CLUSTAL format seed alignment for MF_01570

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

SYP_ANAMM       ----MRLSECYVPTMKDVSSDVVVASHKYSLRAGLVRQNASGLYTWLPLGLKVLRTIERI
SYP_ANAPZ       ----MRLSEFYSPTVKNVSSDVVSASHKYSIRAGIVSQTASGIYTLLPLGLMVLRKVENI
SYP_EHRCJ       ----MRLSNYYIPTLKETSADVSVVSHKYSIRAGLIKQIASGIYTWLPLGLRVLRNIENI
SYP_EHRCR       ----MRLSDYYVPTLKETSADISVISHKYSIRAGLIKQIASGIYTWLPLGLKVLKNIENI
SYP_EHRRG       ----MRLSKYYIPTLKETPTDVSVTSHVYSLRSGLIRQVASGIYAWLPLGLKVLKNIENV
SYP_EHRRW       ----MRLSKYYIPTLKETPADVSVTSHVYSLRSGLIRQVASGIYAWLPLGLKVLKNIENV
SYP_WOLPM       ----MRLSKYYLPTLKEKPAHAKIISHQYSLRAGLIKQIASGIYTWLPLGLLVLKNIEDI
SYP_WOLTR       ----MRLSQYYLPTLKEKPAHARIISHQYSLRAGLIKQIASGIYTWLPLGLRVLKNIEGI
SYP_RHOPA       ----MRLSRFFLPILKENPKEAEIVSHRLMLRAGMLRQEAAGIYAWLPLGHRVLKKIEQI
SYP_RHOP2       ----MRLSRFFLPILKENPKEAEIVSHRLMLRAGMLRQEAAGIYAWLPLGHRVLKKIEQI
SYP_RHOPB       ----MRLSRFFLPILKETPKEAEIVSHRLMLRAGMMRQEAAGIYAWLPLGLRVLKKIEQI
SYP_BRADU       ----MRLSRFFLPILKENPKEAEIVSHRLMLRAGMIRQEAAGIYAWLPLGFRVLKKIEQI
SYP_NITWN       ----MRLSRFFLPILKETPKEAEIVSHRLMLRAGMIRQEAAGIYAWLPLGLRVLKKIEAI
SYP_CAUVC       ----MRSSRYFLPVLKEAPSDAQIVSHQLMLRAGMIRQEAAGIYAWLPLGLRVLNKIEQI
SYP_RHORT       ----MRLSRFLLPTLKETPSEAEIVSHRLMLRAGMIRQHASGIYNWLPLGLRVLRKIEQV
SYP_RHIEC       ----MRLSRYFMPILKENPKEAEIVSHRLMLRAGMIRQQSQGIYSWLPLGKRVLDKVNAI
SYP_RHIL3       ----MRLSRFFMPILKENPKEAEIVSHRLMLRAGMIRQQSQGIYSWLPLGKRVLDKVNAI
SYP_RHIME       ----MRLSRFFMPILKENPKEAEIVSHRLMLRTGMVRQQSAGIYTWLPLGKRVLDKVNAI
SYP_AGRFC       ----MRLSRYFLPILKENPKEAEIVSHRLMLRAGMIRQQSAGIYSWLPLGKRVLDKVNKI
SYP_BARHE       ----MRLSQYFLPLLKENPKEAEIISHRLMLRAGMIRQQTSGIYSWLPLGKKVLDKICKI
SYP_BARQU       ----MRLSQYFLPLLKENPKEAEIISHRLMLRAGMIRQQTSGIYSWLPLGKKVLDKVCKI
SYP_BRUA2       ----MRLSRYFLPILKENPKEAEIVSHRLMLRSGMIRQQSAGIYSWLPIGLKVLNKVCTI
SYP_BRUAB       ----MRLSRYFLPILKENPKEAEIVSHRLMLRSGMIRQQSAGIYSWLPIGLKVLNKVCTI
SYP_BRUME       ----MRLSRYFLPILKENPKEAEIVSHRLMLRSGMIRQQSAGIYSWLPIGLKVLNKVCTI
SYP_BRUSU       ----MRLSRYFLPILKENPKEAEIVSHRLMLRSGMIRQQSAGIYSWLPIGLKVLNKVCTI
SYP_RHILO       ----MRLSRYFLPILKENPREAEIVSHRLMLRAGMIRQQGQGSFSWLPLGKRVLDKVCQI
SYP_ROSDO       ----MRLTRYFMPVLRENPAEAQIVSHRLMLRAGMIKQNAAGIYSWLPLGFKVLRKLENI
