCH       ---------SPLTFASDEAIEAAVGCKPGSIGP---VNLPL-------------------
SYP_SACD2       ---------NPLEFADESGIKAAVGAEVGSLGP---IGLSM-------------------
SYP_COLP3       ---------TPITFASEEQILAAANCNAGSIGP---VGLNI-------------------
SYP_IDILO       ---------APLEILTETE--KATGVEAPYIGV---VNAKL-------------------
SYP_PSEHT       ---------SPLEMATEADIVAAIGAKPGSLGP---VGLSM-------------------
SYP_HYDCU       ---------EPFEMATDEEIQNAVGCKAGSIGP---VNLSI-------------------
SYP_COXBU       ---------FPLQFADEKEIREAIGCGPGSLGP---VNLPI-------------------
SYP_NITOC       ---------NPLQFATPEQVWKTCNASIGSIGP---MGLAI-------------------
SYP_METCA       ---------GRFRFASEDEIERHMGCRPGYIGP---LNLPAGTAVG--------------
SYP_LEGPA       ---------SPLSFIDEELILKTLKTPLGSIGP---IQLNI-------------------
SYP_LEGPL       ---------SPLSFIDEELILKTLKTPLGSIGP---VKLNI-------------------
SYP_LEGPH       ---------APLSFIDEELILKTLKTPLGSIGP---IQLNI-------------------
SYP_FRATH       ---------APYTLATKEEIFSIFNANPGSLGI---YNCPI-------------------
SYP_FRATT       ---------APYTLATKEEIFSIFNANPGSLGI---YNCPI-------------------
SYP_BORBR       ---------AGFRFATETEILDHFGCKPGYLGPIKT-ARPV-------------------
SYP_BORPE       ---------AGFRFATETEILDHFGCKPGYLGPIKT-ARPV-------------------
SYP_BORPA       ---------AGFRFATETEIVDHFGCKPGYLGPIKT-ARPV-------------------
SYP_BORA1       ---------QNFRLATEAEIVEHFGCKPGYLGPIAT-AKPV-------------------
SYP_AROAE       ---------AGFRFATETEIAERFGCQPGYLGPVGV-NKAV-------------------
SYP_RHOFT       ---------AAFRFATVPEIEAHFGCQPGYLGPMGL-RQPV-------------------
SYP_BURP1       ---------AGHRFATEAEIVEWFGTPPGYLGPIGT-KKPV-------------------
SYP_BURPS       ---------AGHRFATEAEIVEWFGTPPGYLGPIGT-KKPV-------------------
SYP_BURMA       ---------AGHRFATEAEIVEWFGTPPGYLGPIGT-KKPV-------------------
SYP_BURTA       ---------AGYRFATEAEIVEWFGTPPGYLGPIGT-KKPV-------------------
SYP_BURL3       ---------KNHRFATEQEIVEWFGTPPGYLGPVGT-KKPV-------------------
SYP_CUPPJ       ---------ADFRFATENEIVDAFGSPPGYLGPIDM-KKPV-------------------
SYP_CUPMC       ---------ADFRFATETEIVDTFGSPPGYLGPIGP-KKPV-------------------
SYP_RALSO       ---------ADFRFATEGEILRAFGTPPGYLGPIGT-KQPV-------------------
SYP_CHRVO       ---------NPLAFASPAAIRDAFGANPGSLGPVGF-KG---------------------
SYP_NEIMA       ---------SPLTMASPAAIVEQFGANGGSLGPVGF-AG---------------------
SYP_NEIMB       ---------SPLTMASPAAIVEQFGANGGSLGPVGF-AG---------------------
SYP_NEIG1       ---------SPLTMASPAAIVEQFGANGGSLGPVGF-TG---------------------
SYP_NITEU       ---------GDFEFAEESRIIAEMSCPPGYLGPVGV---KA-------------------
SYP_NITMU       ---------SDFRLASEEEIRTETGCLPGFIGPAGL---SL-------------------
SYP_THIDA       ---------ADFRLANEAEIRAVFDCPPGFLGPVGIDRSTI-------------------
SYP_DECAR       ---------NPFRFATEEEVIERLGCKPGFIGPVAIDATKV-------------------
SYP_XANAC       ---------ADYRLANESEIREHLGCEPGFLGPVNT-ARPV-------------------
SYP_XANC5       ---------ADYRLANESEIREHLGCEPGFLGPVNT-ARPV-------------------
SYP_XANOM       ---------AGYRLANETEIRAHLGCEPGFLGPVNT-ARPV-------------------
SYP_XANOR       ---------AGYRLANETEIRAHLGCEPGFLGPVNT-ARPV-------------------
SYP_XANC8       ---------ADYRLANESEIRQHLGSEPGFLGPVQP-AQPI-------------------
SYP_XANCP       ---------ADYRLANESEIRQHLGSEPGFLGPVQP-AQPI-------------------
SYP_XYLFA       ---------ANFRLANEVEIARHLGSEPGFLGPVCP-GMPI-------------------
SYP_XYLFT       ---------ANFRLANEVEIARHLGSEPGFLGPVCP-GMPI-------------------
SYP_BUCAI       ---------KPLVFLNEKEVISLIGVKKEFLGPLG-------------------------
SYP_BUCAP       ---------KPLSFVNEEEIITLMGVKSKFLGPLG-------------------------
SYP_BUCBP       ---------YPLIFASKQEILNVTGTTKDFIGPIN-------------------------
SYP_BLOFL       ---------IPISILN----KKNIEIKLNLLKLIN-------------------------
SYP_BLOPB       ---------IPLSCIEPEEIQKITGAQPNLLGPIN-------------------------
SYP_WIGBR       ---------KPLKFANYYEINKYFKVKKSYLGPVN-------------------------
                                                                            

SYP_AQUAE       ---LPENIKVLWDNSLYG-VKNLVVALNEPDWHYINVNPGRDFQYGE---FVDVAEVREG
SYP_THEMA       ---V--DVKKVADHSVRG-LKNFVVGGMEEDTHYVNANHPRDFKVDE---WYDLRTVVEG
SYP_BACSU       ---IHQDVEVYADQAVKA-MVNAVAGANEGDHHYKNVNVNRDAQIKE---FADLRFIKEG
SYP_BACLD       ---LDREIEIFADFAVKA-MANAAAGANKTDYHYQNVNISRDAHNVT---FADLRFIQEG
SYP1_BACAN      ---VNGDIEIIADHAVAS-IVNGCSGANEEGFHYVNVNPERDFKVSQ---YTDLRFIQEG
SYP1_BACCZ      ---VNGDIEIIADHAVAS-IVNGCSGANEEGFHYVNVNPERDFKVSQ---YTDLRFIQEG
SYP1_BACHK      ---VNGDIEIIADHAVAS-IVNGCSGANEEGFHYVNVNPERDFKVSQ---YTDLRFIQEG
SYP1_BACC1      ---VTGDIEIIADHAVAS-IVNGCSGANEEGFHYVNVNPERDFKVSQ---YTDLRFIQEG
SYP1_BACCR      ---VTGDIEIIADHAVAS-IVNGCSGANEEGFHYVNVNPERDFKVSQ---YTDLRFIQEG
SYP_GEOKA       ---VSEDVTVIADHAVAA-ITNGVCGANEEGYHYIGVNPGRDFAVSQ---YADLRFVKEG
SYP_LISMF       ---VPENTRVFADNAVKD-IVNAVVGANEDGFHYINVNPDRDFSVTS---YFDLRMIQVG
SYP_LISMO       ---VPENMRVFADNAVKD-IVNAVVGANEDGFHYINVNPDRDFSVTS---YFDLRMIQVG
SYP_LISIN       ---VPEKIRVFADNAVKG-IVNAVAGANEDGYHYVNVNPNRDFEVTS---YFDLRMIQAG
SYP_STAA3       ---IDKEIKIYADNFVQD-LNNLVVGANEDGYHLINVNVGRDFNVDE---YGDFRFILEG
SYP_STAA8       ---IDKEIKIYADNFVQD-LNNLVVGANEDGYHLINVNVGRDFNVDE---YGDFRFILEG
SYP_STAAC       ---IDKEIKIYADNFVQD-LNNLVVGANEDGYHLINVNVGRDFNVDE---YGDFRFILEG
SYP_STAAM       ---IDKEIKIYADNFVQD-LNNLVVGANEDGYHLINVNVGRDFNVDE---YGDFRFILEG
SYP_STAAN       ---IDKEIKIYADNFVQD-LNNLVVGANEDGYHLINVNVGRDFNVDE---YGDFRFILEG
SYP_STAAW       ---IDKEIKIYADNFVQD-LNNLVVGANEDGYHLINVNVGRDFNVDE---YGDFRFILEG
SYP_STAAS       ---IDKEIKIYADNFVQD-LNNLVVGANEDGYHLINVNVGRDFNVDE---YGDFRFILEG
SYP_STAAR       ---IDKEIKIYADNFVQD-LNNLVVGANEDGYHLINVNVGRDFNVDE---YGDFRFILEG
SYP_STAAB       ---IDKEIKIYADNFVQD-LNNLVVGANEDGYHLINVNVGRDFNVDE---YGDFRFILEG
SYP_STAHJ       ---HDKDIRIFADNYVRD-LNNLVVGANEDGSHYINANLDRDFKVDE---FGDFRFILEG
SYP_STAS1       ---FDKEIKVYADNFIQD-LNNIVVGANEDGYHLLNANIGRDFEVDA---FGDFRFILEG
SYP_STAES       ---FDKDIKIYADNYLQD-LNNFVVGANEDHYHYINVNIGRDFDVTE---YGDFRFITQG
SYP_STAEQ       ---FDKDIKIYADNYLQD-LNNFVVGANEDHYHYINVNIGRDFDVTE---YGDFRFITQG
SYP_BACHD       ---DVKGVKVIADHGIKS-IVNGVCGANESNKHFIHVNEERDFTVDT---YADLRFIQEG
SYP_BACSK       ---GVKDVPIYADYRIRS-MERIACGANETGYHYVNVGPGRDYEVTA---YKDLRTVREG
SYP_LACPL       ---VHDDVKIVADQYVKD-MVNITVGANEDGHHFTNVNPERDFHAEA---YVDIRFVQEG
SYP_LACSS       ---APEDVQIVADYSVEA-LVNAVVGANEADHHFLNVNSKRDFNVAD---YADLRFVQEG
SYP_ENTFA       ---VSEDVKIYADLAVQD-LANAIVGANEDGYHLTNVNPDRDFQPIS---YEDLRFVQEG
SYP_LACS1       ---IDENLKVLADLDVEG-MINASVGANEDGYHYINVNIDRDYHVDE---FLDLREVREG
SYP_STRA3       ---LPDSVKIIADRKVQD-LANAVSGANQDGYHFTGVNPERDFTAE----YVDIREVKEG
SYP_STRA5       ---LPDSVKIIADRKVQD-LANAVSGANQDGYHFTGVNPERDFTAE----YVDIREVKEG
SYP_STRA1       ---LPESVKIIADRKVQD-LANAVSGANQDGYHFTGVNPERDFTAE----YVDIREVKEG
SYP_STRP1       ---LAQGSRIVADRKVQN-LTNAVAGANKDGFHMTGVNPGRDFQAE----YVDIREVKEG
SYP_STRPM       ---LAQGSRIVADRKVQN-LTNAVAGANKDGFHVTGVNPGRDFQAE----YVDIREVKEG
SYP_STRP3       ---LAQGSRIVADRKVQN-LTNAVAGANKDGFHVTGVNPGRDFQAE----YVDIREVKEG
SYP_STRPF       ---LAQGSRIVADRKVQN-LTNAVAGANKDGFHVTGVNPGRDFQAE----YVDIREVKEG
SYP_STRP8       ---LAQGSRIVADRKVQN-LTNAVAGANKDGFHVTGVNPGRDFQAE----YVDIREVKEG
SYP_STRP6       ---LAQGSRIVADRKVQN-LTNAVAGANKDGFHVTGVNPGRDFQAE----YVDIREVKEG
SYP_STRPB       ---LAQGSRIVADRKVQN-LTNAVAGANKDGFHVTGVNPGRDFQAE----YVDIREVKEG
SYP_STRPC       ---LAQGSRIVADRKVQN-LTNAVAGANKDGFHVTGVNPGRDFQAE----YVDIREVKEG
SYP_STRPD       ---LAQGSRIVADRKVQN-LTNAVAGANKDGFHVTGVNPGRDFQAE----YVDIREVKEG
SYP_STRT1       ---LPENVRIIADRKVQD-VANAVVGANEDGYHLTGVNPERDFKAE----YVDIRKVKEG
SYP_STRT2       ---LPENVRIIADRKVQD-VANAVVGANEDGYHLTGVNPERDFKAE----YVDIRKVKEG
SYP_STRMU       ---LPENVKIVADRKVKN-IGNAVVGANEDGYHLTGVNPERDFEAA----YVDIREVCEG
SYP_STRPN       ---LPENIKIIADRKVQD-VRNAVVGANEDDYHLTGVNPGRDFTAE----YVDIREVREG
SYP_STRR6       ---LPENIKIIADRKVQD-VRNAVVGANEDGYHLTGVNPGRDFTAE----YVDIREVREG
SYP_LACLA       ---LE-NVKIIADRKVEQ-IKNAVVGANVDGFHYKNANFGRDYEVEE---FVDLRTVNEG
SYP_LACAC       ---ADWADKIIADETVKG-LYNVVVGAGETDYQFKNANLDRDFKVDE---FADIRTANEG
SYP_LACJO       ---ADWADKIIADETVKD-LYNVVVGANETDYQYQNANLDRDFKVDE---FADIRTANEG
SYP_FUSNN       ---LPAKIKIVADLSVPE-VSNHIVGSHQKDYHYKNVNYDRDYTADI---VTDIRKVRVG
SYP_DEHM1       ---LKNSLTVA-DDSVEN-GSNFVAGANKDGFHLKNVNFGRDFKAD---KMADIALAAEG
SYP_DEHMC       ---LKNILIVA-DDSVEN-GSNFVAGANKDGFHLKNVNCGRDFRAD---KMADIALAAEG
SYP1_ANADE      ---FTRARVVV-DPSLAD-RKDMVTGANEDGFHLRGVDVRRDLLAHGA-TLAELRTVKAG
SYP_CARHZ       ---VN--IPVIADLEVKH-VLNAVTGANETGYHLTGVNPERDFSPAV--KYADIRLVEEG
SYP_MOOTA       ---LQG-IPLYADLEIPY-LVNGVAGANREGYHLVNVNPGRDFNPTA---VVDIRQVEAG
SYP_DESHY       ---APKNLTVVADLEVPL-MAKAVCGANAEDKHYVDAVPEKDFRIDQ---ILDLRMVNAG
SYP_CLOAB       ---LDVDY-LLIDNEVTY-MYNFIVGANETGYHYANANYDRD-FKG---TVGDFRNAVEG
SYP_CLOTE       ---IKVDC-LLIDEEVTN-MYNFIIGANETGYHYKNANYKRD-FEG---IVGDYRKVIQG
SYP_CLOPE       ---IKVDM-LLVDQEVAN-MYNFIIGANETDMHLKNVNYGRD-FEG---IVGDFRNVTIG
SYP_CALS4       ---LKGEVTLVVDSEIPQ-LRNFIVGANETDYHIKNVNYGRD-FKGD--IVADIKSVVEG
SYP_DESAG       ---L-GVKRLFADNELRL-ATDWITGANKADTHLRHVSLKRD-TRLS--GYADLRMITDK
SYP_DESVH       ---LHGVKRVFADTELKG-DAGWIVGANKADTHLREVSLTRD-AAIE--AYADLRMITAS
SYP_LAWIP       ---F-TAGPIIADHELMV-YNDWVVGANKPDKHILHVDLARD-VQNI--TFADIRLITDA
SYP_GEOMG       ---LK-IKIVA-DLTIQG-MKNFVTGGNARDLHFKNVNIGRD-FTPA--LIADIRNVVHG
SYP_GEOSL       ---LN-IKIVA-DLAVQG-MKNFVTGANAGDLHLKNVTIGRD-FTPT--QYADIRNVVHG
SYP_PELCD       ---LS-LRVLA-DFAVQG-MADFVTGANAADTHYVGVNLERD-FTVE--QFADLRAAEAG
SYP_DESPS       ---IP-IRVVA-DQEVMV-MKNFYVGGNEKNFHLKNVNIERD-CTVS--AVADLRQISTD
SYP_SYNAS       ---IKKARILA-DYSLLN-MKNVVMGANKEDYHLRNVNEGRD-FQIS--AFADLKVARET
SYP_MYCTU       KALRENNVRYLVDPRIVD-GTSWITGADQPGRHVVGLVAGRDFTA--D-GTIEAAEVREG
SYP_MYCBO       KALRENNVRYLVDPRIVD-GTSWITGADQPGRHVVGLVAGRDFTA--D-GTIEAAEVREG
SYP_MYCPA       KALKDNGVRYLVDPRVVD-GTSWITGADEPGRHVVGLVAGRDFTA--D-GTIEAAEVRDG
SYP_NOCFA       KALQENGIRYLVDPRVGT-GTAWITGADSPGKHVVGLIAGRDFTP--D-GTIEAAEVRDG
SYP_COREF       VGLARNGVRVLADPRVVT-GTSWITGADEKERHVVGLVAGRDFTP--D-GFIEAAEIREG
SYP_CORGL       VGLAKNGVKVLADPRVVT-GTSWITGADEKERHVVGLVAGRDFTP--D-GFIEAAEIKEG
SYP_CORDI       RALNAHGVKVLADPRVVS-GTSWIAGADAVEHHVVGLTMGRDFTV--D-GYIEAAEIREG