SYP_RUEPO       ----MRLSRYFLPVLKENPAEAQIVSHRLMLRAGMIKQAQAGIYSWLPLGFKVLRKLENI
SYP_JANSC       ----MRLSRYFLPVLKETPAEAQIVSHRLMLRAGMIKQASAGIYSWLPLGYKVLKRIERI
SYP_RHOS4       ----MRLSRYFLPVLKENPSEAQIVSHRYMLRAGMIKQQAAGIYSWLPLGFKVLKRIEQI
SYP_ZYMMO       ----MRLSRYFLPVMKETPADAQIISHKLMLRAGMIRQTAAGIYAWLPLGLRVLRRIEKI
SYP_GLUOX       ----MRLTKAFQPTLKEVPAEAQIASHRLMLRAGLVRQTASGIYAWLPAGLRVLRNIEQI
SYP_PELUB       ----MYISKSFIPILKNNPSEAKIKSHQLMLRVGMIKQSSAGIYSWLPLGFKVMKKIEQI
SYP_RICPR       ----MLLSKYFLPILKEEPSEAKVISHKLMLRSGMIMKQAAGLYTWLPLGLKVLKNIENV
SYP_RICTY       ----MLLSKYFLPILKEEPSEAQVISHKLMLRSGMIMKQASGLYTWLPLGLKVLKNIENI
SYP_RICCN       ----MLLSKYFLPVLKEEPSEAQVTSHKLMLRSGMIRQQAAGIYTWLPLGLKVLKNIENI
SYP_RICFE       ----MLLSKYFLPVLKEEPSEAQVTSHKLMLRSGMIRQQAAGIYTWLPLGLKVLKNIENI
SYP_RICBR       ----MLLSKYFLPVLKEDPSEAQITSHKLMLRSGMIRQQAAGIYSWLPLGLKVLKNIENI
SYP_NEOSM       MKNKTRVSEYYLPLMKNVSGEVKLRSHKYSLRAGLVKQCGAGLYSWLPLGLKVLRNIESV
                       :    * ::: . .    **   :* *:: :   * :  ** *  *:  :  :

SYP_ANAMM       VREEMDSSGFLEILMPSVQPADLWRESLRYDSYGPEMLRMQDRSGREMVFGPTHEEAISD
SYP_ANAPZ       IREEINAVGFSEILMPTMQPADLWKESQRYDSYGQELIRIHDRGGREMVLGPTHEEVVTD
SYP_EHRCJ       VREEMNKSGALEVLMPLIQPASLWKESGRYDDYGSEMLRITDRNQREMLFGPTHEEVITD
SYP_EHRCR       VREEMNKSGSLEILMPLIQPASLWKESGRYDDYGSEMLRITDRNQREMLFGPTHEEVITD
SYP_EHRRG       IKEEMNKSGILEVLMPLIQPASLWQESGRYNDYGSEMLRIKDRNNREMVFGPTHEEVVTD
SYP_EHRRW       IKEEMNKSGILEVLMPLIQPASLWQESGRYNDYGSEMLRIKDRNNREMVFGPTHEEVVTD
SYP_WOLPM       IRDEMNKSGAIEALMPCVQPASLWRESGRYDDYGKEMLRIKDRHEEDMLFGPTHEEIATD
SYP_WOLTR       IRDEMNKSGAIEALMPCVQPASLWRESGRYDDYGKTMLRIRDRHEEDMLFGPTHEEVATD
SYP_RHOPA       VREEQNRAGAIELLMPTLQLADLWRESGRYDAYGPEMLRIADRHKRELLYGPTNEEMITE
SYP_RHOP2       VREEQNRAGAIELLMPTLQLADLWRESGRYDAYGPEMLRISDRHKRELLYGPTNEEMITE
SYP_RHOPB       VREEQNRAGAIECLMPTLQLADLWRESGRYDAYGPEMLRITDRHKRELLYGPTNEEMITE
SYP_BRADU       VREEQDRSGALELLMPTLQLADLWRESGRYDAYGPEMLRIADRHKRELLYGPTNEEMITE
SYP_NITWN       VREEQNRAGAIELLMPTLQLADLWRESGRYDAYGPEMLRIQDRHKRELLYGPTNEEMITE
SYP_CAUVC       VREEMDRAGAIELLMPTIQLADLWRESGRYDDYGDEMLRITDRHKRELLFGPTAEEVVTD
SYP_RHORT       VREEQDATGAQEILMPTIQSADLWRESGRYDDYGKEMLRIVDRHERDMLYGPTHEEVATD
SYP_RHIEC       IREEQNRAGAIELSMPTLQSAELWQESGRYDAYGKEMLRIKDRQDRPMLYGPTNEEMVTD