SYP_CORJK       KGLAANGVRVLADPRVVD-GTSWITGADAKNRHVVGLVAGRDFTP--D-GFVEAAEVLEG
SYP_THEFY       GALQANKVRYLVDPRVVT-GTAWVTGADKADHHVVDLVCGRDFTP--D-GTIEAAEVRDG
SYP_LEIXX       GEEAATGLRFLVDLRVVD-GSGWITGANLPGKHVFGLVAGRDFDW--D-GTVEVAEVKAG
SYP_CUTAK       GEDNSSKVRYLVDPRVVT-GTSWITGADQKDRHVFNLVAGRDFTP--D-GVIDVAEIREG
SYP_BIFLO       AAGVKNPVRYLIDAHVVK-GSAWFTGADENEVDYYNLVYGRDFKV--D-GVVEAVEVRHG
SYP_STRCO       -QGLGEKVTYIADPRVAP-GTAWITGANKADTHAKNVVAGRDFEV--D-TYVDVVVVREG
SYP1_STRAW      -QGL-EKVRYIADPRVAP-GTAWITGANKINTHAKNVVAGRDFEV--D-DYLDVVVVEEG
SYP_TROW8       ---GLSGVFYCADPRVSS-GSSWIIGANRPGVHRIGAIAGRDFSF--D-CTLDVSSIKTG
SYP_TROWT       ---GLSGVFYCADPRVSL-GSSWIIGANRPGVHRIGAIAGRDFSF--D-CTLDVSSIKTG
SYP_TREPA       VTSDIPFFSLVADQSVMA-MHNAITGALKVDTHLVQVEPGRDFVP--D-AVADLMLVRAG
SYP_TREDE       -------IPVIADESVML-MHDAVTGALKKDKHLLHVEPSRDFTP--A-HVFDLRTVRAG
SYP_LEPIC       -------IKVLYDRSLQK-DFPYVVGSSKEDFHTQGFILEKEISGL-P-EFADVALAREG
SYP_LEPIN       -------IKVLYDRSLQK-DFPYVVGSSKEDFHTQGFILEKEISGL-P-EFADVALAREG
SYP_CHLTR       ---LYCPIPCYADETTRP-MTNFICANNQKDVHCKHVNWGRDIPLPA---FGDFLLAEAG
SYP_CHLTA       ---LYCPIPCYADETTRP-MTNFICANNQKDVHCKHMNWGRDIPLPA---FGDFLLAEAG
SYP_CHLMU       ---LHCPVPCYADETTRP-MTNFICANNQKDIHCRYVNWERDIPLPI---FGDFLLAESG
SYP_CHLCV       ---LNCPIELYADETTRC-MTNFICAGNTKDKHYKNVNWDRDIPRPE---YGDFLLAEAG
SYP_CHLFF       ---LNCPIEFYADETTRC-MTNFICAGNAKDKHYKNVNWDRDIPRPE---YADFLLAEAG
SYP_CHLAB       ---LNCPIDFYADETTQC-MTNFICAGNVKDKHYKNVNWDRDIPRPE---YADFLLAEAG
SYP_CHLPN       ---LNCPIDFFADETTSP-MTNFVCAGNAKDKHYVNVNWDRDLLPPQ---YGDFLLAEEG
SYP_NOSS1       NKQIHPKFVRFVDKTVVD-LKNFITGANEAGCHVVGANWGEQFPLPEI--VVDVRKARPG
SYP_TRIV2       NKQIHPKFVRFVDKTAVD-LKNFITGANEAGYHVVGANWGEQFPLPEI--VVDVRKARPG
SYP_SYNP6       NESIIPKFLRLVDPTAAE-LQNFVTGANEVNFHVVGANWETNFPKPA---VVDLRTALVG
SYP_SYNE7       NESIIPKFLRLVDPTAAE-LQNFVTGANEVNFHVVGANWETNFPKPA---VVDLRTALVG
SYP_SYNY3       NKQVADKFLRLVDQTAVD-LTNFATGADAVDYHVTGANWSTDFTLPKL--VVDVRKALAG
SYP_THEEB       DSQIIPQWIRIADRTVVE-LKRFITGANRDQQHRVGVNWGKSCPLPAI--IADVRKAQAG
SYP_SYNJA       QKNLAPQILRLADQTAAL-LKNFVTGSNQVGRHVVGANWGEQYPLAE---VVDVRKAQAG
SYP_SYNJB       QKNLAPQILRLADQTAAL-LQNFVTGGNQVGQHVVGANWGEQYPLPE---VVDVRKAQAG
SYP_PROM9       SSNWDKTWTRIIDHSAST-LSKFISGANKVNFHKVFQEFSFTSKDYL---IEDIRNAKKG
SYP_PROMP       NSSWDKSWIRIADYSASS-LSIFVSGGNKVDFHKVFRAFSFIEKKFL---ISDIRNAKKG
SYP_PROMA       AANWNKKFIRFTDITASN-LDSFICGANTIDQHRAFVNWSKVGGLPE---IVDIRNAMPG
SYP_PROMT       SKAWEKKFIRIADNSAKD-LKSFICGNNIKDEHKIFYNWNLINTVQM---ICDIRKAKPG
SYP_SYNPX       ASSWTTSFLRLADTTATE-LEQFHCGANAEDQHRSHCSWGDLGGAPQ---GEDLRKARAG
SYP_SYNS9       ARSWTKQFLRCTDSTAAA-MDRMVCGANQPDQHRLYATWADLGGAPK---SLDLRKARAG
SYP_SYNSC       AKTWQPTFLRLADETASE-LGSFICGANQPDLHRFNTSWTAIEQKPT---TLDLRNARAG
SYP_PROMM       ATSWTKHFLRLADPTATE-LNCFVCGANQNNQHRTGMTWSKLGGVPK---SVDLRKSQAG
SYP_GLOVI       --------IRLADRSVDG-LTDFSTGCNQDDVQCVWANWGENGLVLPE--VADLDTAQAG
SYP_HELPY       LKKH--VSYIIFDEDLKE-GDCLIAGANEKDFHAVGVDLKGFENLV----YADIVQVKES
SYP_HELPJ       LKKH--VCYIIFDEDLKE-GDCLIVGANEKDFHAVGVDLKGFENLV----YADIVQVKES
SYP_CAMJE       LKDI----DFYIDFELEN-EKQMIMGANEKDYHLIGIDVVNLNKDR----FKDLIEVKEG
SYP_CAMJR       LKDI----DFYIDFELEN-EKQMIMGANEKDYHLIGIDVVNLNKDR----FKDLIEVKEG
SYP_HELHP       LRHITQATHIYFDESLRD-ASNLICGANEKDYHFVGVDLSTFEGLE----YADIAQSKEG
SYP_WOLSU       LKNLTGANHILFDLELKD-AQGLIAGANERDHHFVGVNLGEFEGLI----YKDLAEVGEG
SYP_SHIBS       --------PVVIDRTVAA-MSDFAAGANIDGKHYFGINWDRDVATPE---VADIRNVVAG
SYP_SHIFL       --------PVVIDRTVAA-MSDFAAGANIDGKHYFGINWDRDVATPE---VADIRNVVAG
SYP_SHISS       --------PVVIDRTVAA-MSDFAAGANIDGKHYFGINWDRDVATPE---VADIRNVVAG
SYP_ECOLI       --------PVVIDRTVAA-MSDFAAGANIDGKHYFGINWDRDVATPE---VADIRNVVAG
SYP_ECO57       --------PVVIDRTVAA-MSDFTAGANIDGKHYFGINWDRDVATPE---VADIRNVVAG
SYP_SHIDS       --------PVVIDRIVAA-MSDFAAGANIDGKHYFGINWDRDVATPE---VADIRNVVAG
SYP_ECOL6       --------PVVIDRTVAA-MSDFAAGANIDGKHYFGINWDRDVATPE---IADIRNVVAG
SYP_ECOUT       --------PVVIDRTVAA-MSDFAAGANIDGKHYFGINWDRDVATPE---IADIRNVVAG
SYP_SALPA       --------PVIIDRTVAA-MSDFAAGANIDGKHYFGINWDRDVATPV---VADIRNVVAG
SYP_SALTI       --------PVIIDRTVAA-MSDFAAGANIDGKHYFGINWDRDVATPV---VADIRNVVAG
SYP_SALTY       --------PVIIDRTVAA-MSDFAAGANIDGKHYFGINWDRDVATPV---VADIRNVVAG
SYP_SALCH       --------PVIIDRTVAA-MSDFAAGANIDGKHYFGINWDRDVATPV---VADIRNVVAG
SYP_YERPE       --------PVIADHSVAV-MSDFGAGANIDGKHYFGINWERDLALPL---VADLRNVVEG
SYP_YERPS       --------PVIADRSVAV-MSDFGAGANIDGKHYFGINWERDLALPL---VADLRNVVEG
SYP_PECAS       --------PVVVDRTVAA-MSDFSAGANIDGKHYFGINWVRDVALPQ---VADIRNVVEG
SYP_SODGM       --------PLVIDRSVAV-MSDFAAGANAEGKHFFGINWERDLPLPQ---VADLRKVVEG
SYP_PHOLL       --------PAIIDRSVAV-MSDFGAGANINDKHYFGINWERDLPVPE---VADIRNVVEG
SYP_HAEIN       --------PAIIDRTVAL-MSDFSCGANIDGKHYFNVNWERDVAIPK---VFDLRNVVEG
SYP_HAEI8       --------PAIIDRTVAL-MSDFSCGANIDGKHYFNVNWVRDVAMPE---VFDLRNVVEG
SYP_MANSM       --------PVIIDRSVAL-MSDFGAGANIDGKHYFNINWERDVALPK---IADLRNVVEG
SYP_HAEDU       --------PAIVDRSVAL-MSDFVAGANIDGKHYLNINWQRDVVLPE---VFDLRNVVVG
SYP_PASMU       --------PIVIDRTVAN-MDNFSAGANQDGKHYFGINWERDLPVPH---IADLRNVVEG
SYP_BAUCH       --------PLIIDHSVAV-MSDFVAGANIDGKYFFGINWERDLSLPE---VANLTNQNIS
SYP_VIBVU       --------PFIVDRSVAV-MSDFGAGANIDGKHYFGINWGRDVELGQ---VADLRNVVEG
SYP_VIBVY       --------PFIVDRSVAV-MSDFGAGANIDGKHYFGINWGRDVELGQ---VADLRNVVEG
SYP_VIBPA       --------PFIVDRSVAV-MSDFGAGANIDGKHYFGINWGRDVELGQ---VEDLRNVVEG
SYP_ALIF1       --------PFIVDRSVAV-MSDFGTGANIDGKHFFGVNWDRDVQLGQ---VEDLRNVVEG
SYP_VIBCH       --------PFIVDRTVAV-MNDFGAGANIDGKHYFGINWGRDVELGK---VEDLRNVVEG
SYP_PHOPR       --------PFIVDRTVAI-MSDFGAGANVDGKHYFGINWGRDVELAQ---VEDLRNVVEG
SYP_SHEON       --------PIIIDHSVSV-MSDFAAGANVDDKHYFGINWERDLPLAQ---AADIRNVVEG
SYP_PSE14       --------PCIIDRSVEL-MSDFSVGANIDDKHYFGVNWERDLPVPT---VADLRNVVAG
SYP_PSEU2       --------PCIIDRSVEL-MSDFSVGANIDDKHYFGVNWERDLPVPT---VADLRNVVAG
SYP_PSESM       --------PCIIDRSVEL-MSDFAVGANIDDKHYFGVNWERDLPVPT---VADLRNVVAG
SYP_PSEF5       --------PIIIDRSVEL-MSDFGIGANIDDKHYFGVNWERDLPVPT---VADLRNVVAG
SYP_PSEPF       --------PIIIDRSVEL-MSDFAIGANIDDKHYFGVNWERDLPVPT---VADLRNVVAG
SYP_PSEPK       --------EIIIDRSVAL-MSDFGIGANIDDKHYFGVNWERDLPVPQ---VADLRNVVEG
SYP_PSEAE       --------ACIVDRSVAL-MSDFAAGANIEDKHYFGVNWERDLPLPE---VADLRNVVEG
SYP_CHRSD       --------PLIIDRSVAL-MSDFGAGANIDGQHYFGINWERDVALPK---VADLRNVVEG
SYP_PSYA2       --------PVFVDRAAAA-LSDFVSGANEVNKHTIGMNWERDANITR---IVDIRNVNQG
SYP_PSYCK       --------PVFVDRAAAA-LSDFVSGANEINKHTTGMNWERDAHITR---IVDIRNVHEG
SYP_ACIAD       --------TVIVDRAASV-LSDFIAGANEADKHATGVNWERDAKFSE---IYDLRNVVDG
SYP_HAHCH       --------RTIVDNSAAV-LANFVCGANEEGQHLTGVNWGRDCEIKE---TADLRNVVEG
SYP_SACD2       --------PVYVDRAAAA-LVNFVCGANKDGYHYTNANWSDAAEHK----VVDIRNVVIG
SYP_COLP3       --------EVIVDRSAAH-LSDFVCGANEDDAHLTGVNWQRDCNEIS---VHDIRNVVAG
SYP_IDILO       --------PLLVDSSAAH-LADFACGANENGQWLTGVNWKRDTGDFS---VVDIRNVVAG
SYP_PSEHT       --------PIIVDRSANI-LADFVAGANKDDEHYSGINWDRDVTDYE---VADIRNIVEG
SYP_HYDCU       --------PVIVDRTAAH-MADFVCGANEDGFHFTGANWDRDATPTL---VADIRNVVKG
SYP_COXBU       --------PFIVDRDAAQ-LVDFSCGANEDDFHWINVNWERDVPLGS---VADIRKVVEG
SYP_NITOC       --------PLIADHGAVQ-LTDFACGANMEGKHFTGVNWGRDLPEPS---TADIRNVVDG
SYP_METCA       --------PVYADRAVAV-MSDFVCGANEAGYHFSGVNWERDLPLPQDEYLCDLRNVVEG
SYP_LEGPA       --------PVIVDHHALA-MPSFVCGANQADKHFINAAWERDAKYDD---AYDLRNVKEG
SYP_LEGPL       --------PVIVDHQALA-MPSFVCGANQADKHFINAAWERDAKYDD---AYDLRNVKEG
SYP_LEGPH       --------PVIVDHHALA-MPSFVCGANQADKHFINAAWERDAKYDD---AYDLRNVKEG
SYP_FRATH       --------SIIADYSAIA-ITDLVCGANEDDYHFTNVNWDRDVTNYQ---IADIRNVVTG
SYP_FRATT       --------SIIADYSAIA-ITDLVCGANEDDYHFTNVNWDRDVTNYQ---IADIRNVVTG
SYP_BORBR       --------HVVADRTVAN-MADFVCGANREDYHYQGANWARDLPEPE--LVADLRNVVEG
SYP_BORPE       --------HVVADRTVAN-MADFVCGANREDYHYQGANWGRDLPEPE--LVADLRNVVEG
SYP_BORPA       --------HVVADRTVAN-MADFVCGANREDYHYQGANWGRDLPEPE--LVADLRNVVEG
SYP_BORA1       --------RIIADRTVAN-MADFVCGANRPDFHLRGVNWGRDLPEPE--LVTDLRNVVAG
SYP_AROAE       --------KIVADRTVAN-MADFICGANEADFHLTGTNWGRDLPEPD--LVADLRNIIEG
SYP_RHOFT       --------QLVVDREVAL-MSDWICGANEPDFHITGVNWGRDLPEPA--LVADLRNVVAG
SYP_BURP1       --------RVVADRTVAN-MSDFVVGANEVDYHIAGVNWGRDLPEP---VVADIRNVKAG
SYP_BURPS       --------RVVADRTVAN-MSDFVVGANEVDYHIAGVNWGRDLPEP---VVADIRNVKAG
SYP_BURMA       --------RVVADRTVAN-MSDFVVGANEVDYHIAGVNWGRDLPEP---VVADIRNVKAG
SYP_BURTA       --------RVVADRTVAN-MSDFVVGANEVDYHIAGVNWGRDLPEP---VIADIRNVKAG
SYP_BURL3       --------KVIADRTVAN-MSDFVVGANEVDYHIAGVNWGRDLPEP---DVADVRNVKKG
SYP_CUPPJ       --------KVVADRTVAN-MSDFCCGANYRDYHFTGVNWGRDLPEP---IVADLRNVVAG
SYP_CUPMC       --------KVVADRTVAN-MSDFCCGANDRDYHYTGVNWGRDLPEP---AVADLRNVVAG
SYP_RALSO       --------KVVADRTVAA-MSDFVVGANEEDFHYTGVNWGRDLPEA---EVYDLRNVVEG
SYP_CHRVO       --------RVIADRTVAK-MADFVIGANEDDQHYTGANFGRDCAEP---EVFDIRNVVEG
SYP_NEIMA       --------KVYADFATEK-GADWVIGANEDGYHYTGFNFGRDAAEP---EFVDLRNVVEG
SYP_NEIMB       --------KVYADFATEK-GADWVIGANEDDYHYTGFNFGRDAAEP---EFVDLRNVVEG
SYP_NEIG1       --------KVYADFATEK-GADWVIGANEDDYHYTGFNFGRDAAEP---EFVDLRNVVEG
SYP_NITEU       --------EIIADRAVLE-MSDFTCGANEEGFHLSHVNFGRDLPLPD--QVFDIRNIVAG
SYP_NITMU       --------PVIADLTVAT-MSNFVCGANEEDYHLVNVNFGRDLKEPD--HVFDIRNVVSG
SYP_THIDA       --------RVIADRAVAV-MSDFVCGANKPKFHLAGVNFGRDLQEPD--LVADIRNVVAG
SYP_DECAR       --------AVFADRSVAN-MSDFVCGANEAGYHMTGVNFGRDLPEP---EVFDIRNVVAG
SYP_XANAC       --------RVVADRDVAA-LADFVVGANVSGAHLVGVNWGRDLPEPE--TVADVRNVVEG
SYP_XANC5       --------RVVADRDVAA-LADFVVGANVSGAHLVGVNWGRDLPEPE--TVADVRNVVEG
SYP_XANOM       --------RVVADRDVAA-LADFVVGANVSGAHLVGVNWGRDLPEPE--TVADVRNVVEG
SYP_XANOR       --------RVVADRDVAA-LADFVVGANVSGAHLVGVNWGRDLPEPE--TVADVRNVVEG
SYP_XANC8       --------RIIADRDVAA-MADFVVGANAVGVHLTGVNWGRDLPEPE--TVADVRNVVDG
SYP_XANCP       --------RIIADRDVAA-MADFVVGANAVGVHLTGVNWGRDLPEPE--TVADVRNVVDG
SYP_XYLFA       --------RIIADCEVAV-MADFVVGANEVGFHLVGVNWGRDLPEPE--VVADIRNVIEG
SYP_XYLFT       --------RIIADCEVAV-MADFVVGANEVGFHLVGVNWGRDLPEPE--VVADIRNVIEG
SYP_BUCAI       -----LKVPIIADISTFN-MKNFTIGSNINKHFFINVNWNIDLPMPI---FKDIRKVTKN
SYP_BUCAP       -----LKIPIFADVSVYY-MKDFTIGSNINEKFFINVNWNVDLPIPI---IKDIRNITKK
SYP_BUCBP       -----LDFPVIADFSVIN-LENFTIGSNITNKYFNNMNWNKDISIPQ---TYDIRYVLEG
SYP_BLOFL       -----TPVPLMINYNVATAMYDFIFHNININKNYCMKINQTPNLSKI---TTNLYESNIK
SYP_BLOPB       -----LSIPLIIDYNVAK-MNDFVAGSNMSGKYFFGVNWNRDILFSK---VADLHEVLHH
SYP_WIGBR       -----IKCLLIVDKEAHC-IKNFVSGANINNKYFFNINWDRDVVSYL---VYDLKLCRKK
                            :                                       :       

SYP_AQUAE       DPCPKC-GSPLKVRRGLELGHIFLLGTRYSEPMKAYFTDRD--GKEKPIIMGCYGIGVSR
SYP_THEMA       DPCPVC-GEPLKATKGIELGHIFKLGTKYSEAMKAYFMDEN--GEMKPFIMGCYGWGVSR
SYP_BACSU       DPSPDG-KGTIRFAEGIEVGQVFKLGTRYSEAMNATYLDEN--GRAQPMLMGCYGIGVSR
SYP_BACLD       DPSPDG-KGTIRFAKGIEVGQVFKLGTRYSEAMDATYLDEN--GRAQPMLMGCYGIGISR
SYP1_BACAN      DQSPDG-NGTILFARGIEVGHVFKLGTRYSEAMNATFLDEN--GKTQPLIMGCYGIGVSR
SYP1_BACCZ      DQSPDG-NGTILFARGIEVGHVFKLGTRYSEAMNATFLDEN--GKTQPLIMGCYGIGVSR
SYP1_BACHK      DQSPDG-NGTILFARGIEVGHVFKLGTRYSEAMNATFLDEN--GKTQPLIMGCYGIGVSR
SYP1_BACC1      DQSPDG-NGTILFARGIEVGHVFKLGTRYSEAMNATFLDEN--GKTQPLIMGCYGIGVSR
SYP1_BACCR      DQSPDG-NGTILFARGIEVGHVFKLGTRYSEAMNATFLDEN--GKTQPLIMGCYGIGVSR
SYP_GEOKA       DPSPDG-KGTIRFARGIEVGHVFKLGTKYSEAMNAVYLDEN--GQTQTMIMGCYGIGVSR
SYP_LISMF       DLSPDG-QGVIKFAEGIEVGHIFKLGTKYSEAMNATILDEN--GRAQPIIMGCYGIGVSR
SYP_LISMO       DLSPDG-QGVIKFAEGIEVGHIFKLGTKYSEAMNATILDEN--GRAQPIIMGCYGIGVSR
SYP_LISIN       DLSPDG-QGVIKFAEGIEVGHIFKLGTKYSEAMNATILDEN--GRAQPIIMGCYGIGLSR
SYP_STAA3       EKLSDG-SGVAHFAEGIEVGQVFKLGTKYSESMNATFLDNQ--GKAQSLIMGCYGIGISR
SYP_STAA8       EKLSDG-SGVAHFAEGIEVGQVFKLGTKYSESMNATFLDNQ--GKAQSLIMGCYGIGISR
SYP_STAAC       EKLSDG-SGAAHFAEGIEVGQVFKLGTKYSESMNATFLDNQ--GKAQSLIMGCYGIGISR
SYP_STAAM       EKLSDG-SGVAHFAEGIEVGQVFKLGTKYSESMNATFLDNQ--GKAQPLIMGCYGIGISR
SYP_STAAN       EKLSDG-SGVAHFAEGIEVGQVFKLGTKYSESMNATFLDNQ--GKAQPLIMGCYGIGISR
SYP_STAAW       EKLSDG-SGVAHFAEGIEVGQVFKLGTKYSESMNATFLDNQ--GKAQPLIMGCYGIGISR
SYP_STAAS       EKLSDG-SGVAHFAEGIEVGQVFKLGTKYSESMNATFLDNQ--GKAQPLIMGCYGIGISR
SYP_STAAR       EKLSDG-SGVAHFAEGIEVGQVFKLGTKYSESMNATFLDNQ--GKAQPLIMGCYGIGISR
SYP_STAAB       EKLSDS-SGVAHFAEGIEVGQVFKLGTKYSESMNATFLDNQ--GKAQPLIMGCYGIGISR
SYP_STAHJ       ETLSDG-SGEAKFAEGIEVGQVFKLGTKYSEAMNATFLDNQ--GKAKPLIMGCYGIGVSR
SYP_STAS1       EPLSDG-SGPARFAEGIEVGQVFKLGTKYSESMNATFLDNQ--GKAQPLLMGCYGIGVSR
SYP_STAES       EMLSDG-SGVAQFAEGIEVGQVFKLGTKYSESMNATFLDNQ--GKAQPLIMGCYGIGVSR
SYP_STAEQ       EMLSDG-SGVAQFAEGIEVGQVFKLGTKYSESMNATFLDNQ--GKAQPLIMGCYGIGVSR
SYP_BACHD       DPSPDG-KGTIRFAQGIEVGQVFKLGTVYSEKLGATFLDEN--GKSQPMLMGCYGIGVSR
SYP_BACSK       DPSPDG-KGTLRFAEGIEIGQIFKLGTRYSESLDAKYLDGQ--GKAQPFLMGCYGIGVSR
SYP_LACPL       ELSPDG-AGVLKFTKGIEIGHIFKLGTRYSKDLHAEVLDAN--GRNIPVIMGCYGIGVSR
SYP_LACSS       ETAPDG-EGKLQFTKGIEIGHIFKLGTRYTEQFGATFLDEN--GRAKPIIMGSYGIGVSR
SYP_ENTFA       DPSPDG-NGVLAFTKGIEIGHIFKLGTRYSDAMGATVLDEN--GREKSVIMGCYGIGVSR
SYP_LACS1       ELSPDG-EGVLKFTRGIEIGHIFQLGTRYSESLGADVLDEN--GRQVPMRMGCYGIGVSR
SYP_STRA3       EISPDG-KGTLKFARGIEIGHIFKLGTRYSDSMGANILDEN--GRSNPIVMGCYGIGVSR
SYP_STRA5       EISPDG-KGTLKFARGIEIGHIFKLGTRYSDSMGANILDEN--GRSNPIVMGCYGIGVSR
SYP_STRA1       EISPDG-KGTLKFSRGIEIGHIFKLGTRYSDSMGANILDEN--GRSNPIVMGCYGIGVSR
SYP_STRP1       EMSPDG-HGVLQFARGIEVGHIFKLGTRYSDSMGATILDEN--GRTVPIVMGCYGIGVSR
SYP_STRPM       EMSPDG-HGVLQFARGIEVGHIFKLGTRYSDSMGATILDEN--GRTVPIVMGCYGIGVSR
SYP_STRP3       EMSPDG-HGVLQFARGIEVGHIFKLGTRYSDSMGATILDEN--GRTVPIVMGCYGIGVSR
SYP_STRPF       EMSPDG-HGVLQFARGIEVGHIFKLGTRYSDSMGATILDEN--GRTVPIVMGCYGIGVSR
SYP_STRP8       EMSPDG-HGVLQFARGIEVGHIFKLGTRYSDSMGATILDEN--GRAVPIVMGCYGIGVSR
SYP_STRP6       EMSPDG-HGVLQFARGIEVGHIFKLGTRYSDSMGAKILDEN--GRAVPIVMGCYGIGVSR
SYP_STRPB       EMSPDG-HGVLQFARGIEVGHIFKLGTRYSDSMGATILDEN--GRAVPIVMGCYGIGVSR
SYP_STRPC       EMSPDG-HGVLQFARGIEVGHIFKLGTRYSDSMGATILDEN--GRAVPIVMGCYGIGVSR
SYP_STRPD       EISPDG-HGVLQFARGIEVGHIFKLGTRYSDSMGATILDEN--SRAVPIVMGCYGIGVSR
SYP_STRT1       EISPDG-QGVLQFARGIEIGHIFKLGTRYSESMGANVLDEN--GRAVPIIMGCYGIGVSR
SYP_STRT2       EISPDG-QGVLQFARGIEIGHIFKLGTRYSESMGANVLDEN--GRAVPIIMGCYGIGVSR
SYP_STRMU       EASPDG-RGVLKFARGIEIGHIFKLGTRYSESMGANILDEN--GRSIPIIMGSYGIGVSR
SYP_STRPN       EISPDG-QGVLNFARGIEIGHIFKLGTRYSASMGADVLDEN--GRAVPIIMGCYGIGVSR
SYP_STRR6       EISPDG-QGVLNFARGIEIGHIFKLGTRYSASMGADVLDEN--GRAVPIIMGCYGIGVSR
SYP_LACLA       EISPDG-RGTLKFARGIEIGHIFKLGTRYTEAMNANILDAN--GRSIPMLMGCYGIGVSR
SYP_LACAC       EPDPVD-HLPLKFTTSIEVGHIFKLGTYYTKTMGADFLDQN--GKAQPVIMGSYGIGVTR
SYP_LACJO       EPDPVD-HLPLKFTTSIEVGHIFKLGTYYTDTMGADFLDNN--GKAKPVIMGSYGIGVTR
SYP_FUSNN       DNCITG--GKLHSARGIECGQIFKLGDKYSKAMNATYLDEK--GKTQFMLMGCYGIGVTR
SYP_DEHM1       AACPFC-DGTFASKRGVEVGHIFKLGTFLSERFGANFTDAE--GISHPIIMGCYGMGVGR
SYP_DEHMC       SACPFC-DGTFASKRGVEVGHIFKLGTFLSERFGANFTDAE--GVSHPIIMGCYGMGVGR
SYP1_ANADE      EGCPRC-DGALEVFKALEVGHIFKLGTKYSESMKATVLDAG--GKQVPIVMGSYGIGVER
SYP_CARHZ       EPCPKC-GKALVFARGIEVGQIFKLKDKYSRKMGAFYLDEN--GQQKPIIMGCYGIGVTR
SYP_MOOTA       EPCPQC-GAPLAQARGIEVGQVFQLGTKYSGALGANYTDAR--GQEHPIVMGCYGIGVSR
SYP_DESHY       EPCPQC-GSPLKEARGIEVGQVFKLGTKYSKALNAVFLDEN--GAEHPCVMGCYGIGVSR
SYP_CLOAB       EKCPKC-GKPLTIARGIEVGHIFKLGTKYSEAMKAYFVDEN--GESKPLIMGCYGIGVNR
SYP_CLOTE       DKCPLC-GGNIEIARGIEVGHIFKLGTKYSESMGANFLDEK--GESRPLVMGCYGIGVSR
SYP_CLOPE       EKCPEC-GKEITISRGTEVGHIFKLGTKYSESMGATFIDED--GKAKPFIMGCYGIGVTR
SYP_CALS4       DRCPRC-GAPLKIARGIEVGHIFKLGTKYSEALGATYTDEE--GNEKPIVMGCYGIGINR
SYP_DESAG       DPCPRC-SGTLELTRGIEVGHVFKLGTKYSEAMGCKFLDEN--GKEQVMLMGCYGIGVSR
SYP_DESVH       DPCPRC-GGAVELPKGIEVGHVFKLGLKYSKSMNATFLDEN--GKEQVMVMGCYGIGVSR
SYP_LAWIP       DGCPSC-GREIALTKGIEVGHVFKLGTKYSKSMNAFFLDEN--GEEQLMVMGCYGIGVSR
SYP_GEOMG       DPCPRCEAGHLEMWRGIEVGHVFKLGTKYSESLRATFLDAD--GKEQVIFMGCYGIGISR
SYP_GEOSL       DPCPRCEAGHLELWRGIEVGHVFKLGTKYSEALRATYLDAD--GKEQIIFMGCYGIGISR
SYP_PELCD       DICPRC-GGVLEIWRGIEVGHVFKLGTKYSAALGATVLDDQ--GQDRELFMGCYGIGVGR
SYP_DESPS       DPCPRC-GGRLELTEGIEVGHVFKLGTGYSESMNARFQDGT--GDEKPFVMGCYGIGVSR
SYP_SYNAS       DSCPRC-QGALKFARGIEVGHVFKLGTKYSKAMGASYLDKN--GKEQIMIMGCYGIGTGR
SYP_MYCTU       DPSPDG-AGPLVMARGIEIGHIFQLGSKYTDAFTADVLGED--GKPVRLTMGSYGIGVSR
SYP_MYCBO       DPSPDG-AGPLVMARGIEIGHIFQLGSKYTDAFTADVLGED--GKPVRLTMGSYGIGVSR
SYP_MYCPA       DPSPDG-AGPLVSARGIEVAHIFQLGRKYTDAFTADVLGED--GKPVRLTMGSYGLGVSR
SYP_NOCFA       DPSPDG-RGTLEAARGIEIGHIFQLGYKYTDAFEVDVLGEN--GKPVRLIMGSYGIGVSR
SYP_COREF       DPAPEG-QGTLTLARGIEIGHIFQLGRKYTEAFDVQILDEN--GKRAIPTMGSYGIGVSR
SYP_CORGL       DPAPAG-EGTLTLARGIEIGHIFQLGRKYTEAFDVQILDEN--GKRAIPTMGSYGLGVTR
SYP_CORDI       DPAPEG-QGTLTLARGIEVGHIFQLGRKYTEAFDVQILDES--GKRAIPTMGSYGIGVSR
SYP_CORJK       DPSPDG-KGTLALARGIEIGHIFQLGRKYTEAFDVKILDES--GKRSVPTMGSYGVGVSR
SYP_THEFY       DPAPDG-KGTLYTARGIEIGHVFQLGRKYTDAFSLDALGPD--GKPVRITMGSYGIGVSR
SYP_LEIXX       DPAPDG-SGPVELARGMEIGHVFQLGRKYADALGLTVLDEN--GKLVTVTMGSYGIGVTR
SYP_CUTAK       DPAPDG-SGELHLARGIEIGHIFQLGKKYADALGLKVLDHN--GKLVTVTMGSYGLGVSR
SYP_BIFLO       DMSPDG-SGPLSFERGVEIGQVFQLGLKYSKALDLKVLDQN--GKAVPVWMGCYGIGVSR
SYP_STRCO       DPCPNC-GTGLKLDRAIEIGHIFQLGRKYADALKLDVLGQN--GKPARVTMGSYGIGVSR
SYP1_STRAW      DPCPSC-GTGLRLDRAIEIGHIFQLGRKYADAFQLDVLGKE--GKPVRVTMGSYGIGVSR
SYP_TROW8       DKSE---WGPVTVKRGIEIGHLFQLGLKYSNALGLKVLDKD--GYNKAVFMGSYGIGVSR
SYP_TROWT       DKSE---WGPVTVKRGIEIGHLFQLGLKYSNALGLKVLDKD--GYNKAVFMGSYGIGVSR
SYP_TREPA       DRCIHC-GAPLYEKKGNELGHLFKLGDKYTRSMHLTFTDEQ--GVRQFPLMGCYGIGLDR
SYP_TREDE       DKCAVC-GTALYTKKGNELGHIFKLGYKYTKAMNMTYLDEN--GKQQHPSMGCYGIGLDR
SYP_LEPIC       DLCPNC-SSPLKAEKGIEVGHIFKLGDKYTKAFGIQVLDQN--GKSKTLTTGCYGIGVNR
SYP_LEPIN       DLCPNC-SFPLKAEKGIEVGHIFKLGDKYTKAFGIQVLDQN--GKSKTLTMGCYGIGVNR
SYP_CHLTR       DLCPQNGGAPYEIFQGVEVAHIFNLGTRYTESFSVGFQDKN--GDKQLCWMGTYGIGVGR
SYP_CHLTA       DLCPQNGGAPYEIFQGVEVAHIFNLGTRYTESFSVGFQDKN--GDKQLCWMGTYGIGVGR
SYP_CHLMU       DLCPQNNEAPYEIFQGVEVAHIFNLGTRYTECFSVGFQDEN--GEKQLCWMGTYGIGVGR
SYP_CHLCV       DLCPANGNAPYEVFEGVEVAHIFNLGTRYTECFEVGFQNEQ--EEQQTCWMGTYGIGIGR
SYP_CHLFF       DLCPSNGNAPYEIFEGVEVAHIFNLGTRYTECFDVGFQNEQ--GEQQTCWMGTYGIGIGR
SYP_CHLAB       DLCPTNNHAPYEIFEGVEVAHIFNLGTRYTEGFDVVFQDEQ--GKPQSCWMGTYGIGIGR
SYP_CHLPN       DTCPENPGHPYRIYQGIEVAHIFNLGTRYTDSFEVNFQDEH--GQTQQCWMGTYGIGVGR
SYP_NOSS1       DRAVHDSTQLLKSARGIEVGHIFQLGTKYSQALGATYTNEQ--GEEKPLVMGCYGVGVSR
SYP_TRIV2       DRAIHDSTQILKSARGIEVGHIFQLGTKYSQALGATYTNEQ--GEEKPLVMGCYGVGVSR
SYP_SYNP6       DRAQHDSSQVLASARGIEAGHIFQLGLKYSQAMGATFTTEN--GTEEPLWMGCYGIGVSR
SYP_SYNE7       DRAQHDSSQVLASARGIEAGHIFQLGLKYSQAMGATFTTEN--GTEEPLWMGCYGIGVSR
SYP_SYNY3       DRPVHDPTGELKTARGIEVGHIFQLGTKYSQAMGATFTNEQ--GEEKPLVMGCYGIGVSR
SYP_THEEB       DRACHDPTQHLEAARGIEIGHIFQLGTKYSEAMKATYTNEQ--GEEVPLVMGCYGIGISR
SYP_SYNJA       DRCLLNPDQILETARGIEIGHIFQLGLKFSLPMRASFTDEQ--GSEQPLWMGCYGIGVSR
SYP_SYNJB       DRCLLNPDQILETARGIEIGHIFQLGLKFSLPMRATFTDEQ--GSEQPLWMGCYGIGVSR
SYP_PROM9       DKIKINDNEELKEKKGIEIGHIFQLGQKYSEKLNAKFSDKD--GHLKNLWMGCYGIGVTR
SYP_PROMP       DCISQESNEELKEKRGIEIGHIFQLGQKYSEKLNAKFSDKN--GQLKNLWMGCYGIGVTR
SYP_PROMA       DISIHDPKQKLIAKRGIEVGHIFQLGRKYSSCLQASFTNEM--GLEEPFWMGCYGIGISR
SYP_PROMT       DRCIHDKTQKLQECRGIEIGHIFQLGTKYSKSLNATFTNEK--GVEDHFWMGCYGIGISR
SYP_SYNPX       ERCVHNPDARLQEKRGIEVGHIFQLGRKYSQALDCCFTNEN--GRDEPFWMGCYGIGVSR
SYP_SYNS9       EACVHNPEAHLIEKRGIEVGHIFQLGRKYSEAMDSRFTNEA--GKTEHFWMGCYGIGISR
SYP_SYNSC       DVCQHNLESRLTEKRGIEVGHIFQLGRKYSEAMESGFTNEN--GKTEPFWMGCYGIGVSR
SYP_PROMM       DRCIHDSSQILEERRGIEVGHIFQLGRKYSEALEACFTNDQ--GTQEPFWMGCYGIGISR
SYP_GLOVI       DHCHLAPEATLQSARGVELGHIFKLGTKYSRPMQVLFADEA--GELQPALMGCYGVGVSR
SYP_HELPY       DRCPNC-QGALKYHKSLEVGHIFKLGQGYAKSLKASFLDKN--GKEQFFEMGCYGIGISR
SYP_HELPJ       DCCPNC-QGALKYHKSLEVGHIFKLGQSYAKSLKASFLDKN--GKERFFEMGCYGIGISR
SYP_CAMJE       DCCVKC-GAKLKQSKGIEVGHIFKLGQKYSKAMNANFLDEN--GKSQPFYMGCYGIGVSR
SYP_CAMJR       DCCVKC-GAKLKQSKGIEVGHIFKLGQKYSKAMNANFLDEN--GKSQPFYMGCYGIGVSR
SYP_HELHP       DLCPKC-AQELYYTKGIEVGHIFKLGDKYSRAMNAQFLDND--GKTQPLIMGCYGFGISR
SYP_WOLSU       DGCPLC-EGRLTYKKGIEVGHIFQLGTRYSEPLGANFLNPE--GKSQPLVMGCYGIGVSR
SYP_SHIBS       DPSPDG-QGTLLIKRGIEVGHIFQLGTKYSEALKASVQGED--GRNQILTMGCYGIGVTR
SYP_SHIFL       DPSPDG-QGTLLIKRGIEVGHIFQLGTKYSEALKASVQGED--GRNQILTMGCYGIGVTR