SYP_RHIL3       IRDEQNRAGAIELSMPTLQSAELWQESGRYDAYGKEMLRIKDRQDRPMLYGPTNEEMVTD
SYP_RHIME       IREEQNRSGAIELLMPTLQSAELWQESGRYDAYGKEMLRIKDRQDRPMLYGPTNEEMITD
SYP_AGRFC       IREEQNRAGAIELLMPTLQTAELWQESGRYDDYGKEMLRIKDRQDRQMLYGPTNEEMITD
SYP_BARHE       IREEQERAGAIEILMPTIQSADLWRESDRYDDYGLEMLRIKDRQKRDLLYGPTNEEMVTD
SYP_BARQU       IREEQERAGAVEILMPTVQSADLWRESGRYDDYGLEMLRIKDRQKRDLLYGPTNEEMVTD
SYP_BRUA2       IREEQNRAGANEILMPTIQSADLWRESGRYDAYGKEMLRIQDRQKREMLFGPTNEEMVTD
SYP_BRUAB       IREEQNRAGANEILMPTIQSADLWRESGRYDAYGKEMLRIQDRQKREMLFGPTNEEMVTD
SYP_BRUME       IREEQNRAGANEILMPTIQSADLWRESGRYDAYGKEMLRIQDRQKREMLFGPTNEEMVTD
SYP_BRUSU       IREEQNRAGANEILMPTIQSADLWRESGRYGAYGKEMLRIQDRQEREMLFGPTNEEMVTD
SYP_RHILO       IREEQNRAGALEILMPTIQSADLWRESGRYNDYGKEMLRIKDRQDRDMLYGPTNEEMVTE
SYP_ROSDO       VHEEQIRAGHVPMLMPTMQSADLWRESGRYDAYGPEMLRIRDRQDRDMLFGPTNEEMITD
SYP_RUEPO       VHEEQIRAGHIPMLMPTLQSADLWRESGRYDDYGQEMLRITDRHGRDMLFGPTNEELITD
SYP_JANSC       VHEEQIRAGHIPMLMPTLQSADLWQKSGRFDAYGPEMLRLKDRHDRDMLYGPTNEEMITD
SYP_RHOS4       VHEEQIRAGHIPLLMPTLQPADLWRESGRYDDYGEEMLRITDRHKRDMLYGPTNEEMITD
SYP_ZYMMO       IREEQARAGALELLMPTLQTADLWRESGRYDAYGPEMLRIKDRHNRELLYGPTNEEMITA
SYP_GLUOX       IREEQDAIGAQEVLMPTLQSAELWRRSGRYDAYGPEMLRIQDRHGRDLLYGPTNEEMITD
SYP_PELUB       VREEQNKIGAQEILMPTIQPSDIWKESGRYDDYGDEMLRIKDRQGREMLYGPTNEELVTD
SYP_RICPR       VRSNMNKVGALEVLMPCIQPAHLWIESGRFEHYGKEMLKFQDRHDNTLLFGPTNEDMITD
SYP_RICTY       VRSNMNKVGALEVLMPCIQPAHLWIESGRFEYYGKEMLKFQDRHDNTLLFGPTNEDMITD
SYP_RICCN       VRLNMNKAGALEVLMPCIQPAHLWMESGRFDNYGKEMLKFQDRHDNTLLFGPTNEDMITD
SYP_RICFE       VRSNMNKAGALEVLMPCIQPAHLWMESGRFDNYGKEMLKFQDRHDNTLLFGPTNEDMITD
SYP_RICBR       VRSNMDKAGCLEVLMPCIQPAHLWVESGRFDNYGKEMLKFQDRHDNTLLFGPTNEDMVTD
SYP_NEOSM       IRQELDSMGMHEMLMPCIQLAKLWEESGRYSDYGKELLKFKDRHDNELLFGPTNEEVITA
                :: :    *     ** :* : :* .* *:  **  :::: **  . :: *** *:  : 

SYP_ANAMM       VVRSSLKSYRDLPINLYQIQWKFRDELRPRHGIMRGREFLMKDAYSFDVDFEGVMRSYEN
SYP_ANAPZ       LVRSSLKSYRDLPVNLYQIQWKFRDELRPRNGILRSREFLMMDAYSFDTDFEKAMKTYDA
SYP_EHRCJ       TLRTTLTSHKNLPITLYQIQWKFRDELRPRYGIMRCREFLMKDAYSFDKDLSGAILSYNL
SYP_EHRCR       ILRTTPVSHKDLPLILYQIQWKFRDELRPRYGIMRCREFLMKDAYSFDKDFSGAISSYNL