SYP_SHISS       DPSPDG-QGTLLIKRGIEVGHIFQLGTKYSEALKASVQGED--GRNQILTMGCYGIGVTR
SYP_ECOLI       DPSPDG-QGRLLIKRGIEVGHIFQLGTKYSEALKASVQGED--GRNQILTMGCYGIGVTR
SYP_ECO57       DPSPDG-QGTLLIKRGIEVGHIFQLGTKYSEALKASVQGED--GRNQILTMGCYGIGVTR
SYP_SHIDS       DPSPDG-QGTLLIKRGIEVGHIFQLGTKYSEALKASVQGED--GRNQILTMGCYGIGVTR
SYP_ECOL6       DPSPDG-QGTLLIKRGIEVGHIFQLGTKYSEALKASVQGED--GRNQILTMGCYGIGVTR
SYP_ECOUT       DPSPDG-QGTLLIKRGIEVGHIFQLGTKYSEALKASVQGED--GRNQILTMGCYGIGVTR
SYP_SALPA       DPSPDG-QGTLLIKRGIEVGHIFQLGTKYSEALKASVQGED--GRNQILTMGCYGIGVTR
SYP_SALTI       DPSPDG-QGTLLIKRGIEVGHIFQLGTKYSEALKASVQGED--GRNQILTMGCYGIGVTR
SYP_SALTY       DPSPDG-QGTLLIKRGIEVGHIFQLGTKYSEALKASVQGED--GRNQILTMGCYGIGVTR
SYP_SALCH       DPSPDG-QGTLLIKRGIEVGHIFQLGTKYSEALKASVQGED--GRNQILTMGCYGIGVTR
SYP_YERPE       DISPDG-KGTLQIKRGIEVGHIFQLGTKYSEVMKATVQGED--GRNQVMTMGCYGIGVSR
SYP_YERPS       DISPDG-KGTLQIKRGIEVGHIFQLGTKYSEAMKATVQGED--GRNQVMTMGCYGIGVSR
SYP_PECAS       DISPDG-KGTLQIKRGIEVGHIFQLGSKYSEALKATVQGED--GRNQTLTMGCYGIGVTR
SYP_SODGM       DISPDG-NGTLQIKRGIEVGHIFQLGTKYSEAMKATVQGED--GRNQTLTMGCYGIGITR
SYP_PHOLL       DASPDG-KGTLLIKRGIEVGHIFQLGTKYSDAMKATVQGED--GHNQIVTMGCYGIGVTR
SYP_HAEIN       DPSPDG-KGTLQIKRGIEVGHIFQLGKKYSEAMKATVQGED--GKPLVMTMGCYGIGVTR
SYP_HAEI8       DPSPDG-KGTLQIKRGIEVGHIFQLGKKYSEAMKATVQGED--GKPLVMTMGCYGIGVTR
SYP_MANSM       DPSPDG-KGTLLIKRGIEVGHIFQLGQKYSEAMNATVQGED--GKPLVMTMGCYGIGVTR
SYP_HAEDU       DPSPDG-RGILLIKRGIEVGHIFQLGQKYSAAMNATVQGED--GKPLVMTMGCYGIGVTR
SYP_PASMU       DPSPDG-KGVLQIKRGIEVGHIFQLGTKYSAAMNATVQGED--GRPQTMIMGCYGIGVTR
SYP_BAUCH       VSQPQ----RLHRTNWIEVGHIFQLGSKYSKVMKATVQGED--GNNMIMTMGCYGIGITR
SYP_VIBVU       DPSPCG-KGTLMLKRGIEVGHIFQLGNVYSEAMNCGVLDSN--GKNVILEMGCYGIGVSR
SYP_VIBVY       DPSPCG-KGTLMLKRGIEVGHIFQLGNVYSEAMNCGVLDSN--GKNVILEMGCYGIGVSR
SYP_VIBPA       DPSPCG-KGTLMLKRGIEVGHIFQLGNVYSEAMNCSVLGPD--GKNVILEMGCYGIGVSR
SYP_ALIF1       DPSPCG-KGTLQLKRGIEVGHIFQLGTAYSEAMNCGVLDAN--GKNVILEMGCYGIGVSR
SYP_VIBCH       DPSPCG-KGTLMLKRGIEVGHIFQLGTNYSEKMNCGVLDSN--GKNVILEMGCYGIGVSR
SYP_PHOPR       DLSPCG-QGTIQLKRGIEVGHIFQLGTNYSKKMNCNVLGPD--GKSATLEMGCYGIGVSR
SYP_SHEON       EPTPDG-LGTYAMARGIEVGHIFQLGTNYSKSMNATVLDEN--GKSQVLLMGCYGVGVSR
SYP_PSE14       DPSPDG-KGTLEIKRGIEVGHIFQLGTKYSEAMKCQVLGEN--GKPVNLAMGCYGIGVSR
SYP_PSEU2       DPSPDG-KGTLEIKRGIEVGHIFQLGTKYSEAMKCQVLGEN--GKPVNLAMGCYGIGVSR
SYP_PSESM       DPSPDG-QGTLEIKRGIEVGHIFQLGTKYSEAMKCQVLGEN--GKPVNLAMGCYGIGVSR
SYP_PSEF5       DPSPDG-KGTLEIKRGIEVGHIFQLGNKYSKAMKCEVLGEN--GKPVTLEMGCYGIGVSR
SYP_PSEPF       DPSPDG-KGTLEIKRGIEVGHIFQLGNKYSKAMKCEVLGEN--GKPVTLEMGCYGIGVSR
SYP_PSEPK       DPSPDG-QGTLVIKRGIEVGHIFQLGTKYSEALKCQVLGEN--GKPVVLSMGCYGIGVSR
SYP_PSEAE       DPSPDG-KGTLVIKRGIEVGHIFQLGTKYSEAMKLSVLSEQ--GKPVNLIMGCYGIGVSR
SYP_CHRSD       DPSPDG-KGTLSIARGIEVGHVFQLGTKYSTAMNATVLDDN--GQAVPLLMGCYGIGVTR
SYP_PSYA2       DPSPDG-KGTLQIKRGIEVGHIFQLGNKYSQAMNCTVSGDD--GKPVTLMMGCYGIGVSR
SYP_PSYCK       DPSPDG-KGTLQIKRGIEVGHIFQLGDKYSQAMNCTVSGED--GKPVTLMMGCYGIGVSR
SYP_ACIAD       DPSPDG-QGVLQIKRGIEVGHIFQLGQKYSEALNCTVLGDD--GKPLVVTMGCYGIGVTR
SYP_HAHCH       DLSPDG-KGVLVLKKGIEVGHVFKLGDKYSSAMNATVLDEN--GKATVMQMGCYGIGVSR
SYP_SACD2       DPSPCG-KGTIDIKRGIEVGHIFQLGTKYSEAMKASVLDEN--GKDKTMIMGCYGIGVSR
SYP_COLP3       DPSPCG-QGNIEIKRGIEVGHIFQLGRKYAEAMNCAVLNEG--GKNQTLTMGCYGIGVSR
SYP_IDILO       DPSPCG-QGKVKIARGIEVGHIFQLGKKYSDAMKVGVLSES--GKHETLTMGCYGIGVSR
SYP_PSEHT       DASPCG-QGTLQIKRGIEVGHIFQLGTKYSQAMKAGVLNES--GKNQIMTMGCYGIGVSR
SYP_HYDCU       DPSPCG-KGKIEIRRGIEVGHIFQLGNKYSEALNATVLNEN--SRAQILEMGCYGIGVTR
SYP_COXBU       DISPDG-KGRLRFARGIEVGQVFQLGDKYSRKMNATVVDEL--GKSRYLQMGCYGIGVSR
SYP_NITOC       DPSPDG-EGTLSIARGIEVGHIFQLGEKYSQAMNATVLDET--GRAISLAMGCYGIGVSR
SYP_METCA       DPSPDG-LGTLRIARGIEVGHIFQLGTKYSAALNATVLNEE--GRSQVMLMGCYGIGVSR
SYP_LEGPA       DQSPDG-RGTLHCCRGIEVGHVFQLGDKYAKAMNASVINEQ--GQLQTMIMGCYGLGITR
SYP_LEGPL       DPSPDG-RGTLHCCRGIEVGHVFQLGDKYAKAMNASVINEQ--GQLQTMIMGCYGLGITR
SYP_LEGPH       DPSPDG-KGTLHCCRGIEVGHVFQLGDKYAKAMNASVINEQ--GQLQTMIMGCYGLGITR
SYP_FRATH       DISPDG-KGTLELTNGIEVGHIFELEDVYSKPMNANIIGQD--GKSKPMLMGCYGFGVSR
SYP_FRATT       DISPDG-KGTLELTNGIEVGHIFELEDVYSKPMNANIIGQD--GKSKPMLMGCYGFGVSR
SYP_BORBR       DPSPDG-KGALSIQRGIEVGHVFFLGTKYSEALKATFLDDN--GKPAVLQMGCYGIGVTR
SYP_BORPE       DPSPDG-KGALSIQRGIEVGHVFFLGTKYSEALKATFLDDN--GKPAVLQMGCYGIGVTR
SYP_BORPA       DPSPDG-KGALSIQRGIEVGHVFFLGTKYSEALKATFLDDN--GKPAVLQMGCYGIGVTR
SYP_BORA1       DPSPDG-KGTLAIQRGIEVGHVFFLGTKYSEALKATFLDET--GKPALMQMGCYGIGVTR
SYP_AROAE       DPSPDG-RGRLAIQRGIEVGHVFYLGTKYSQSMNATFLDEN--GKPKHFEMGCYGIGVTR
SYP_RHOFT       DASPDG-QGVLAIERGIEIGHVFYLGTKYSQAMNATFLDVN--GKPQFMEMGCYGIGITR
SYP_BURP1       DPSPDG-KGALDICRGIEVGHVFQLGTKYSDAMGATFIDES--GKAQPMVMGCYGIGITR
SYP_BURPS       DPSPDG-KGALDICRGIEVGHVFQLGTKYSDAMGATFIDES--GKAQPMVMGCYGIGITR
SYP_BURMA       DPSPDG-KGALDICRGIEVGHVFQLGTKYSDAMGATFIDES--GKAQPMVMGCYGIGITR
SYP_BURTA       DPSPDG-KGVLDICRGIEVGHVFQLGTKYSDAMGATFIDES--GKAQPMVMGCYGIGVTR
SYP_BURL3       DPSPDG-KGVIDICRGIEVGHVFQLGTKYSEAMGATFLDES--GKPQPMLMGCYGVGVTR
SYP_CUPPJ       DASPDG-KGTLEICRGIEVGHVFMLGTRYSESMNATFLDEN--GKTQPMQMGCYGIGVTR
SYP_CUPMC       DASPDG-KGTLDICRGIEVGHVFMLGTRYSESMNATFLDEN--GKTQPMQMGCYGIGVTR
SYP_RALSO       DPSPDG-KGTLAICRGIEVGHVFMLGTRYSESMSATFLDEN--GKTQPMMMGCYGIGITR
SYP_CHRVO       DPSPDG-QGALAIQRGIEVGHVFYLGTKYSAAMNATFLDED--GKPKPFEMGCYGIGVTR
SYP_NEIMA       DESPDG-QGRLKLARGIEVGHVFQLRDKYTQAMNVSFLDNN--GKSQIMEMGCYGIGITR
SYP_NEIMB       DESPDG-QGRLKLARGIEVGHVFQLRDKYTQAMNVSFLDNN--GKSQIMEMGCYGIGITR
SYP_NEIG1       DESPDG-QGRLKLARGIEVGHVFQLRGKYTQAMNVSFLDNN--GKSQIMEMGCYGIGITR
SYP_NITEU       DPSPDG-KGVLEICRGIEVGHVFQLRTKYSEKMKATYLDES--GQTRIMEMGCYGIGVSR
SYP_NITMU       DLSPDG-KGKLEICRGIEVGHIFQLLTKYSEAMKANYLDES--GQARPMEMGCYGIGVSR
SYP_THIDA       DPSPDG-KGTLALCRGIEVGHVFQLGNKYSQAMNATYLDEA--GKAQAMEMGCYGIGVSR
SYP_DECAR       DASPDG-QGKLEILRGIEVGHIFQLRQKYAEALNCVYLDDS--GKSQIMEMGCYGIGVSR
SYP_XANAC       ERAADG--GELRLARGIEVGHVFQLGSQYAQALQATVIDEG--GKAAVMKMGCYGIGISR
SYP_XANC5       ERAADG--GELRLARGIEVGHVFQLGSQYAQALQATVIDEG--GKAAVMKMGCYGIGISR
SYP_XANOM       ERAADG--GELRLARGIEVGHVFQLGSQYAQALQATVIDEG--GKVAVMKMGCYGIGISR
SYP_XANOR       ERAADG--GELRLARGIEVGHVFQLGSQYAQALQATVIDEG--GKVAVMKMGCYGIGISR
SYP_XANC8       DRASDG--GELRLTRGIEVGHVFQLGSKYAEALQATVLDEN--GKAAVMKMGCYGIGISR
SYP_XANCP       DRASDG--GELRLTRGIEVGHVFQLGSKYAEALQATVLDEN--GKAAVMKMGCYGIGISR
SYP_XYLFA       DRAVDG--GKICIARGIEVGHVFQLGRKYAEAMKATVLDEY--GKAVTMTMGCYGIGVSR
SYP_XYLFT       DRAVDG--GKICIARGIEVGHVFQLGRKYAEAMKATVLDEY--GKAVTMTMGCYGIGVSR
SYP_BUCAI       DLSPNG-SGYLNIKQSIEIGHIFQLGQKYSRKIQQSVKIKN--GNLKNLYMGCYGIGITR
SYP_BUCAP       DISSDG-SKSLEIKKSIEIGHIFQLGKEYSKKMNVLVQEQH--NNYKHIHMGCYGIGITR
SYP_BUCBP       DPSPDG-AGELKMQKSIEIAHIFQLGKKYSKIMNVKIQNKI--GKKDTLIMGCYGIGITR
SYP_BLOFL       KINTNQIRKLLPIRNTIEIGHIFQLGKKYSNCINSCIQKKN--KDNLNITMGCYGIGITR
SYP_BLOPB       NSYTNK-KNILSIHNCIEIGHIFQLGQKYLNLHTNYSQKNNEHKHNLSMEMGCYGIGITR
SYP_WIGBR       YNNKKN-------NNSIEIGHIFQLGDKYSKPLNYSLLKDY---NKKKIFMGCYGIGISR
                                 * .::* *                          * ** *  *

SYP_AQUAE       ILAALVEQYHD-------------DKGIKWPT------PVAPFELDIILLNTKDE-EMKN
SYP_THEMA       TMAAVVEHFHD-------------ENGMIWPL------SIAPYTVVVDILNMNDA-EQKQ
SYP_BACSU       TLSAIAEQHHD-------------EKGLIWPK------SVAPYDLHILALNMKND-GQRE
SYP_BACLD       TLSAIVEQHHD-------------DKGLIWPL------EVTPYDLHILALNMKND-AQVQ
SYP1_BACAN      TVAAIAEQFND-------------ENGLVWPK------AVAPFHVHVIPVNMKSD-AQRE
SYP1_BACCZ      TVAAIAEQFND-------------ENGLVWPK------AVAPFHVHVIPVNMKSD-AQRE
SYP1_BACHK      TVAAIAEQFND-------------ENGLVWPK------AVAPFHVHVIPVNMKSD-AQRE
SYP1_BACC1      TVAAIAEQFND-------------ENGLVWPK------AVAPFHVHVIPVNMKSD-AQRE
SYP1_BACCR      TVAAIAEQFND-------------ENGLVWPK------AVAPFHVHVIPVNMKSD-AQRE
SYP_GEOKA       LVAAIAEQFAD-------------EHGLVWPA------SVAPFHIHLLTANAKSD-EQRA
SYP_LISMF       ILSAIAEQSND-------------ENGFVWDK------QISPFDLHLIPVNMKSE-EQVA
SYP_LISMO       ILSAIAEQSND-------------ENGFVWDK------QISPFDLHLIPVNMKSE-EQVA
SYP_LISIN       ILSAIAEQSND-------------ENGLVWDK------QISPFDLHLIPVNMKSE-EQVA
SYP_STAA3       TLSAIVEQNHD-------------DNGIVWPK------SVTPFDLHLISINPKKD-DQRE
SYP_STAA8       TLSAIVEQNHD-------------DNGIVWPK------SVTPFDLHLISINPKKD-DQRE
SYP_STAAC       TLSAIVEQNHD-------------DNGIVWPK------SVTPFDLHLISINPKKD-DQRE
SYP_STAAM       TLSAIVEQNHD-------------DNGIVWPK------SVTPFDLHLISINPKKD-DQRE
SYP_STAAN       TLSAIVEQNHD-------------DNGIVWPK------SVTPFDLHLISINPKKD-DQRE
SYP_STAAW       TLSAIVEQNHD-------------DNGIVWPK------SVTPFDLHLISINPKKD-DQRE
SYP_STAAS       TLSAIVEQNHD-------------DNGIVWPK------SVTPFDLHLISINPKKD-DQRE
SYP_STAAR       TLSAIVEQNHD-------------DNGIVWPK------SVTPFDLHLISINPKKD-DQRE
SYP_STAAB       TLSAIVEQNHD-------------DNGIVWPK------SVTPFDLHLISINPKKD-DQRE
SYP_STAHJ       TLSAIVEQNND-------------ENGIIWPK------SVTPFDLHLITINPKKD-EQLE
SYP_STAS1       TLSAIVEQNND-------------ENGIIWPK------SVTPFDLHLITINPKKD-DQRE
SYP_STAES       TLSAIVEQNND-------------ENGIIWPK------SVTPFDIHLITINPKKD-DQRT
SYP_STAEQ       TLSAIVEQNND-------------ENGIIWPK------SVTPFDIHLITINPKKD-DQRT
SYP_BACHD       MVAAVIEQHHD-------------EDGIVWPT------SVAPFDVHVLALNVKKE-EQMK
SYP_BACSK       TLAAVIEQHHD-------------EAGIVWPK------AVAPFDVHLLALNVKNE-DQKT
SYP_LACPL       LLSAIAEQRAD-------------ENGLIWPK------AIAPFDVHVIPVNPKKA-DQVE
SYP_LACSS       LLSAITEQQAD-------------ENGLVWPS------AIAPYDLHVVPVNVKDD-AQVE
SYP_ENTFA       LLSAIVEQNAD-------------ERGINWPT------GIAPFDLHVVQMNVKDE-YQTK
SYP_LACS1       LLSAIVEQHND-------------ENGIAWPR------EIAPFDIHVVPVNVKND-TQRE
SYP_STRA3       ILSAVIEQHARLFVNKTPKGAYRFAWGINFPE------ELAPFDVHLITVNVKDQ-ESQD
SYP_STRA5       ILSAVIEQHARLFVNKTPKGAYRFAWGINFPE------ELAPFDVHLITVNVKDQ-ESQD
SYP_STRA1       ILSAVIEQHARLFVNKTPKGAYRFAWGINFPE------ELAPFDVHLITVNVKDQ-ESQD
SYP_STRP1       ILSAVIEQHARLFVNKTPKGDYRYAWGINFPK------ELAPFDVHLITVNVKDQ-VAQD
SYP_STRPM       ILSAVIEQHARLFVNKTPKGDYRYAWGINFPK------ELAPFDVHLITVNVKDQ-VAQD
SYP_STRP3       ILSAVIEQHARLFVNKTPKGDYRYAWGINFPK------ELAPFDVHLITVNVKDQ-VAQD
SYP_STRPF       ILSAVIEQHARLFVNKTPKGDYRYAWGINFPK------ELAPFDVHLITVNVKDQ-VAQD
SYP_STRP8       ILSAVIEQHARLFVNKTPKGDYRYAWGINFPK------ELAPFDVHLITVNVKDQ-VAQD
SYP_STRP6       ILSAVIEQHARLFVNKTPKGDYRYAWGINFPK------ELAPFDVHLITVNVKDQ-AAQD
SYP_STRPB       ILSAVIEQHARLFVNKTPKGDYRYAWGVNFPK------ELAPFDVHLITVNVKDQ-VAQD
SYP_STRPC       ILSAVIEQHARLFVNKTPKGDYRYAWGVNFPK------ELAPFDVHLITVNVKDQ-VAQD
SYP_STRPD       ILSAVIEQHARLFVNKTPKGDYRYAWGINFPK------ELAPFDVHLITVNVKDQ-VAQD
SYP_STRT1       ILSAVIEQHARLFVNKTPKGQYRYAWGINFPK------ELAPYDVHLITVNTKDE-EANA
SYP_STRT2       ILSAVIEQHARLFVNKTPKGQYRYAWGINFPK------ELAPYDVHLITVNTKDE-EANA
SYP_STRMU       ILSAVIEQNARIFVNKTPKGAYRFSWGVNFPK------TLAPFDVHLITVNVKDE-VSQQ
SYP_STRPN       LLSAVMEQHARLFVNKTPKGEYRYAWGINFPK------ELAPFDVHLITVNVKDE-EAQA
SYP_STRR6       LLSAVMEQHARLFVNKTPKGEYRYAWGINFPK------ELAPFDVHLITVNVKDE-EAQA
SYP_LACLA       LLSAILEQFARIYVEKTPREEFKFSWSINFPK------ELAPFDIHLVPVNVKDE-AAME
SYP_LACAC       MLSAVVEQHLT-------------DRGVAWPK------EIAPFEIHIVQMKMNKE-DQTE
SYP_LACJO       MLSAAVEQHLT-------------ENGIAWPK------EIAPFAIHLIQMKMKDE-TQTK
SYP_FUSNN       TMAASIEQNND-------------ENGIIWPV------SIAPYIVDVIPANIKNE-VQVS
SYP_DEHM1       LLAAAIEQNHD-------------EKGIIWPM------PIAPYQIYICGLFLDNP-AVSQ
SYP_DEHMC       LLAAAIEQNHD-------------EKGIIWPM------PIAPYQVYICGLFLDNP-VVRE
SYP1_ANADE      ILAAAIELHHD-------------DNGIVFPM------AIAPFHATVLTLGPE-P-ELRK
SYP_CARHZ       TMAAAVEQNHD-------------EDGIIWPA------AIAPFEVIVVPVSNKDE-QQMK
SYP_MOOTA       TMAAIVEQCHD-------------DQGIIWPL------SVAPYQVVIIPASLKDD-GQRQ
SYP_DESHY       TMAAAIEQNND-------------KDGIIWPI------PIAPYHVIVVPVNMKDD-QVRE
SYP_CLOAB       TMSAVVEQHHD-------------DNGIVWPL------SVAPYEVIVVPAVFKSE-EQMK
SYP_CLOTE       TMAAAIEQNHD-------------ENGIVWPL------SIAPYHVIVVPVITKDE-EQMK
SYP_CLOPE       TVASIIEQHND-------------ENGIIWPL------EVAPYHVSVIPANVKNE-EQAT
SYP_CALS4       TVAAIIEQHHD-------------EKGIIWPM------SVAPYHVIVVPVNVSDE-EQKQ
SYP_DESAG       VVAACIEQNSD-------------ENGIVFPP------PIAPFEVLLLNLDGKND-DVNA
SYP_DESVH       VVASCIEQNND-------------GDGIVFPP------PIAPYEVALLLLDPKNE-EAAA
SYP_LAWIP       VIAACIEQNND-------------KYGIIFPP------PLAPFEIMLINLDPRDE-SVVM
SYP_GEOMG       TVAACIEQNHD-------------ADGIIFPI------PIAPFHCIISAVSTKDA-EVVA
SYP_GEOSL       TVAACIEQNHD-------------ADGIIFPI------PIAPFHCIVSAVNTKDA-EVMA
SYP_PELCD       TVAAAIEQNHD-------------ENGIVFPM------PIAPFHVLVTVVNPRQE-EVLA
SYP_DESPS       VVAAAIEQNHD-------------KDGIIFPV------PLAPYTVTVLNLGLKDP-EITA
SYP_SYNAS       TVAACIEQNHD-------------ENGIVWPM------PISPYQVIITPVNMNDK-ALAE
SYP_MYCTU       LVAVVAEQHHD-------------ELGLRWPS------TVAPFDVHLVIANKDAQ-ARA-
SYP_MYCBO       LVAVVAEQHHD-------------ELGLRWPS------TVAPFDVHLVIANKDAQ-ARA-
SYP_MYCPA       MVAVIAEQHHD-------------ELGLRWPA------SVAPFDVHLVIANKDAQ-ARA-
SYP_NOCFA       MVAVIAEQQHD-------------EKGLRWPA------AVAPFDVHVVVANKDEA-ART-
SYP_COREF       LLAVLAEQRHD-------------EAGLNWSP------AVAPYQVHVVAANKDAA-AIE-
SYP_CORGL       LLAVLAEQRHD-------------DAGLNWSV------EVAPYQVHVVAANKDAA-AIE-
SYP_CORDI       LMAVLAEQRHD-------------ETGLNWPL------EVAPYQVHVVVANKDKE-AIE-
SYP_CORJK       LVGVIAEQMLD-------------DSGLRWPA------SVAPFDVHVVIANKDAA-AGE-
SYP_THEFY       VVAAIVEQSHD-------------ERGIIWPR------EVAPADVHVVGTGK-GD-QVE-
SYP_LEIXX       ILAIIAEENND-------------DKGLVWPE------AVAPFDVHVVAAGREQV-AFD-
SYP_CUTAK       AVAAIAEGTCD-------------EKGLCWPR------EVAPYDVQVLATGKGTE-ILD-
SYP_BIFLO       VLACIAETHHD-------------EAGLAWPS------VIAPAAVHVVATGKDAV-AFE-
SYP_STRCO       AVAALAEQHAD-------------DKGLVWSK------EVAPADVHVVAAGK-AL-QTE-
SYP1_STRAW      AVAALAEQTAD-------------EQGLCWPK------EIAPADVHVVAAGK-AL-QTE-
SYP_TROW8       LFALIAEKNCD-------------ERGLKWPA------VLAPFDLHVVLLSS--------
SYP_TROWT       LFALIAEKNCD-------------ERGLKWPA------VLAPFDLHVVLLSS--------
SYP_TREPA       TLASVVENHHD-------------TRGISWPL------AISPYAVVLIPIPHTQA-PYA-
SYP_TREDE       LTASIVEEHHD-------------EDGIIWPM------SIAPFQVAIVPIKYEGE-MQK-
SYP_LEPIC       TMATVIEQCND-------------EKGIFWPI------SIAPFEVSLVSIVKGED-QYS-
SYP_LEPIN       TMATVIEQCND-------------EKGIFWPI------SIAPFEVSLVSIVKGED-QYF-
SYP_CHLTR       TLAACIEQLAD-------------NKGLVWPL------AVAPFSITILYNGG-DT-EGEA
SYP_CHLTA       TLAACIEQLAD-------------NKGLVWPL------AVTPFSITILYNGG-DT-EGEA
SYP_CHLMU       TLAACIEQLAD-------------SKGIVWPL------AVAPFSITILYNGG-DT-EGEA
SYP_CHLCV       TLAACIEQLAD-------------DRGIVWPK------AIAPFDIAILYNGG-DA-ASQE
SYP_CHLFF       TLAACVEQLAD-------------DRGIVWPK------AIAPFDISILYNGG-DS-ASQE
SYP_CHLAB       TLAACIEQLAD-------------DRGIVWPK------AIAPFDISILYNGG-DT-ACEE
SYP_CHLPN       TLAACVEQLAD-------------DRGIVWPK------ALAPFSITIAFNGG-DT-VSQE
SYP_NOSS1       LAQSAVEQSYD-------------KDGIIWPV------AIAPYHAIVTIPNINDA-QQVE
SYP_TRIV2       LAQSAVEQSYD-------------KDGIIWPV------AIAPYHAIVTIPNINDA-QQVE
SYP_SYNP6       VAQAAVEQSYD-------------KDGIIWPV------AIAPYQAVVVIPNITDT-EQVA
SYP_SYNE7       VAQAAVEQSYD-------------KDGIIWPV------AIAPYQAVVVIPNITDT-EQVA
SYP_SYNY3       LAQAAVEQSYD-------------KDGIIWPT------AIAPYEVVIVVPNVGDE-EQMQ
SYP_THEEB       LAQAAVEQHHD-------------AQGIVWPL------AIAPYQVIIVVPNIGDA-QQMQ
SYP_SYNJA       LAQAAVEQSHD-------------ANGIIWPV------AIAPYHVVVVVPNVSDP-EQTK
SYP_SYNJB       LAQAAVEQSHD-------------ANGIIWPV------AIAPYHVVVVVPNISDP-EQMS
SYP_PROM9       IAQAAIEQNHD-------------QKGICWPI------QISPFEVIIIPTNLKDQ-IQRD
SYP_PROMP       IAQAAIEQNHD-------------ENGISWPI------QISPFEILIIPTNLKDP-IQKE
SYP_PROMA       LAQASVEQNYD-------------QSGIIWPL------GIAPFEVIVIVANMKDD-LQRE
SYP_PROMT       LAQAAVEQNHD-------------DLGIIWPT------SIAPFTVIIIIANIKNN-DQKC
SYP_SYNPX       LAQAAVEQHHD-------------DGGIRWPA------AIAPYEVIVVIANNHDD-AQTD
SYP_SYNS9       LAQAAVEQHHD-------------DAGICWPA------AIAPYEAIVVVANMQDQ-TQAE
SYP_SYNSC       LAQAAVEQHHD-------------DSGICWPT------AIAPFEAIVVVANIQDD-TQGQ
SYP_PROMM       LAQAAVEQHHD-------------EAGMKWPL------AIAPFEVIIVVANIQDE-VQQK
SYP_GLOVI       LPAAVVEQSHD-------------NDGILWPI------AIAPYQVVLVPANVAVE-AQRQ
SYP_HELPY       LLSAILEQKSD-------------DLGCVWTK------NTAPFDVVIVVSNWKDE-AQKK
SYP_HELPJ       LLSVILEQKSD-------------DLGCVWTK------NTAPFDVVIVVSNLKDE-AQKK
SYP_CAMJE       LLAVAIEANHD-------------EKGCIWNK------TLAPFVLEIIVSNLKDE-KALE
SYP_CAMJR       LLAVATEASHD-------------EKGCIWNK------TLAPFVLEIIVSNLKDE-KALE
SYP_HELHP       ILPAILEQKSD-------------DLGCIWSK------EVSVFDIAIIISNTKDS-VQND
SYP_WOLSU       LLAAVIEQHHD-------------EKGCIWTK------STAPFNLVIVVSNVKDP-SQKA
SYP_SHIBS       VVAAAIEQNYD-------------ERGIVWP------DAIAPFQVAILPMNMHKSFRVQE
SYP_SHIFL       VVAAAIEQNYD-------------ERGIVWP------DAIAPFQVAILPMNMHKSFRVQE
SYP_SHISS       VVAAAIEQNYD-------------ERGIVWP------DAIAPFQVAILPMNMHKSFRVQE
SYP_ECOLI       VVAAAIEQNYD-------------ERGIVWP------DAIAPFQVAILPMNMHKSFRVQE
SYP_ECO57       VVAAAIEQNYD-------------ERGIVWP------DAIAPFQVAILPMNMHKSFRVQE
SYP_SHIDS       VVAAAIEQNYD-------------ERGIVWP------DAIAPFQVAILPMNMHKSFRVQE
SYP_ECOL6       VVAAAIEQNYD-------------ERGIVWP------DAIAPFQVAILPMNMHKSFRVQE
SYP_ECOUT       VVAAAIEQNYD-------------ERGIVWP------DAIAPFQVAILPMNMHKSFRVQE
SYP_SALPA       VVAAAIEQNFD-------------ERGIVWP------DAIAPFQVAILPMNMHKSFRVQE
SYP_SALTI       VVAAAIEQNFD-------------ERGIVWP------DAIAPFQVAILPMNMHKSFRVQE
SYP_SALTY       VVAAAIEQNFD-------------ERGIVWP------DAIAPFQVAILPMNMHKSFRVQE
SYP_SALCH       VVAAAIEQNFD-------------ERGIVWP------DAIAPFQVAILPMNMHKSFRVQE
SYP_YERPE       VVAAAIEQNHD-------------DRGIIWP------DAIAPFQVAILPMNMHKSFRVKE
SYP_YERPS       VVAAAIEQNHD-------------DRGIIWP------DAIAPFQVAILPMNMHKSFRVKE
SYP_PECAS       VVAAAIEQNND-------------ERGIIWP------DAIAPFHVAILPMNMHKSFRVKE
SYP_SODGM       VVVAAIEQNHD-------------DRGILWP------ETLAPFNVAILPMNMHKSFRVKE
SYP_PHOLL       IVAAAIEQNHD-------------DRGIIWP------DAIAPFQVAILPMNMHKSYRVKE
SYP_HAEIN       VVASAIEQHHD-------------ERGIIWPS-----DEIAPFTVAIVPMNMHKSEAVQK
SYP_HAEI8       VVASAIEQHHD-------------DRGIIWPS-----DEIAPFTVAIVPMNMHKSEAVQK
SYP_MANSM       VVASAIEQHHD-------------ERGIIWPS-----DAIAPFTVAIVPMNMHKSESVQA
SYP_HAEDU       VVAAAIEQHHD-------------ERGIIWPT-----DEIAPFTVAIVPMNMFKSASVQA
SYP_PASMU       VIAAAIEQHHD-------------ERGIIWP------DNIAPFKVAIVPMNMHKSESVQQ
SYP_BAUCH       VVAAAIDKYND-------------KQGLLLP------VSIAPFQVAIIPINLHKSLLVQT
SYP_VIBVU       VVAAAIEQNND-------------KYGIIWP------DALAPFQVAIVPMNMHKSERVQE
SYP_VIBVY       VVAAAIEQNND-------------KYGIIWP------DALAPFQVAIVPMNMHKSERVQE
SYP_VIBPA       VVASAIEQNHD-------------KYGIIWP------DAIAPFQVAIVPMNMHKSERVKE
SYP_ALIF1       VVASAIEQNND-------------EYGIVWP------EAIAPFTVAIVPMNMHKSERVKE
SYP_VIBCH       VVAAAIEQNHD-------------DYGIIWP------DAIAPFQVAIVPMNMHKSERVQQ
SYP_PHOPR       IVASAIEQNND-------------ENGIIWP------TALAPFQVAIVPMNMAKSEEVKA
SYP_SHEON       IVAAAIEQNFD-------------DRGIVWP------EAIAPFSVGILPMNMHKSHRVTD
SYP_PSE14       VVAAAIEQNSD-------------ENGIIWN------DTLAPFQIALIPLR-YETDAVRE
SYP_PSEU2       VVAAAIEQNSD-------------ENGIIWN------DTLAPFQIALVPLR-YETDAVRE
SYP_PSESM       VVAAAIEQNSD-------------ENGIIWN------DTLAPFQIALIPLR-YETDAVRE
SYP_PSEF5       VVAAAIEQNND-------------ANGIIWS------DTLAPFQIALVPLR-YETEQVRE
SYP_PSEPF       VVAAAIEQNND-------------ENGIIWS------DALAPFQIALVPLR-YETELVRE
SYP_PSEPK       VVAAAIEQSYD-------------DKGIIWN------DALAPFQIALVPLR-YETDVVRE
SYP_PSEAE       VVAAAIEQNHD-------------ERGILWP------SALAPFQIALVPLK-YETESVKQ
SYP_CHRSD       VVAAAIEQNHD-------------AGGIIWP------DAIAPFEIALVPMNAHKSERVRE
SYP_PSYA2       IIAAAIEQNND-------------ENGIMWPLTPNISDSLAPFEVAIVPMKSKEE-TVMQ
SYP_PSYCK       IIAAAIEQNND-------------ENGIMWPSTPDISDSLAPFEVAIVPMKSKED-TVME
SYP_ACIAD       VVASAIEQNYD-------------DKGIIWPS------AIAPFEIAIVPMNAHKSPKTLE
SYP_HAHCH       VVAAAIEQGHD-------------DKGIIWPD------ALAPFEVALVPLNMHKSDVVRE
SYP_SACD2       IVASAIEQNYD-------------DNGIIWPD------AIAPFHVAIVPINMQKSEAVAQ
SYP_COLP3       IVAAAIEQNHD-------------KYGIKWPK------AIAPFQVAIVPMNMAKSARVKE
SYP_IDILO       IVAAAIEQNND-------------ERGICWPE------ALAPFQVVIVPMNMHKSARVQE
SYP_PSEHT       IVAAAIEQNND-------------QYGIIWPQ------PIAPFDLAIVPMNMHKSHRIPD
SYP_HYDCU       VVAAAIEQNYD-------------DKGIIWPE------AIAPFQVCIVPMQMHKSPRVEE