SYP_EHRRG       LLRTTLTSYKNLPLILYQVQWKFRDELRPRYGIMRCREFLMKDAYSFDKDFNSAIESYNL
SYP_EHRRW       LLRTTLTSYKNLPLILYQVQWKFRDELRPRYGIMRCREFLMKDAYSFDKDFNSAIESYNL
SYP_WOLPM       LIRDVVKSYKDLPLCLYQIQWKFRDEVRPRYGVMRGREFLMKDAYSFDVDYEGALNSYNL
SYP_WOLTR       LIRDIVKSYKNLPLCLYQIQWKFRDEVRPRYGVMRGREFLMKDAYSFNVNYESALNSYNL
SYP_RHOPA       IFRAYIKSYKSLPLNLYHIQWKFRDEQRPRFGVMRGREFLMKDAYSFDVDEAGARKSYNK
SYP_RHOP2       IFRAYVKSYKSLPLNLYHIQWKFRDEQRPRFGVMRGREFLMKDAYSFDVDEAAARKSYNR
SYP_RHOPB       IFRAYVRSYKNLPLNLYHIQWKFRDEQRPRFGVMRGREFLMKDAYSFDIDEAAARKSYNR
SYP_BRADU       IFRAYVKSYKNLPLNLYHIQWKFRDEQRPRFGVMRGREFLMKDAYSFDLNEAAARVAYNK
SYP_NITWN       IFRGYIRSYKSLPLNLYHIQWKFRDEQRPRFGVMRGREFLMKDAYSFDIDEAGARRSYNR
SYP_CAUVC       IFRASIKSYKDLPKNLYNIQWKFRDERRPRFGVMRGREFLMKDAYSFDLDADGARKSYNR
SYP_RHORT       VFRKNVKSYRALPQNLYQIQWKFRDEVRPRFGVMRGREFLMKDNYSFDLTYEGARHSYNK
SYP_RHIEC       IFRSSVKSYKDLPLNLYHIQLKFRDEIRPRFGTMRSREFMMKDAYSFDLTREGAEHSYNK
SYP_RHIL3       IFRSSVKSYKDLPLNLYHIQLKFRDEIRPRFGTMRSREFMMKDAYSFDLTREAAEHSYNK
SYP_RHIME       IFRSYVKSYRNLPLNLYHIQLKFRDEIRPRFGTMRSREFLMKDAYSFDLDRAGAEHAYNK
SYP_AGRFC       IFRSYVKSYKNLPLNLYHIQLKFRDEVRPRFGTMRSREFLMKDAYSFDLTKEDAIHSYNK
SYP_BARHE       IFRSYIRSYKDLPLNLYHIQWKFRDEIRPRFGVMRSREFLMKDAYSFDLDYEGSKISYNR
SYP_BARQU       IFRSYVHSYKDLPLNLYHIQWKFRDEIRPRFGVMRSREFLMKDAYSFDLDYEGSKTSYNR
SYP_BRUA2       IFRSYVRSYKDLPLNLYHIQWKFRDEVRPRFGVMRSREFLMKDAYSFDLDYEGAKMAYYR
SYP_BRUAB       IFRSYVRSYKDLPLNLYHIQWKFRDEVRPRFGVMRSREFLMKDAYSFDLDYEGAKMAYYR
SYP_BRUME       IFRSYVRSYKDLPLNLYHIQWKFRDEVRPRFGVMRSREFLMKDAYSFDLDYEGAKMAYYR
SYP_BRUSU       IFRSYVRSYKDLPLNLYHIQWKFRDEVRPRFGVMRSREFLMKDAYSFDLDYEGAKMAYYR
SYP_RHILO       IFRAYVKSYKDLPLNLYHIQWKFRDEVRPRFGVMRSREFLMKDAYSFDLDFEGARSAYNR
SYP_ROSDO       IFRSHVSSYKDLPLTLYHIQWKFRDEMRPRFGVMRGREFFMKDGYNFDLTKEDALHAYNR
SYP_RUEPO       IFRGHVSSYKDLPLTLYHIQWKFRDEIRPRFGVMRGREFLMKDGYNFDLTKEDALHAYNR
SYP_JANSC       MVGTFVTSYKSLPLTLYHIQWKFRDEVRPRFGVMRGREFLMKDGYNFDLTKEAALHAYNR
SYP_RHOS4       IFRSHVSSYKDLPLTLYHIQWKFRDEIRPRFGVMRGREFLMKDGYNFDLDYESAIHAYNR
SYP_ZYMMO       LIRDNLQSYRDLPRIFYHIQWKFRDEVRPRFGVMRGREFLMKDAYSFDIDETAGRHNYNR
SYP_GLUOX       IFGSSVKSYKELPKALYHIQWKFRDEVRPRFGVMRGREFLMKDAYSFDASYEGAVASYRR
SYP_PELUB       IFRSSVKSYKSLPQLLYHIQWKFRDEVRPRFGIMRGREFYMKDAYSFDVNDEDATFSYNK
SYP_RICPR       IFRRNIKSYKDLPKNLYHIQWKFRDEIRPRFGVMRGREFLMKDAYSFDINQKNAVNTYNK
SYP_RICTY       IFRRNIKSYKDLPKNLYHIQWKFRDEIRPRFGVMRGREFLMKDAYSFDINQENAVNTYNK
SYP_RICCN       IFRHNIKSYKDLPKNLYHIQWKFRDEIRPRFGVMRGREFLMKDAYSFDINEENAVKTYNQ
SYP_RICFE       IFRHNIKSYKDLPKNLYHIQWKFRDEIRPRFGVMRGREFLMKDAYSFDINEENAVKTYNQ
SYP_RICBR       IFRNNIKSYKDLPKNLYHIQWKFRDEIRPRFGVMRGREFLMKDAYSFDIDEESAVKTYNQ
SYP_NEOSM       IVRDDLASYKQLPKILYHIQWKFRDEIRPRFGLMRAREFLMKDAYSFDVDQQSARISYNK
                 .     *:: **  :*::* ***** *** * :* *** * * *.*:         *  

SYP_ANAMM       VFSAYFRIFRRLGLVPIAAKADSGAIGGSISHEFHVLVPTG-ESTVYHDKKALDLS----
SYP_ANAPZ       VFRAYRKAFKRMNLQTIALKADMGAIGGSVSHEFHVLTPTG-ESTVYYDERALELS----
SYP_EHRCJ       MFKTYIKIFKNLGLTPIAVKAESGPIGGNLSHEFHVLANSG-ESTLYYDQEIIELM----
SYP_EHRCR       MFKTYIKIFQKLGLTPIAVKADSGPIGGNLSHEFHVLANSG-ESTLYYDQDIIELM----
SYP_EHRRG       MFKVYIQIFRRLGLTPIAVKADSGPIGGNLSHEFHILANSG-ESTLYYDQDIINLI----
SYP_EHRRW       MFKVYIQIFRRLGLTPIAVKADSGPIGGNLSHEFHILANSG-ESTLYYDQDIINLI----
SYP_WOLPM       MYKTYIKIFKRMGFTPIGVGADTGPIGGNLSHEFHILANTG-ESTLYYDNKFSELL----
SYP_WOLTR       MYKTYIKIFKRMGLIPIGVRADTGLIGGNLSHEFHILASTG-ESTLYYDNKFFELL----
SYP_RHOPA       MFVAYLRTFARMGLKAIPMRAETGPIGGDLSHEFIVLAETG-ESGVYIDRDVLNLPVPDE
SYP_RHOP2       MFVAYLRTFARMGLKAIPMRAETGPIGGDLSHEFIVLAETG-ESGVYCDRDVLSLPVPDE
SYP_RHOPB       MFVAYLRTFARMGLKAIPMRAETGPIGGDLSHEFIVLAETG-ESGVFCDSDVLNLPVPGD
SYP_BRADU       MFVAYLRTFARMGLKAIPMRAETGPIGGDLSHEFIVLAETG-ESGVFINRDVLDLPVPGE
SYP_NITWN       MFVAYLRTFARMGLKAIPMRAETGPIGGDLSHEFIVLAETG-ESGVYIDKDVLDLPIPGT
SYP_CAUVC       MFVAYLNLFARMGLKAVPMRADTGPIGGDLSHEFIVLAETG-ESAVFCHKDLVEMPAPGP
SYP_RHORT       MFVAYLRTFARLGLKAIPMAADTGPIGGKLSHEFIILADTG-ESAVFCHRDLLDKPAP-E
SYP_RHIEC       MFAAYLRTFERLGLRAIPMRADTGPIGGNLSHEFIILADTG-ESEVFCHKDFVGFDIPGE
SYP_RHIL3       MFAAYLRTFDRLGLRAIPMRADTGPIGGKLSHEFIILADTG-ESEVFCHKDFVDFDVPGE
SYP_RHIME       MFAAYLRTFDRMGLRAIPMRADTGPIGGNLSHEFIILADTG-ESEVFCHKDFLGFDIPGE
SYP_AGRFC       MFVAYLRTFERLGLRAIPMRADTGPIGGNHSHEFIILADTG-ESEVFCHKSFLDRAIPAE
SYP_BARHE       MFVAYLRTFSCLGLKAIPMRADTGPIGGKLSHEFIILAETG-ESAIFCDKHFLELTVPDS
SYP_BARQU       MFVAYLRTFSCLGLKAIPMRADTGPIGGELSHEFIILAETG-ESAIFCDKKFFELTVPHS
SYP_BRUA2       MFVSYLRTFARVGLQAIPMRADTGPIGGDLSHEFIILAETG-ESQVYCDRAYLDLAVPGA