SYP_COXBU       TVAAAIEQNHD-------------ERGIIWPM------PMAPFFIALVPVNMHKSYRVRE
SYP_NITOC       VVAAAIEQNHD-------------EHGIIWPA------SIAPFQLALVPINAHKSARVKE
SYP_METCA       VVAAAIEQNHD-------------ERGIVWPE------ALAPFQVALCPINMQTSARVRT
SYP_LEGPA       VVAAAIEQHHD-------------EHGIIWPQ------ALAPFQVNIIPLNGARSQTVKE
SYP_LEGPL       VVAAAIEQHHD-------------EHGIIWPQ------ALAPFQVNIIPLNGARSHAVKE
SYP_LEGPH       VVAAAIEQHHD-------------EHGIIWPQ------ALAPFQVNIIPLNGARSQAVKE
SYP_FRATH       VMAAAIEQSHD-------------ENGIIWPE------SIAPYQVAILPINYNKSDKVKE
SYP_FRATT       VMAAAIEQSHD-------------ENGIIWPE------SIAPYQVAILPINYNKSDKIKE
SYP_BORBR       IVGAAIEQNHD-------------ARGIIWPR------AIAPYEVVICPVGWGKSETVRD
SYP_BORPE       IVGAAIEQNHD-------------ARGIIWPR------AIAPYEVVICPVGWGKSETVRD
SYP_BORPA       IVGAAIEQNHD-------------ARGIIWPR------AIAPYEVVICPVGWGKSETVRD
SYP_BORA1       IVGAAIEQNFD-------------NRGIIWPR------AIAPFEVVICPVGWGKSETVRN
SYP_AROAE       ILGAAIEQNHD-------------ARGIIWPD------AIAPFRVVVCPVGWGKSDAVRT
SYP_RHOFT       LPAAAIEQNHD-------------ERGIIWPD------ALAPFTVVLCPISPERFPDVKA
SYP_BURP1       ILGAAIEQNFD-------------DKGIVWPE------AIAPFEVVLCPMGYDRSDAVRE
SYP_BURPS       ILGAAIEQNFD-------------DKGIVWPE------AIAPFEVVLCPMGYDRSDAVRE
SYP_BURMA       ILGAAIEQNFD-------------DKGIVWPE------AIAPFEVVLCPMGYDRSDAVRE
SYP_BURTA       ILGAAIEQNFD-------------DKGIIWPE------AIAPFEVVLCPMGYDRSDAVRE
SYP_BURL3       ILGAAIEQNFD-------------DKGIIWPE------SIAPFEVVLCPMGYDRSDMVRE
SYP_CUPPJ       ILGAAIEQNFD-------------ERGIIWPA------AIAPFEVVVCPVGYDRSEAVKA
SYP_CUPMC       ILGAAIEQNYD-------------ERGIIWPA------AIAPFAVVVCPVGYDRNEAVKA
SYP_RALSO       ILGAAIEQNYD-------------ARGIIWPV------SIAPFEVVICPVGYDRSEAVRA
SYP_CHRVO       ILGAAIEQNYD-------------DKGMIWPD------SIAPFAVVVCPVGYDRSEAVKE
SYP_NEIMA       VVAAAIEQNND-------------EKGIIWTK------AMASFEVVIVPMNYKKSDTVRE
SYP_NEIMB       VVAAAIEQNND-------------EKGIIWTK------AMAPFEVVIVPMNYKKSDTVRE
SYP_NEIG1       VVAAAIEQNND-------------EKGIIWTK------AMAPFEVVIVPMNYKKSDTVRE
SYP_NITEU       IVAAAIEQNYD-------------ERGIIFPQ------TIAPFQLSIIPVGYHKSQQVRT
SYP_NITMU       IVAAAIEQNHD-------------ERGIIFPA------AMAPFQVVIIPIGLKKNAEVRA
SYP_THIDA       IVAAAVEQNHD-------------GKGIVWPA------SMAPFSVVIVAIGYGKSASVKN
SYP_DECAR       IVGAAIEQGND-------------DKGIILPP------AIAPFEVCIVPMGYHKSEAVKA
SYP_XANAC       IVAAAIEQNHD-------------DAGIIWPA------PMAPWQVVVCVINPKQDPQVLA
SYP_XANC5       IVAAAIEQNHD-------------DAGIIWPA------PMAPWQVVVCVINPKQDPQVLA
SYP_XANOM       IVAAAIEQNHD-------------DAGIIWPA------PMAPWQVVVCVINPKQDAQVVS
SYP_XANOR       IVAAAIEQNHD-------------DAGIIWPA------PMAPWQVVVCVINPKQDAQVVS
SYP_XANC8       IVAAAIEQNHD-------------DAGIVWPA------PMAPWKVVVCVINPKQDAQVAA
SYP_XANCP       IVAAAIEQNHD-------------DAGIVWPA------PMAPWKVVVCVINPKQDAQVAA
SYP_XYLFA       IVAAAIEQNHD-------------VAGIIWPA------SIAPWQVAVCVINPKKDPVITA
SYP_XYLFT       IVAAAIEQNHD-------------VAGIIWPA------PIAPWQVAVCVINPKKDPVITA
SYP_BUCAI       IAAAVIEQHHD-------------KNGIIWPD------SIAPFEVVILPINMKKDNKIKI
SYP_BUCAP       IVASVIEQNYD-------------DNGIIWPD------SIAPFQVVILPLNTKNCIKIKE
SYP_BUCBP       IIAAIIEQNND-------------KNGIIWPD------SIAPFTIAIIPVCFHKSTLVKQ
SYP_BLOFL       IVPMVIEQHHD-------------KHGIIWPN------EIAPFKLAIIPINMYRFINVQN
SYP_BLOPB       IIAVIIEQNYD-------------KNGILWPD------VIAPFKLAIIPIDMYRSVNVRN
SYP_WIGBR       LVSTYIEQNYD-------------SNGIIWNE------EIAPFKVAIIPININFSIKVKN
                      :                   .             :     :             

SYP_AQUAE       VAEKLYLEAEEK---GIDVIFDDR--EESPGFKFADADLVGFPYRIVVGKK-VKEGKVEV
SYP_THEMA       VGEKIYQVLSEK---GEEVVLDDR--EVSPGFKFKDADLIGFPIRINVGRS-LKEGVVEL
SYP_BACSU       LAEKLYADLKAE---GYEVLYDDR--AERAGVKFADSDLIGLPIRITVGKR-ADEGIVEV
SYP_BACLD       LAEKLYEEFKAN---GYDVLFDDR--AERAGVKFADSDLIGLPIRITVGKR-ADEGVVEV
SYP1_BACAN      MGENIYNSLQEQ---GYEVLLDDR--AERAGVKFADADLFGLPVRVTVGKK-ADEGIVEV
SYP1_BACCZ      MGENIYNSLQEQ---GYEVLLDDR--AERAGVKFADADLFGLPVRVTVGKK-ADEGIVEV
SYP1_BACHK      MGENIYNSLQEQ---GYEVLLDDR--AERAGVKFADADLFGLPVRVTVGKK-ADEGIVEV
SYP1_BACC1      MGENIYNSLQEQ---GYEVLLDDR--AERAGVKFADADLFGLPVRVTVGKK-ADEGIVEV
SYP1_BACCR      MGENIYNSLQEQ---GYEVLLDDR--AERAGVKFADADLFGLPVRVTVGKK-ADEGIVEV
SYP_GEOKA       LAEEWYEKLGQA---GFEVLYDDR--PERAGVKFADSDLIGIPLRVTVGKR-AGEGVVEV
SYP_LISMF       FAETLYSSLQDA---GFSVLIDDR--AERAGVKFADADLIGLPIRITVGKK-AAEGVVEV
SYP_LISMO       FAETLYTSLQDA---GFSVLIDDR--AERAGVKFADADLIGLPIRITVGKK-AAEGVVEV
SYP_LISIN       FAESLYDSLQKA---GFSVLIDDR--TERAGVKFADADLIGLPIRITVGKK-AAEGIVEV
SYP_STAA3       LADALYAEFNT----KFDVLYDDR--QERAGVKFNDADLIGLPLRIVVGKR-ASEGIVEV
SYP_STAA8       LADALYAEFNT----KFDVLYDDR--QERAGVKFNDADLIGLPLRIVVGKR-ASEGIVEV
SYP_STAAC       LADALYAEFNT----KFDVLYDDR--QERAGVKFNDADLIGLPLRIVVGKR-ASEGIVEV
SYP_STAAM       LADALYAEFNT----KFDVLYDDR--QERAGVKFNDADLIGLPLRIVVGKR-ASEGIVEV
SYP_STAAN       LADALYAEFNT----KFDVLYDDR--QERAGVKFNDADLIGLPLRIVVGKR-ASEGIVEV
SYP_STAAW       LADALYAEFNT----KFDVLYDDR--QERAGVKFNDADLIGLPLRIVVGKR-ASEGIVEV
SYP_STAAS       LADALYAEFNT----KFDVLYDDR--QERAGVKFNDADLIGLPLRIVVGKR-ASEGIVEV
SYP_STAAR       LADALYAEFNT----KFDVLYDDR--QERAGVKFNDADLIGLPLRIVVGKR-ASEGIVEV
SYP_STAAB       LADALYAEFNT----KFDVLYDDR--QERAGVKFNDADLIGLPLRIVVGKR-ASEGIVEV
SYP_STAHJ       LGDQLYKELQQ----QYDVLYDDR--KDRAGVKFNDADLIGLPIRIVVGKN-ASEGIVEV
SYP_STAS1       LADQLYTQLKE----NYDVLYDDR--KERAGVKFNDADLIGLPVRVVVGKN-AAEGIVEV
SYP_STAES       LGDQLYQKLMD----SYDVLYDDR--KERAGVKFNDSDLIGLPVRVVVGKR-AEEGIVEV
SYP_STAEQ       LGDQLYQKLMD----SYDVLYDDR--KERAGVKFNDSDLIGLPVRVVVGKR-AEEGIVEV
SYP_BACHD       LADSVYHSLQQA---GLDVLLDDR--PERAGVKFKDADLIGLPLRVAVGKR-ADEGYVEV
SYP_BACSK       LAEQLYSDIRQA---GIDVLYDDR--PERAGVKFKDADLIGLPVRVAVGKR-AGEGIIEV
SYP_LACPL       VADQVEAQLEAA---GYNVLYDDR--KERPGVKFADSDLMGIPARITIGKK-ASEGIVEI
SYP_LACSS       LAEQIEGLLEEA---GYSVLVDDR--KERAGVKFADSDLIGLPIRITVGKK-AAEEIVEV
SYP_ENTFA       LSQEVEAMMTEA---GYEVLVDDR--NERAGVKFADADLIGCPIRITVGKK-AVDGVVEV
SYP_LACS1       LSEKVTAMLEDA---GYQVLVDDR--KERAGVKFADSDLIGLPIRITVGKK-ADEGIVEI
SYP_STRA3       LTEKIEADLMLK---GYEVLTDDR--NERVGSKFSDSDLIGLPIRVTVGKK-ASEGIVEV
SYP_STRA5       LTEKIEADLMLK---GYEVLTDDR--NERVGSKFSDSDLIGLPIRVTVGKK-ASEGIVEV
SYP_STRA1       LTEKIEADLMLK---GYEVLTDDR--NERVGSKFSDSDLIGLPIRVTVGKK-ASEGIVEV
SYP_STRP1       LTAKLEADLMAK---GYDVLTDDR--NERVGSKFSDSDLIGLPIRVTVGKK-AAEGIVEI
SYP_STRPM       LTAKLEADLMAK---GYDVLTDDR--NERVGSKFSDSDLIGLPIRVTVGKK-AAEGIVEI
SYP_STRP3       LTAKLEADLMAK---GYDVLTDDR--NERVGSKFSDSDLIGLPIRVTVGKK-AAEGIVEI
SYP_STRPF       LTAKLEADLMAK---GYDVLTDDR--NERVGSKFSDSDLIGLPIRVTVGKK-AAEGIVEI
SYP_STRP8       LTAKLEADLMAK---GYDVLTDDR--NERVGSKFSDSDLIGLPIRVTVGKK-AAEGIVEI
SYP_STRP6       LTAKLEADLMAK---GYDVLTDDR--NERVGSKFSDSDLIGLPIRVTVGKK-AAEGIVEI
SYP_STRPB       LTAKLEADLTAK---GYDVLTDDR--NERVGSKFSDSDLIGLPIRVTVGKK-AAEGIVEI
SYP_STRPC       LTAKLEADLTAK---GYDVLTDDR--NERVGSKFSDSDLIGLPIRVTVGKK-AAEGIVEI
SYP_STRPD       LTAKLEADLMAK---GYDVLTDDR--NERVGSKFSDSDLIGLPIRVTVGKK-AAEGIVEI
SYP_STRT1       LTDRLEAALAAE---GYDVLIDDR--NERVGSKFSDSDLIGLPIRVTVGKK-ASEGVVEV
SYP_STRT2       LTDRLEAALAAE---GYDVLIDDR--NERVGSKFSDSDLIGLPIRVTVGKK-ASEGVVEV
SYP_STRMU       LTAKVEESLVDA---HYSVLTDNR--NERIGSKFSDSDLIGLPIRVTVGKK-ASDGIVEV
SYP_STRPN       LTEKLEASLMGA---GYEVLTDDR--NERVGVKFSDSDLIGLPIRITVGKK-AADGIVEV
SYP_STRR6       LTEKLEASLMGA---GYEVLTDDR--NERVGVKFSDSDLIGLPIRITVGKK-AADGIVEV
SYP_LACLA       LTSELEEKLRGK---GYQVLVDDR--NERAGVKFADSDLIGLPVRVTIGKK-AAEGVVEV
SYP_LACAC       LAEKLEKKFSEK----YDVLYDDR--KERAGVKFADADLVGAPVRITIGKK-AADGIVEV
SYP_LACJO       LAEKLEKELSAK----YDVLYDDR--NERPGVKFNDADLVGAPLRITIGRK-AKDGIVEV
SYP_FUSNN       LAEKIYNELQEE---KIDVMLDDR--DEKPGFKFKDADLIGFPFKVVVGKR-ADEGIVEL
SYP_DEHM1       AAEKIYTELEAQ---GVEVLFDDR--ELTAGVKFNDADLLGIPLRLTISPRNLDKGGVEL
SYP_DEHMC       SAEKIYAELEAK---GIEVLFDDR--ELTAGVKFNDADLLGIPLRLTISPRNLDKGGVEF
SYP1_ANADE      AAEEVVAALGKE---GVEVLFDDR--DERAGVKFKDADLLGIPIRVAVGKKGLAAGNVEW
SYP_CARHZ       MAEEVYNLLLNA---GFEVVIDDR--DERPGVKFKDADLIGIPLRITVGKRTVSEGVYEV
SYP_MOOTA       VAEGLYRELAAA---GVEVVYDDR--DERAGLKFVEADLIGYPLRITVGKRTITSGTVDV
SYP_DESHY       TGEALYQELLKL---GVEAVLDDR--DERPGVKFKDADLVGYPLRVTVGSKTLANGEVEL
SYP_CLOAB       EAEKLYTELKKI---GVDALLDDR--NERAGVKFKDADLIGIPMRITVGKK-ISEGKVEF
SYP_CLOTE       AAEEIYNKLKSM---GVEVLLDDR--AERPGVKFKDADLIGIPIRVTVGKK-IKEGKVEY
SYP_CLOPE       KAEEIYNELRKM---GVEALLDDR--KERAGVKFKDSELMGIPMRITVGKM-IGEGQVEF
SYP_CALS4       IAEKIYNKLLEE---KLEVLIDDR--DVRAGVKFNDADLIGIPVRVTIGKK-VKEGIVEI
SYP_DESAG       RVDELYGAVQAA---GCDVLMDDR--NERPGVKFKDADLIGVPMQLVVGGKGLARGIVEA
SYP_DESVH       KAAEIESFLEAE---GHDVLLDDR--DERPGVKFKDADLIGSPYQLVLGGKGLARGVVEA
SYP_LAWIP       KASEIYQFFLSE---GIEVFLDDR--EERPGIKFNDADLLGFPIQVIIGAKSLANGIIEV
SYP_GEOMG       ACDELYRALTAV---GVEVLFDDR--DERPGSKFKDADLIGIPLRIVVGSKNLAEGKVEL
SYP_GEOSL       ACESLYLDLRAA---GVEVLFDDR--DERPGIKFKDADLIGIPLRLVVGSKNLADGKVEL
SYP_PELCD       AAENLYAELQAL---GVEVLLDDR--DERPGSKFKDADLIGIPLRLTVGARGLKENAVEL
SYP_DESPS       AAEKLYAELQAA---GLSVLLDDR--DERPGAKFKDADLLGIPYRLTVGKGLAKNGMVEV
SYP_SYNAS       TAERLYESLAGK---GAEVLLDDR--DERAGVKFKDADLIGIPIRVTVGPKKLAEGKVEV
SYP_MYCTU       GATALAADLDRL---GVEVLLDDR--QASPGVKFKDAELLGMPWIVVVGRGWA-DGVVEL
SYP_MYCBO       GATALAADLDRL---GVEVLLDDR--QASPGVKFKDAELLGMPWIVVVGRGWA-DGVVEL
SYP_MYCPA       GATALADDLDRL---GVEVLLDDR--QASPGVKFKDAELLGVPWIVVVGRGWA-DGVVEL
SYP_NOCFA       GAEQVVAGLDAQ---GLDVLFDDR--TASPGVKFKDAELLGMPWVVVIGRGWA-DGTVEL
SYP_COREF       AAERYATELSQA---GIDVLFDDRP-KVSPGVKFKDAELLGMPFALILGRGYA-DGTVEL
SYP_CORGL       AAERFAAELSAA---GLDVLFDDRP-KVSPGVKFKDAELLGMPFALILGRGYA-EGKVEL
SYP_CORDI       AGDALVAALDSH---GIEVLFDDRP-KVSPGVKFKDAELLGMPFVVVLGRAFK-DGNIEL
SYP_CORJK       AAVELVETLSND---GLEVLFDDRP-KVSPGVKFKDSELLGMPLVVVVGRGFA-DGKVEL
SYP_THEFY       VALRISQELVDR---GVRVLVDDRK-GVSPGVKFTDAELLGVPTVLIVGRGLA-NGVVEL
SYP_LEIXX       VAEQAVAQLEAV---GLDVLYDDRP-KVSPGVKFGDAELIGVPRVLVVGRGAA-QGEVEL
SYP_CUTAK       EATRIASELAEA---GLEVLLDDR--KASPGVKFADSEILGMPTSVVVGRGLK-DGLVEV
SYP_BIFLO       GAEKLVAELEAK---GLEVIYDDRK-KVSPGVKFKDAELIGVPLVAVVGRDYVNDGTIEL
SYP_STRCO       LALEVSDKLAAA---GVRVLVDDRA-GVSPGVKFTDAELIGVPQILVAGRRSG-EGVVEL