SYP_BRUAB       MFVSYLRTFARVGLQAIPMRADTGPIGGDLSHEFIILAETG-ESQVYCDRAYLDLAVPGA
SYP_BRUME       MFVSYLRTFARVGLQAIPMRADTGPIGGDLSHEFIILAETG-ESQVYCDRAYLDLAVPGA
SYP_BRUSU       MFVSYLRTFARVGLQAIPMRADTGPIGGDLSHEFIILAETG-ESQVYCDRAYLDLAVPGA
SYP_RHILO       MFVSYLRTFTRMGLQAIPMRADTGPIGGDLSHEFIILADTG-ESQVFCHRDYLSLAVPGA
SYP_ROSDO       HLVSYLRTYERMGLQAIPMRADSGPIGGDDTHEFLVLADTG-ESEVFYDSAVTDLTFGDR
SYP_RUEPO       HLVSYIRTYERMGLQAIPMRADSGPIGGDDTHEFLVLAETG-ESEVFYDSKVTDIRLGER
SYP_JANSC       HLVSYLRTYERMGLQAIPMRADSGPIGGDYTHEFLVLADTG-ESEVFYDAEITDLKFGDR
SYP_RHOS4       HMVSYLRTYERMGLQAIPMRAASGPIGGDNTHEFLVLASTG-ESEVFYDAAITDLKFGDR
SYP_ZYMMO       MFVAYLNSFSRLGLRAIPMQADTGPIGGDLSHEFIVLAPNG-ESDVFYHSNWE-QPTRHI
SYP_GLUOX       MMLSYLRIFQRLGVRAVPMVADTGPIGGDLSHEFLVLAPTG-ESAVFFDAALEEQDWLSR
SYP_PELUB       FFFSYLKTFKRLELSAIPMAADTGPIGGNLSHEFIILADTG-ESKIFTDKRVFDLGSEGT
SYP_RICPR       MYKAYMNTFRDLGVFAIPVIADNGPIGGNLSHEFHIVAETG-ESTIYYDKRFKILK----
SYP_RICTY       MYKAYINTFRDLGVFAIPVIADNGPIGGNLSHEFHIIAETG-ESTIYYDKRFKILK----
SYP_RICCN       MYKAYINAFRDLGVFVIPVIADNGPIGGNLSHEFHIIAETG-ESTIYYDKKFKTLK----
SYP_RICFE       MYQAYINTFRDLGVFAIPVIADNGPIGGNLSHEFHIIAETG-ESTIYYNKRFKTLK----
SYP_RICBR       MYKAYINTFRDLGVFAVPVIADNGPIGGKLSHEFHIIAETG-ESNIYYDKRFKTLK----
SYP_NEOSM       VYQSYLRIFKRLGLNPIPCRANAGVIGGSLNHEFHITTTEGGEGKIFYPEEMGELVDEFC
                    * . :  : .  :   *  * ***. .*** : .  * *. ::             

SYP_ANAMM       -------KNDYCTTEEIASVYAATEDAHDPQNC--GVDPNDLQVSKGIEVAHVFYLGDRY
SYP_ANAPZ       -------EMNDYGIEELKEVYAATDDMHDEKSC--GIAPEDLKTARGIEVGHIFYLDDRY
SYP_EHRCJ       -------NSDNIDIERIKNTYTAADDMHDPQTC--PIPPNNIKTSKGIEIGHIFYLGDKY
SYP_EHRCR       -------NSESIDVEKIKNTYTAADDMHDPQAC--PISSDKVKISKGIEIGHIFHLGDKY
SYP_EHRRG       -------NNDNIDIEKIKNTYTAADDLHNSETC--PIPASNIKTSKGIEIGHIFYLGDKY
SYP_EHRRW       -------NNDNIDIEKIKNTYTAADDLHNSETC--PIPASNIKKSKGIEIGHIFYLGDKY
SYP_WOLPM       -------ESE--DIESLKSIYAVADDMHDPETC--PISQEQLNVSKGIEIGHIFYFGDKY
SYP_WOLTR       -------ESE--DVKSLKSIYAVADDIHDPKTC--PVPQEQLNVSKGIEIGHIFYFGDKY
SYP_RHOPA       NVDY--DGDLTPIIKQWTSVYAATEDVHEPARYESEVPEANRLNTRGIEVGQIFYFGTKY
SYP_RHOP2       TVDY--DGDLTPIIKQWTSVYAATEDVHDAVRYESEVPEANRLHTRGIEVGQIFYFGTKY
SYP_RHOPB       DVDY--DGDLTPIIKQWTSVYAATEDVHDAERFEREVPADKKLNTRGIEVGQIFYFGTKY
SYP_BRADU       DVDY--ESDLTPIIKQWTSVYAATEDVHDAARFEQEVPEAKRLNTRGIEVGQIFYFGTKY
SYP_NITWN       EVDY--DGDLTPIVRQWTTAYAATEDVHDGPRYEREVPEERRVHTRGIEVGQIFYFGTKY
SYP_CAUVC       DLDWI-NGDLQPLVNQRTALYAATEEMHDEAAF-NALPEGDRLSARGIEVGHIFSFGTKY
SYP_RHORT       NVDY--DSDLQPLVDSWTSLYAATDEMH---RPDHGVPEGDLVSARGIEVGHIFHFGTKY
SYP_RHIEC       NTDFDSVEGLKAIFDKWTSLYAATSEMHDEAAF-NAVPEGDRLSARGIEVGHIFYFGTKY
SYP_RHIL3       HTDFDSVEGLQAIFDKWTSLYAATSEMHDEAAF-NAVPEGDRLSARGIEVGHIFYFGTKY
SYP_RHIME       DTNFDDVAGLKTIFDKWTSRYAATSEMHDEAAF-GAIAEGERLSARGIEVGHIFYFGTKY
SYP_AGRFC       STDFDDVAALQGVFDEWTADYAATSEMHDDAAY-DAIPEGERLSARGIEVGHIFYFGTKY
SYP_BARHE       SIDFSDKAILANIVKQWTSFYAATEEMHDEEEW-AKISDNNRLSARGIEVGHIFHFGTKY
SYP_BARQU       SIDFSDKAVLANIVKQWTSFYAATEEMHNEEEW-AKVSDNDRLSARGIEVGHIFHFGTKY
SYP_BRUA2       DTDFRNDAQLTDIVTRWTTPYAATDEMHDEADW-AKVKPESQVSARGIEVGHIFHFGTKY
SYP_BRUAB       DTDFRNDAQLTDIVTRWTTPYAATDEMHDEADW-AKVKPESQVSARGIEVGHIFHFGTKY
SYP_BRUME       DTDFRNDAQLTDTVTRWTTPYAATDEMHDEADW-AKVKPESQVSARGIEVGHIFHFGTKY
SYP_BRUSU       DTDFRNDAQLTDIVTRWTTPYAATDEMHDEADW-AKVKPESQVSARGIEVGHIFHFGTKY
SYP_RHILO       NTDFANDGEIADIVKTWTTPYAATDEMHDEAAW-EKVPESDKVSARGIEVGHIFHFGEKY
SYP_ROSDO       DIDYDSVEQCQGVMEEFTNLYARTDETHDQALF-AAIPAERQRQARGIEVGQIFYFGTKY
SYP_RUEPO       EIDYDSVDQCRAVMEEFTSLYARTDETHDEAVF-NQIPEERRRSARGIEVGQIFYFGTKY
SYP_JANSC       EIDYDDVAQCDAVLQEFTSRYARTDETHDEAEF-AAIPGDRQRSARGIEVGQIFYFGTEY
SYP_RHOS4       VVNYDDRAECEAIVKEWTAPYARTDETHDEAVF-GQIPEERRRSSRGIEVGQIFYFGTKY
SYP_ZYMMO       EADFDDPKALQSIVNDHISDYAATDEKRDPLRE-AQA-GDKLRQSRGIEVGHIFFFGTKY
SYP_GLUOX       PVDCDDAESLATFFATVTDHYAATDEKHDEAEW-AKVPAERKREGRGIEVGHIFYFGTKY
SYP_PELUB       VLDR---QSLQDLRKKYEQYYAVADEKFNKNEFEEKVSEENRLITKGIEVGHIFYFGDKY
SYP_RICPR       -------DNPDIDVEEIKGWYAAAEEKHDVNKLSSFPEGITR--SKGIEVGHIFYIGSKY
SYP_RICTY       -------DNPDIDVEEIKSWYAAAEEKHDVNKLSSFPEGITS--SKGIEVGHIFYIGSKY
SYP_RICCN       -------DNPDIDVEEIKSWYAAAEEKYEVNKLPISEQEITS--SKGIEVGHIFYIGSKY
SYP_RICFE       -------DNPNIDVEEIKSWYAAAEEKHDVNKLPISEQEITS--SKGIEVGHIFYIGSKY
SYP_RICBR       -------DNPDIDIEEIKSWYAAAEEKHDASKLSS-DKEITS--SKGIEVGHIFYIGTKY
SYP_NEOSM       KIDPSNEHAVSVMTEKLQELFCFTEECNSSGIG----NDNRICTAQGIEVGHIFLFGEKY