SYP1_STRAW      LALDVAEKLGAA---GVRVLVDDRA-GVSPGVKFTDAELIGVPQILVAGRRSA-EGVLEL
SYP_TROW8       ARAELIDSLTDC---GLDVLVDDR--RVSPGVKFTDAQLIGVPKIIVIGDKTR-GEDVEV
SYP_TROWT       ARAELIDSLTDC---GLDVLVDDR--RVSPGVKFTDAQLIGVPKIIVIGDKTR-GEDVEV
SYP_TREPA       AAEALYVQLRTR---GVEVLFDDR--AERPGVKFADADLIGIPLRVVLSAKTLPRVECTT
SYP_TREDE       EADRLYEECKKR---GIEALLDDR--KERTGVKFKDMDLIGIPIRLVVGEKNLPNIEFKL
SYP_LEPIC       KIEEFYNVLINE---GIEVFWDDR--DLGPGFKLKDSELIGFPIRITIGKKFFESGEISI
SYP_LEPIN       KIEEFYNVLMNE---GIEVFWDDR--DLGPGFKLKDSELIGFPIRITIGKKFFESGEISI
SYP_CHLTR       TALQLYQSLNTE---GFEPLLDDR--NERLGFKLKDSDLLGIPYKLIIGKS-FQSTGLLE
SYP_CHLTA       TALQLYQSLNTE---GFEPLLDDR--NERLGFKLKDSDLLGIPYKLIIGKS-FQSTGLLE
SYP_CHLMU       VASQFYQSLNTA---GFEPLLDDR--NERLGFKLKDSDLLGIPYKLIIGKS-FQKTGMLE
SYP_CHLCV       AAEKIYKDLQNY---GYAPLLDDR--NERLGFKLKDSDLIGIPYKLILGKT-FQNSGVLE
SYP_CHLFF       AAEKIYTELQNS---GYAPLLDDR--NERLGFKLKDSDLIGIPYKLILGKT-FLNSGTLE
SYP_CHLAB       AAEKIYKELQGY---GYAPLLDDR--NERLGFKLKDSDLIGIPYKLILGKT-FLNSGMLE
SYP_CHLPN       LAETIYHELQSQ---GYEPLLDDR--DERLGFKLKDSDLIGIPYKLILGKS-YQSSGIFE
SYP_NOSS1       IAEKLYTELNQS---GVETLLDDR--NERAGVKFKDADLIGIPYRIVTGRA-ITNGKVEI
SYP_TRIV2       IAERLYTELNQS---GVETLLDDR--NERAGVKFKDADLIGIPYRIVTGRA-ITNGKVEI
SYP_SYNP6       AAEKIYADLTAA---GIETLLDDR--DERAGVKFKDADLIGIPYRIVTGRS-LKEGKVEV
SYP_SYNE7       AAEKIYADLTAA---GIETLLDDR--DERAGVKFKDADLIGIPYRIVTGRS-LKEGKVEV
SYP_SYNY3       VAEQIYTEFQAA---EVDVLLDDR--NERAGVKFKDSELIGIPYRVVTGKS-LKQGQLEV
SYP_THEEB       AATDLYEQLQAA---GIEVLLDDR--DERAGVKFKDADLIGIPYRLVTGRA-IANGEVEL
SYP_SYNJA       VAEKLVQELAAA---GIETLWDDR--DERAGVKFKDADLIGIPYRLTTGRS-LKQGKVEL
SYP_SYNJB       VAEKLVQDLATA---GIETLWDDR--DERAGVKFKDADLIGIPYRITTGRS-LKQGKVEL
SYP_PROM9       LTEQIYNNFLVN---KIDVLLDDR--EDRAGVKFKDAELIGIPFQIIIGRD-SINNEVEL
SYP_PROMP       LTQEIYEEFISN---QIDVLLDDR--DDRAGVKFKDADLIGIPFQIIIGRD-SINKEVEF
SYP_PROMA       LGEKLYSQLKDE---GVDVLIDDR--KERAGVKFKDADLIGIPWKIISGRD-SATGIVEL
SYP_PROMT       LAEDIYQKLIQD---RVDVLLDDR--DERAGIKFKDADLIGIPWRIVAGRE-ASSGLVEL
SYP_SYNPX       LGDTVYATLLEA---GIDVLLDDR--KERAGVKFKDADLIGIPWRLVIGRD-AAEGTVEL
SYP_SYNS9       LGESLYKQLLAA---GVDALFDDR--KERAGVKFKDADLIGIPWRVVVGRD-ASDGVVEL
SYP_SYNSC       LGEALYAELQAA---DVDVLLDDR--KERAGVKFKDADLIGIPWRIVVGRD-ASEGIVEL
SYP_PROMM       LAEQLYSELQAA---DIEALLDDR--TERAGVKFKDADLIGIPWRVVVGRD-AAKGQVEL
SYP_GLOVI       AAEELYRSLTAA---GIDTLLDDR--PERAGVKFKDADLIGIPLRVTLGRD-LEAGLVEI
SYP_HELPY       LAFEVYERLLQK---GVDALLDDR--DARFGAKMRDFELIGERLALIIGKQTLESKEFEC
SYP_HELPJ       LAFEVYERLLQK---GVDALLDDR--DARFGAKMRDFELIGERLALIVGKQTLESKEFEC
SYP_CAMJE       FANKLYRDLTNL---GLEVLLDDR--NERFGVKMNDFELMGFPYALVIGKGLENN-EIEL
SYP_CAMJR       FANKLYEDLTNL---GLEVLLDDR--NERFGVKMNDFELMGFPYALVVGKGLEKN-EIEL
SYP_HELHP       FGSALYEILSAC---GIDVLLDER--DERFGVKMKDFELLGFHSALIVGKGLNEG-KVEL
SYP_WOLSU       YAENLYNALQKE---GIEVLLDDR--DERYGSKMADFELLGIPYAVIVGKGLIEG-QVEL
SYP_SHIBS       LAEKLYSELRAQ---GIEVLLDDRKE--RPGVMFADMELIGIPHTIVLGDRNLDNDDIEY
SYP_SHIFL       LAEKLYSELRAQ---GIEVLLDDRKE--RPGVMFADMELIGIPHTIVLGDRNLDNDDIEY
SYP_SHISS       LAEKLYSELRAQ---GIEVLLDDRKE--RPGVMFADMELIGIPHTIVLGDRNLDNDDIEY
SYP_ECOLI       LAEKLYSELRAQ---GIEVLLDDRKE--RPGVMFADMELIGIPHTIVLGDRNLDNDDIEY
SYP_ECO57       LAEKLYSELRAQ---GIEVLLDDRKE--RPGVMFADMELIGIPHTIVLGDRNLDNDDIEY
SYP_SHIDS       LAEKLYSELRAQ---GIEVLLDDRKE--RPGVMFADMELIGIPHTIVLGDRNLDNDDIEY
SYP_ECOL6       LAEKLYSELRAQ---GIEVLLDDRKE--RPGVMFADMELIGIPHTIVLGDRNLDNDDIEY
SYP_ECOUT       LAEKLYSELRAQ---GIEVLLDDRKE--RPGVMFADMELIGIPHTIVLGDRNLDNDDIEY
SYP_SALPA       LAEKLYSELRAQ---GIEVLMDDRKE--RPGVMFADMELIGIPHTIVIGDRNLDNDDIEY
SYP_SALTI       LAEKLYSELRAQ---GIEVLMDDRKE--RPGVMFADMELIGIPHTIVIGDRNLDNDDIEY
SYP_SALTY       LAEKLYSELRAQ---GIEVLMDDRKE--RPGVMFADMELIGIPHTIVIGDRNLDNDDIEY
SYP_SALCH       LAEKLYSELRAQ---GIEVLMDDRKE--RPGVMFADMELIGIPHTIVIGDRNLDNDDIEY
SYP_YERPE       LAEELYTTLRSH---GIDVILDDRKE--RPGVMFADMELIGVPHNIVIGDRNLDSEEVEY
SYP_YERPS       LAEELYTTLRSH---GIDVILDDRKE--RPGVMFADMELIGVPHNIVIGDRNLDSEEVEY
SYP_PECAS       VAEDIYQQLRAK---GIEVLLDDRKE--RPGVMFADMELIGVPHTIVIGDRNLDSEEIEY
SYP_SODGM       VAEDLYQQLQAR---GIDVLLDDRKE--RPGVMFADMELIGVPHQLVIGDRNLDTEEIEY
SYP_PHOLL       VAEKLYADLRAS---GIDVIFDDRKE--RPGVMFADMELIGVPHTVVIGDRNLDNGEVEY
SYP_HAEIN       YAEELYRTLQSQ---GVDVIFDDRKE--RPGVMFADMELIGVPHMVVIGEKNLDNGEIEY
SYP_HAEI8       YAEELYRTLQSQ---GVDVIFDDRKE--RPGVMFADMELIGIPHMVVIGEKNLDNGEIEY
SYP_MANSM       YAEELYQTLLAQ---GVEVIFDDRKE--RPGVMFADMELIGVPHMVIIGEKNLENGEIEY
SYP_HAEDU       FAEQLYTDLMAQ---GVDVILDDRKE--RPGVMFADMELIGVPHMIVIGEKNLENGEVEY
SYP_PASMU       FAEELYRTLTAQ---GVEVIFDDRKE--RPGVMFADMELIGVPHMIVIGEKNLEKGEIEY
SYP_BAUCH       VAEQLYNQLSIR---KIDVLLDDRKE--RPGVMFADIELIGIPHIIIIGDRNLAVQKIEY
SYP_VIBVU       AAEKLYAELTAM---GIEVLFDDRKE--RPGVMFSDMELIGIPHTIVIGDRSMDEGHFEY
SYP_VIBVY       AAEKLYAELTAM---GIEVLFDDRKE--RPGVMFSDMELIGIPHTIVIGDRSMDEGHFEY
SYP_VIBPA       AAEKLYAELTAM---GIEVLFDDRKE--RPGVMFSDIELIGIPHTIVIGDRSMDEGNFEY
SYP_ALIF1       AAEKLYAELTAM---GIEVLFDDRKE--RPGVMFKDIELIGIPHTIVIGDRSMDEGHFEY
SYP_VIBCH       AAEKLYAELTAA---GIEVLFDDRKE--RPGVMFSDMELIGVPHTIIIGDRSMDEGHFEY
SYP_PHOPR       AAESLYAELTAA---GIEVLFDDRKE--RPGVMFKDIELIGIPHTIVIGNRSLENGEMEY
SYP_SHEON       IAEQLYKDLSAA---GIDVLLDDRKE--RPGVMFADMELIGIPHTVVIGDRNIDAGVFEY
SYP_PSE14       ATDKLYAELTAA---GFEVLLDDRDKKTSPGIKFADMELIGIPHRIVVSDRGLAEGNLEY
SYP_PSEU2       ATDKLYADLTAA---GFEVLLDDRDKKTSPGIKFADMELIGIPHRIVVSDRGLAEGNLEY
SYP_PSESM       ATDKLYAELTAA---GFEVLLDDRDKKTSPGIKFADMELIGIPHRIVVSDRGLAEGNLEY
SYP_PSEF5       ATDKLYSELTAA---GFEVLLDDRDKKTSPGIKFADMELIGIPHRIVVSDRGLAEGNLEY
SYP_PSEPF       ATDKLYAELTAA---GFEVLLDDRDKKTSPGIKFADMELIGIPHRIVVSDRGLAEGNLEY
SYP_PSEPK       ATDKLYAELTAA---GYEVLLDDRDKKTSPGIKFADMELIGIPHRIVVSDRGLAEGNLEY
SYP_PSEAE       ATDKLYAELTAA---GFEVLLDDRDKKTSPGVKFADMELIGIPHRIVISDRGLSEGVLEY
SYP_CHRSD       YADTLYQQLSDA---GFDVLIDDRD--LRPGVKFADQELIGIPHRVVIGDRGLDNDELEY
SYP_PSYA2       TATALYDELKAL---GVNVLLDDR--NERPGVKFADLELIGIPHRIVVSDRNLAEDKYEY
SYP_PSYCK       TATALYEELKAL---GINVLLDDR--NERPGVKFADLELIGIPHRIVVSDRNLAEDKYEY
SYP_ACIAD       AAEALYAELQAQ---GYDVLLDDR--NERPGVKFSDLELTGIPHRIVIGEKGLDAGTFEY
SYP_HAHCH       KAESLYAELLQA---GVDVLLDDR--NERPGVKFAEMELIGIPHRVVISDRGLAEGKVEY
SYP_SACD2       KCEELYAQLNQL---GYDVLLMDEP-KARLGGMLADTELMGIPHRIVVGDRGLEKGQLEY
SYP_COLP3       TAEALYESLNQA---GIEVLFDDR--KERPGVMFADHELMGTPLLLIIGERNLDAQQIEL
SYP_IDILO       AAEKLYTDLKAQ---GIDVLFDDR--KERPGVMFTDMELIGIPHQVVVGERNLDENQVEY
SYP_PSEHT       IATNLYQGLKDA---GLDVLFDDR--KERPGVMFNDMELIGVPFTLVIGERNLDENKVEL
SYP_HYDCU       AVMTLYNELTAK---GIEVLLDDR--KERPGVMFNDMELIGIPHRIVIGERGLDKGEIEY
SYP_COXBU       ACEKLYNELIDA---GYEVLWDDRKE--RPGVMFADMDLIGIPHRLVISESGLDRGIVEY
SYP_NITOC       MSDRLYTELQAA---GFEVLLDDRQL--RPGVIFADMDLIGIPYRLVISERGLENNTVEY
SYP_METCA       TAERLYAELSAA---GFEVLYDDRKV--RPGVMFADMELIGIPHRIVISERGLDSGALEY
SYP_LEGPA       QAESLYQQLKSH---GIDVLLDDRNE--RAGVLFADNDLIGIPHRLVVSERNLEQGCIEY
SYP_LEGPL       QAESLYQQLKSH---GIDVLLDDRNE--RAGVLFADNDLIGIPHRLVVSERNLEQGCIEY
SYP_LEGPH       QAESLYQQLKSH---GIDVLLDDRNE--RAGVLFADNDLIGIPHRLVVSERNLEQGCVEY
SYP_FRATH       VADKLCQDLLGD---GIDVLLDDRGA--RPGVMFADADLIGYSHHVVIGDRLLEQGLIEY
SYP_FRATT       VADKLYQDLLGD---GIDVLLDDRGA--RPGVMFADADLIGYSHHVVIGDRLLEQGLIEY
SYP_BORBR       TALALYEALRAR---GVDVMLDDRDS--RPGVMFAEWELIGVPLRVTVGERGLNEGVVEL
SYP_BORPE       TALALYEALRAR---GVDVMLDDRDS--RPGVMFAEWELIGVPLRVTVGERGLNEGVVEL
SYP_BORPA       TALALYEALRAR---GVDVMLDDRDS--RPGVMFAEWELIGVPLRVTVGERGLNEGVVEL
SYP_BORA1       KSEALYQALREQ---GIDVILDDRDA--RPGVMFAEWELIGVPLRVTIGDRGLNDGVIEL
SYP_AROAE       EATKLYETLCAG---GIDVILDDRDE--RPGVMFADWELIGVPHRVVIGDRGLKDGMAEY
SYP_RHOFT       ASDKLYAELLAA---GVDVILDDRGE--RPGAMFADWELIGVPHRVTIGDRGLKAGEVEY
SYP_BURP1       AADKLYADLAAA---GIDVILDDRGE--RPGVMFADWELIGVPHRLVIGERGLKDGKIEY
SYP_BURPS       AADKLYADLAAA---GIDVILDDRGE--RPGVMFADWELIGVPHRLVIGERGLKDGKIEY
SYP_BURMA       AADKLYADLAAA---GIDVILDDRGE--RPGVMFADWELIGVPHRLVIGERGLKDGKIEY
SYP_BURTA       AADKLYADLAAA---GIDVILDDRGE--RPGVMFADWELIGVPHRLVIGERGLKDGKIEY
SYP_BURL3       TADKLYAELVAA---GIDVILDDRGE--RPGVMFADWELIGVPHRLVIGERGLKEGKIEY
SYP_CUPPJ       EADRIHAELLAA---GVDVIIDDRGE--RPGVMFADWELIGVPHRVVVGDRGLKEGKVEY
SYP_CUPMC       EADRIHAELLAA---GVDVILDDRGE--RPGVMFADWELIGVPHRVVVGDRGLKEGKVEY
SYP_RALSO       EADRLHAELAAA---GIDVILDDRGE--RPGAMFADWELIGVPFRVVVGERGLKDGKLEL
SYP_CHRVO       AADKLYADLQAR---GVDVMLDDRGE--RPGAMFADWELIGAPHRVTIGDRGLKEGKVEY
SYP_NEIMA       AADKIYAELLAA---GADVLLDDRDE--RAGVLLNDSELLGIPHRIVIGDRALKEGNVEY
SYP_NEIMB       AADKIYAELLAA---GADVLLDDRDE--RAGVLLNDSELLGIPHRIVIGDRALKEGNVEY
SYP_NEIG1       AADRIYAELLAA---GADVLLDDRDE--RAGVLLNDSELLGIPHRIVIGDRALKEGNVEY
SYP_NITEU       EAEKLYQACRSA---GIEVLLDDREE--RPGVMFADQELIGIPHRIVIGERNLREGMVEY
SYP_NITMU       EAEKLYATLSSV---GIEVLLDDRDD--RPGVMFADMELIGIPHRVVVGERGLKEGNAEY
SYP_THIDA       AADTLYADLMAV---GVEVLLDDRDE--RPGVMFADAELVGIPHRVTLGERGLNEGVVEY
SYP_DECAR       SADQLYADLKKI---GVDVVLDDRNE--RPGVMFADMELIGIPHRVVIGERGLKDGLFEY
SYP_XANAC       AAQALLDQLLAA---GLDAALDDRGL--RPGAMFADMELLGIPHRVVVSERGLAAGTFEY
SYP_XANC5       AAQALLDQLLAA---GLDAALDDRGL--RPGAMFADMELLGIPHRVVVSERGLAAGTFEY
SYP_XANOM       AAQALLDELIAA---GLDAALDDRGL--RPGAMFADMELLGIPHRVVVSERGLAAGTFEY
SYP_XANOR       AAQALLDELIAA---GLDAALDDRGL--RPGAMFADMELLGIPHRVVVSERGLAAGTFEY
SYP_XANC8       AAGDLLEELIAA---GIDAALDDRGL--RPGAMFADMELLGVPHRVVVSERGLAAGTFEY
SYP_XANCP       AAGDLLEELIAA---GIDAALDDRGL--RPGAMFADMELLGVPHRVVVSERGLAAGTFEY
SYP_XYLFA       AAEVLLAELQSA---DVDTVLDDRGL--RPGVMFADMELIGIPHRIVVSERGLAAGTYEY
SYP_XYLFT       AAEMLLAELQSA---DVDTVLDDRGL--RPGVMFADMELIGIPHRIVVSERGLAAGTYEY
SYP_BUCAI       IAHFLYKKFKK---TGIDVILDDR--DERPGVMFNEVDLIGIPHQIIISKRSINYDNVEY
SYP_BUCAP       ITENLYKILKK---EKIDVILYDR--NERPGIMFNQIDLIGIPHQIIISPRHINENKVEY
SYP_BUCBP       QSEKIYNFCKK---NNIDALLDDR--KQNLSITLSEIELIGIPYSIIISEKLLKNDMVEY
SYP_BLOFL       TAEELYTQLSSIPVIGFDILLDDR--KENPGIMFTDIDLLGIPHILIISERNLNNQEVEY
SYP_BLOPB       IAEKIYTQLLS--VIGIDILIDDR--KEYPGTMFADIDLIGIPHILIISDRSLANQEVEY
SYP_WIGBR       FSEEIYYKLCN---LKIDVLFYDN--VERPGIMFSNIELIGIPHILIISDKNLKNSIIEY
                                      :.      .  : : :: *       .           

SYP_AQUAE       QSRHTGEKW-----DVEIEKAIDFVKEKIEEDKK-----------------------
SYP_THEMA       KKRYSKELV-----KVNIKNGFGALLETLEKMKREYDPKEAVR--------------
SYP_BACSU       KIRQTGEST-----EISVDELSAFISKQ-----------------------------
SYP_BACLD       KIRKTGESF-----EIAADELFDFIEKQVKSLSSHS---------------------
SYP1_BACAN      KVRATGESE-----EVKVEELQTYIANILK---------------------------
SYP1_BACCZ      KVRATGESE-----EIKVEELQTYIANILK---------------------------
SYP1_BACHK      KVRATGESE-----EVKVEELQTYIANILK---------------------------
SYP1_BACC1      KVRATGESE-----EVKVEELQTYIANILK---------------------------
SYP1_BACCR      KVRATGESE-----EVKVEELQTYIANILK---------------------------
SYP_GEOKA       KVRKTGETF-----DVPVSELVDTARRLLQS--------------------------
SYP_LISMF       KIRKTGEMI-----EVRQDELLNTLPILFGDK-------------------------
SYP_LISMO       KIRKTGEMI-----EVRQDELLNTLPILFGDK-------------------------
SYP_LISIN       KIRKTGEMI-----EVRQDELLNTLPILFGDK-------------------------
SYP_STAA3       KERLTGDSE-----EVHIDDLMTVITNKYDNLK------------------------
SYP_STAA8       KERLTGDSE-----EVHIDDLMTVITNKYDNLK------------------------
SYP_STAAC       KERLTGDSE-----EVHIDDLMTVITNKYDNLK------------------------
SYP_STAAM       KERLTGDSE-----EVHIDDLMTVITNKYDNLK------------------------
SYP_STAAN       KERLTGDSE-----EVHIDDLMTVITNKYDNLK------------------------
SYP_STAAW       KERLTGDSE-----EVHIDDLMTVITNKYDNLK------------------------
SYP_STAAS       KERLTGDSE-----EVHIDDLMTVITNKYDNLK------------------------
SYP_STAAR       KERLTGDSE-----EVHIDDLMTVITNKYDNLK------------------------
SYP_STAAB       KERLTGDSE-----EVHIADLMTVITNKYDNLK------------------------
SYP_STAHJ       KVRQTGESE-----EVHINDLNTHIATLYSNL-------------------------
SYP_STAS1       KRRDTGESE-----DVHVDNLINYVNTLYSNI-------------------------
SYP_STAES       KQRINGLSE-----EVQIDELEYYLQELFKNIK------------------------
SYP_STAEQ       KQRINGLSE-----EVQIDELEYYLQELFKNIK------------------------
SYP_BACHD       KVRKTGEVI-----EVHADELVPTIQAKLQQLAE-----------------------
SYP_BACSK       KVRKTGEQL-----ELTASELVRWLNDFLRE--------------------------
SYP_LACPL       KLRQTGETL-----EVKQEEIANNLAVLLKNID------------------------
SYP_LACSS       KLRKTGETL-----EVKKDELINSLSILLASEK------------------------
SYP_ENTFA       KIKRTGEML-----EVRKEELESTLSILMNTTSEVE---------------------
SYP_LACS1       KLRQNGEKI-----EVKLEELLNSVKILFNETITD----------------------
SYP_STRA3       KIKASGDTI-----EVHADNLIETLEILTKK--------------------------
SYP_STRA5       KIKASGDTI-----EVHADNLIETLEILTKK--------------------------
SYP_STRA1       KIKASGDTI-----EVHADNLIETLEILTKK--------------------------
SYP_STRP1       KIKATGDSI-----EVNAENLIETLEILTKEH-------------------------
SYP_STRPM       KIKATGDSI-----EVNAENLIETLEILTKEH-------------------------
SYP_STRP3       KIKATGDSI-----EVNAENLIETLEILTKEH-------------------------
SYP_STRPF       KIKATGDSI-----EVNAENLIETLEILTKEH-------------------------
SYP_STRP8       KIKATGDSI-----EVNAENLIETLEILTKEH-------------------------
SYP_STRP6       KIKATGDSI-----EVNAENLIETLEILTKEH-------------------------
SYP_STRPB       KIKATGASI-----EVNAENLIETLEILTKEH-------------------------
SYP_STRPC       KIKATGASI-----EVNAENLIETLEILTKEH-------------------------
SYP_STRPD       KIKATGDSI-----EVNAENLIETLEILTKEH-------------------------
SYP_STRT1       KIKATGDTI-----EVNADNLIETLAILTTEQDA-----------------------
SYP_STRT2       KIKATGDTI-----EVNADNLIETLAILTTEQDA-----------------------
SYP_STRMU       KIKSTGDTI-----EVNAENLLETLSILID---------------------------
SYP_STRPN       KIKATGDTI-----EVHADNVLETLEILSKK--------------------------
SYP_STRR6       KIKATGDTI-----EVHADNVLETLEILSKK--------------------------
SYP_LACLA       KIRATGEVV-----EINKDELVNTIEILSK---------------------------
SYP_LACAC       KRPTDEKAV-----EMSIDELDKFVNQELG---------------------------
SYP_LACJO       KRPMDEKAT-----EVNISDLDAVITKELG---------------------------
SYP_FUSNN       KIRRTGETL-----EVSQNEVIAKIKELMRIY-------------------------
SYP_DEHM1       KLRRNKESE-----LVPLESIMERVITCIKSQSDL----------------------
SYP_DEHMC       KLRRNKESE-----LVPLDSIVERVIATIKSESDL----------------------
SYP1_ANADE      KLRRGGAVE-----LVPLGEVARKAAEAVRAATT-----------------------
SYP_CARHZ       KIRRTREEK-----VFQKEELVDGLRQLLKTL-------------------------
SYP_MOOTA       KWRSRKEET-----PLPLEGLSAQIQALLAREMEKYR--------------------
SYP_DESHY       RDRKTGEVQ-----LVKVEELAGRIQGMIREALNIG---------------------
SYP_CLOAB       KCRNSEEVE-----VIDLDKVIARVEEEFEKNNLALK--------------------
SYP_CLOTE       KLRKEEDLE-----ILNIEQVYDKVREEFEKSSLKL---------------------
SYP_CLOPE       KLRNGGEVE-----TLSIEEVYNRVREEFERANLSL---------------------
SYP_CALS4       KLREREEVE-----EVKVEEVVKRVKQIVEEKLRELS--------------------
SYP_DESAG       KDRRTGEKT-----ELPVDGFAQAFAAWRRQVLQGWGL-------------------
SYP_DESVH       KNRRSGEKT-----ELPVEGFAEAFRDWRAGVLKGWGL-------------------
SYP_LAWIP       KNRKTGEKS-----SFSLERFFTDFYSWRDTVYVTWGLS------------------
SYP_GEOMG       KSRKGGEVS-----LLPLAEAVETVKGLVVAALNQ----------------------
SYP_GEOSL       KSRRTGEVE-----LLPLAGAVEKVRNIVAEALGR----------------------
SYP_PELCD       QERAGGERR-----MLPLAEAAALVRDMVVEACGR----------------------
SYP_DESPS       RRRRDGHTE-----EMTPEVAADFLARCIQAELTD----------------------
SYP_SYNAS       RLRDTGETS-----DVQVDSVEKMILRVIEGKMSESYLIF-----------------
SYP_MYCTU       RDRFSGQTR-----ELVAGASLATDIAAAVTG-------------------------
SYP_MYCBO       RDRFSGQTR-----ELVAGASLATDIAAAVTG-------------------------
SYP_MYCPA       RDRFAGQTR-----ELATGPSLAADIAAALRG-------------------------
SYP_NOCFA       RNRFTGEAE-----NVPAAEAVAT-VVARIRG-------------------------
SYP_COREF       RVR-GGEKT-----ELPVDEAVETIVRLVNEARG-----------------------
SYP_CORGL       RVR-GGEKS-----ELDADQAVAQIVEMVAQARN-----------------------
SYP_CORDI       RER-GQETV-----LVSADEIVDTVVAKLNR--------------------------
SYP_CORJK       RNRLTGETY-----EVDYTDALPEAKRALRGEARP----------------------
SYP_THEFY       RDRASGDRS-----EVSVDTVVDTIVNLVRG--------------------------
SYP_LEIXX       WDRRGGNHT-----TLPLSEAVAALTTSS----------------------------
SYP_CUTAK       RDRSTGENR-----QVSVAEAVCAVLKEVRG--------------------------
SYP_BIFLO       RDRNGENKV-----AVPAAEAADALAERFAALS------------------------
SYP_STRCO       KDRRTGERE-----EVTVEEALTRLTS------------------------------
SYP1_STRAW      KDRKTGERE-----ELTVEEAIARLSA------------------------------
SYP_TROW8       WDRANDQRT-----VLPLKEMIQGVIQR------------SDTGGCTERCTGVCPTR
SYP_TROWT       WDRANDQRT-----VLPLKEMIQGVIQGVIQGVIQGVIQGGDTGGDTGGDTGGCTER
SYP_TREPA       RCGAHTY-------FFTQEEASEHIARLLEQLASPESS-------------------
SYP_TREDE       RKAVESS-------LVDKDKVVDLVEKTVKEELAKLN--------------------
SYP_LEPIC       YNRKKDQEDSF--VFSGFDDLVARVESMRQELFTELR--------------------
SYP_LEPIN       YNRKKDQEDSF--VFSGFDDLVARVESMRQELFTELR--------------------
SYP_CHLTR       IESRSGEKC-----NVSPENLLDWCSKNLPCHTRKIPPLREQN--------------
SYP_CHLTA       IESRSGEKC-----NVSPENLLDWCSKNLPCHTRKIPPLQEQN--------------
SYP_CHLMU       IESRSGEKY-----NISPENLLDWCSKNLPCHTRKIPPIRE----------------
SYP_CHLCV       IESRSREKF-----FVEPKDFFNWCKNYFP-KPRGFSPIS-----------------
SYP_CHLFF       IESRSGEKF-----SVQPKDFVHWCENYLP-QSQKLSSAS-----------------
SYP_CHLAB       IESRSIEKF-----SVEPKDFVHWCKRHLP-SPRVFSPIP-----------------
SYP_CHLPN       IESRSGEKY-----TVSPEAFPTWCQNHLA---------------------------
SYP_NOSS1       VERATRQSQ-----EIPIDEVITTLQQWIRAAIEQKN--------------------
SYP_TRIV2       VERATRQSQ-----EIPIDEVITTLQQWIKAAIEQKN--------------------
SYP_SYNP6       VQRASKESS-----VIAVGSVVETVQDWIAAAIV-----------------------
SYP_SYNE7       VQRASKESS-----VIAVGSVVETVQDWIAAAIV-----------------------
SYP_SYNY3       VKRADKSVQ-----NLAIAAVVPTLTAWIKAEKKTS---------------------
SYP_THEEB       IIRATGAKS-----TLPLTEVVRYLQKEIAQQLAP----------------------
SYP_SYNJA       AERATGQAV-----EIPIEEVVATLKERIAAALAVPD--------------------
SYP_SYNJB       TERASGQAT-----EIPIEEVVTTLKERIEAALAVPD--------------------
SYP_PROM9       ICRTNNTKF-----KISAHKLLETFISESEIMYNKNS--------------------
SYP_PROMP       FSRSSKSKI-----KIASKNLLEKFISESKVMYNKNS--------------------
SYP_PROMA       VERSTGISK-----SLKAEEAIKELLEEISNYKKSILQESL----------------
SYP_PROMT       HNRKTKITE-----LLDLNSVFKKLSEEFNTEKL-----------------------
SYP_SYNPX       VQRSNREMR-----KLPHGEAIGELLKALRP--------------------------
SYP_SYNS9       VERANRAVQ-----KLPHADALKELLRTLRP--------------------------
SYP_SYNSC       VRRSSREVR-----KLPHAEAVSCLIKALHP--------------------------
SYP_PROMM       IQRSSRKVQ-----ILSAKQAFTALVKDIAANQNTRV--------------------
SYP_GLOVI       KVRGGGAAE-----KVPLAEALAQIKGLIERLNSAQHSR------------------
SYP_HELPY       IKRANLEKQ-----TIKDIELEEKILEMLESE-------------------------
SYP_HELPJ       IKRANLEKQ-----TIKDIELEEKILEMLASE-------------------------
SYP_CAMJE       IQREGLVKE-----LIKTDELMEILKKKVL---------------------------
SYP_CAMJR       IQREGLIKE-----LIKTDELMEILKKKVL---------------------------
SYP_HELHP       IKREGLKKY-----ELCATDKEILLEEILKIIA------------------------
SYP_WOLSU       VNRANLQKG-----IVLADD---ILGRILEL--------------------------
SYP_SHIBS       KYRRNGEKQ-----LIKTGDIVEYLVKQIKG--------------------------
SYP_SHIFL       KYRRNGEKQ-----LIKTGDIVEYLVKQIKG--------------------------
SYP_SHISS       KYRRNGEKQ-----LIKTGDIVEYLVKQIKG--------------------------
SYP_ECOLI       KYRRNGEKQ-----LIKTGDIVEYLVKQIKG--------------------------
SYP_ECO57       KYRRNGEKQ-----LIKTGDIVEYLVKQIKG--------------------------
SYP_SHIDS       KYRRNGEKQ-----LIKTGDIVEYLVKQIKG--------------------------
SYP_ECOL6       KYRRNGEKQ-----LIKTGDIVDYLVKQIKG--------------------------
SYP_ECOUT       KYRRNGEKQ-----LIKTGDIVDYLVKQIKG--------------------------
SYP_SALPA       KYRRSGEKS-----LIKTGDIVDYLVKAIKG--------------------------
SYP_SALTI       KYRRSGEKS-----LIKTGDIVDYLVKAIKG--------------------------
SYP_SALTY       KYRRSGEKS-----LIKTGDIVDYLVKAIKG--------------------------
SYP_SALCH       KYRRSGKKS-----LIKTGDIVDYLVKAIKG--------------------------
SYP_YERPE       KNRRVGEKQ-----MIKTSEIVEFLLSQIKR--------------------------
SYP_YERPS       KNRRVGEKQ-----MIKTSEIVEFLLSQIKR--------------------------
SYP_PECAS       KNRRVGEKQ-----MIKTSEIIDFLLANIIR--------------------------
SYP_SODGM       KNRRSGEKR-----MIKLSAIVDFLVSEIATAK------------------------
SYP_PHOLL       KHRRNDEKQ-----MLKLDNVVDYLKQQLGC--------------------------
SYP_HAEIN       KNRRTGEKE-----MISKDKLLSVLNEKLGNL-------------------------
SYP_HAEI8       KNRRTGEKE-----MISKDKLLSVLNEKLGNL-------------------------
SYP_MANSM       KNRRTSEKQ-----MIAKDQLLDFLKANVNV--------------------------
SYP_HAEDU       KNRRTGEKT-----MIAKDQLLAYLAQNVRA--------------------------
SYP_PASMU       KYRRSGEKE-----MIAKDQLLDVLKAKFAS--------------------------
SYP_BAUCH       KNRSNGEKK-----LMNLSIIVDWIVAKLNS--------------------------
SYP_VIBVU       KNRRSGEKT-----PVAMADIVEHIKAQLK---------------------------
SYP_VIBVY       KNRRSGEKT-----PVAMADIVEYIKAQLE---------------------------
SYP_VIBPA       KNRRTGEKT-----PVAMADIVEHVKSQLK---------------------------
SYP_ALIF1       KNRRANTKE-----AVEMANIVEHIKAQLS---------------------------
SYP_VIBCH       KNRRQGEKE-----AVAMESIIDFIQAKLA---------------------------
SYP_PHOPR       KDRRDGNKV-----AVPVADVVEMIKQKLA---------------------------
SYP_SHEON       KNRRTGEKQ-----DVPFDQIVDFLKNLQA---------------------------
SYP_PSE14       KSRTESQPQ-----AIAVADVLSFIQGKVNR--------------------------
SYP_PSEU2       KSRTESQPQ-----AIAVADVLSFIQGKVNR--------------------------
SYP_PSESM       KSRTESQPQ-----AIAVADVLSFIQGRVKR--------------------------
SYP_PSEF5       KSRTEAEAQ-----ALPVADVLSFLQARIRR--------------------------
SYP_PSEPF       KSRTEGQAQ-----ALPVADVLSFLQARIRR--------------------------
SYP_PSEPK       KHRTEQDAQ-----ALPLNEVLTFLQARVRR--------------------------
SYP_PSEAE       KGRRDSESQ-----NLPIGELMSFITEKLSR--------------------------
SYP_CHRSD       KGRRDSDVT-----MVPTEGLLSFLRERITK--------------------------
SYP_PSYA2       INRRDTEKQ-----LLSRDEVLAKVSSK-----------------------------
SYP_PSYCK       VNRRDSEKQ-----LLSRDEVIAKVSGK-----------------------------
SYP_ACIAD       KGRTDAESV-----NLTKDELLAKLK-------------------------------
SYP_HAHCH       KGRRDTDST-----DMTVDTVVNFIKEKLKK--------------------------
SYP_SACD2       KCRRDSDSQ-----DIAVDDIIEFINNAVKTGK------------------------
SYP_COLP3       KNRITGEKS-----LIAIDEVMSLFN-------------------------------
SYP_IDILO       QSRKGGEKQ-----KINLDDCISFIQQQL----------------------------
SYP_PSEHT       KNRRTGEKL-----MIDIDTAIDAIKAAVKG--------------------------
SYP_HYDCU       KHRRDEKSQ-----DIPEAEFMEFLLGKLSGN-------------------------
SYP_COXBU       KARKSKEAE-----NVSLENVLSVFR-------------------------------
SYP_NITOC       KRRQDGKTC-----AIQLDNFISGLKAELKAPISRR---------------------
SYP_METCA       KGRRDADNQ-----SIGIDGVIEFLRERSESR-------------------------
SYP_LEGPA       KSRTSSETQ-----LINLDKVVNFIIELINK--------------------------
SYP_LEGPL       KSRTSSETQ-----LINLDKVVNFIIELINK--------------------------
SYP_LEGPH       KARISSETQ-----LINLDKVVNFIIELINK--------------------------
SYP_FRATH       KNRKTQEKQ-----EITIAELIKLLK-------------------------------
SYP_FRATT       KNRKTQEKQ-----EITIAELIKILK-------------------------------
SYP_BORBR       QARRE--AE---AAKVPVDQALAQTLAKLDLL-------------------------
SYP_BORPE       QARRE--AE---AAKVPVDQALAQTLAKLDLL-------------------------
SYP_BORPA       QARRE--AE---AAKVPVDQALAQTLAKLDLL-------------------------
SYP_BORA1       QGRRD--TE---TVKISVDSALKEILNKLETL-------------------------
SYP_AROAE       QGRRD--AE---AAKIPLAELAAFVGSKLRPTA------------------------
SYP_RHOFT       QHRRD--SA---ATTVGVTAIFSLLQAKLKA--------------------------
SYP_BURP1       QGRRD--AE---ATLLPADSAAAAVAEKVRAALAR----------------------
SYP_BURPS       QGRRD--AE---ATLLPADSAAAAVAEKVRAALAR----------------------
SYP_BURMA       QGRRD--AE---ATLLPADSAAAAVAEKVRAALAR----------------------
SYP_BURTA       QGRRD--AE---ATLLPADSAATAVAEKVRAALAR----------------------
SYP_BURL3       QGRRD--AE---ATLLPADAAAATVAEKIRAALAR----------------------
SYP_CUPPJ       QGRRD--AQ---ATQV----AVADVVGHVRGQIGK----------------------
SYP_CUPMC       QGRRD--AQ---ATPV----AVADVVAHVRGQLAA----------------------
SYP_RALSO       QGRRD--EA---AAAV----APADVLATLKSRLAQ----------------------
SYP_CHRVO       QHRRD--SE---ATAVAADAILEHVLSKLA---------------------------
SYP_NEIMA       AERRD--NE---AQAIAIGEIVARVTASLNA--------------------------
SYP_NEIMB       AERRD--NE---AQAVAIGEIVARVTASLNA--------------------------
SYP_NEIG1       AERRG--NE---AQAVAIGEIVARVTASLNA--------------------------
SYP_NITEU       QGRLDKTPQ-----MLSLSEAASII-SKICGD-------------------------
SYP_NITMU       RGRRDEKSE-----VVPLPEIADFIKSKLAGG-------------------------
SYP_THIDA       QPRRAAPEQGADARKIAVAEAKAFLMGVLGD--------------------------
SYP_DECAR       KSRIDAEPT-----MVAQTDIVTLLQGKLCAA-------------------------
SYP_XANAC       RARTA---------DAAESLDKAGLFSRLGH--------------------------
SYP_XANC5       RARTA---------DAAESLDKAALFSRLGH--------------------------
SYP_XANOM       RARTA---------AAAENLDKAGLFSRLGR--------------------------
SYP_XANOR       RARTA---------AAAENLDKAGLFSRLGR--------------------------
SYP_XANC8       RARTA---------ESAENLDKAGLFSRLGN--------------------------
SYP_XANCP       RARTA---------ESAENLDKAGLFSRLGN--------------------------
SYP_XYLFA       RARHT---------AMVENLDKTTLLMRIKA--------------------------
SYP_XYLFT       RARRT---------AMVENLDKTTLLTRIKA--------------------------
SYP_BUCAI       RERKNKENI-----LINIKDIKNFIIQKLKK--------------------------
SYP_BUCAP       RERKNNKST-----LIKVKEITYFLKKKLNLI-------------------------
SYP_BUCBP       RERHKNVKK-----IINKNHVFKIILNNSLK--------------------------
SYP_BLOFL       KYRKTGIIQ-----KIKLNLIIQFLTEKLMNN-------------------------
SYP_BLOPB       KYRKKNKIE-----KIKLEMLIRYLIEKIVSS-------------------------
SYP_WIGBR       KNRITGDKL-----MINYKYIFDFLLQFNINFNF-----------------------