                                    :  :.:                   :***:.::* :. .*

SYP_ANAMM       SAPMNVKFHDKDGNS-AHALMGCYGIGISRLVAAIIEVFHDDVG--IRWPESIAPFKVGI
SYP_ANAPZ       SRTMNVKFCNTDGHSGTHVKMGCYGIGISRLIGALIEVFHDDAG--IKWPLSVAPFKVGI
SYP_EHRCJ       SKPMNANFCDNNDSK--PLQMGCYGIGISRLVAAIIEVFHDNKG--ITWPEEISPFKFSL
SYP_EHRCR       SKPMNANFCDSNNNK--LLQMGCYGIGVSRLVAAIIEVFHDNKG--IIWPETVAPFKFSL
SYP_EHRRG       SKTMNAAFSQNNETQ--LLHMGCYGIGVSRLVGAIIEVSHDNNG--IIWPEEIAPFKFSL
SYP_EHRRW       SKTMNAVFSQNNETQ--LLHMGCYGIGVSRLVGAIIEVSHDNNG--IIWPEEIAPFKFSL
SYP_WOLPM       SKPMKASVTSQDGKN-VNIHMGSYGIGVSRLVGAIIEAFHDDKG--IIWPEEVAPFRIGL
SYP_WOLTR       SKPMNAKVTAQDGKN-VNIHMGSYGIGVSRLVGAIIEAFHDDKG--ITWPEAVAPFRVGL
SYP_RHOPA       SDSMKANVTGPDGTD-APIHGGSYGVGVSRLLGAIIEACHDDNG--IIWPEAVAPFRVTI
SYP_RHOP2       SDSMKANVAGPDGTD-APIHGGSYGVGVSRLVGAIIEACHDDNG--IIWPEEVAPFRVAI
SYP_RHOPB       SDKMKALVAGPDGVD-VPVHGGSYGVGVSRLVGAIIEACHDENG--IKWPEEVAPFRAAI
SYP_BRADU       SEPMKAMVAGPDGVD-VPIHGGSYGVGVSRLLGAIIEACHDDAG--IKWPEAVAPFRAVV
SYP_NITWN       SESMKALVTGTDGVE-QPIHGGSYGVGVSRLVGAIIEACHDEAG--IKWPEAVAPFTVAI
SYP_CAUVC       SEPMKATVQGPDGQQ-VPVQMGSYGVGVSRLLGAIIEASHDEGG--IIWPESVAPFDVGI
SYP_RHORT       SAPMGATVTAPDGSS-QAVFMGSYGIGVSRLVAGIIEASHDDNG--IIWPDGVAPFDIGV
SYP_RHIEC       SEPMGAKVQGPDGKE-HFVHMGSYGIGPTRLVPAIIEASHDDNG--IIWPASVAPFDVVV
SYP_RHIL3       SEPMGAKVQGPDGKE-HFVHMGSYGIGPTRLVPAIIEASHDDNG--IIWPASVAPFDIVV
SYP_RHIME       SEAMGAKVLGPDGKE-HTVHMGSYGIGPTRLVPAIIEASHDDNG--IIWPKGIAPFDVVV
SYP_AGRFC       SEPMGAKVQGKDGKE-HPVHMGSYGIGPTRLVPAIIEASHDENG--IIWPASVAPFDVVI
SYP_BARHE       SAPMGAKVMGQDGKE-HLVSMGSYGIGPSRLVAAVIEASHDENG--IIWPKSIAPFDFGI
SYP_BARQU       SAPMGAKVMGQDGKE-HLVSMGSYGIGPSRLVAAVIEASHDENG--IIWPKSIAPFDFGI
SYP_BRUA2       SEPMGAKVQGPDGKE-HLVSMGSYGIGPSRLVAAAIEASHDDAG--IIWPKTIAPFGAGI
SYP_BRUAB       SEPMGAKVQGPDGKE-HLVSMGSYGIGPSRLVAAAIEASHDDAG--IIWPKTIAPFGAGI
SYP_BRUME       SEPMGAKVQGPDGKE-HLVSMGSYGIGPSRLVAAAIEASHDDAG--IIWPKTIAPFGAGI
SYP_BRUSU       SEPMGAKVQGPDGKE-HLVSMGSYGIGPSRLVAAAIEASHDDAG--IIWPKAIAPFGAGI
SYP_RHILO       SKPMGAKVTGPDGKD-HFASGGSYGIGPSRLVAAIIEASHDENG--IIWPDAVAPFDIGL
SYP_ROSDO       SDAMGAKVQGPDGKP-TAVHMGSHGIGVSRLVGAIIEASHDEKG--IIWPEGVTPFHCGI
SYP_RUEPO       SEPMGATVQGPDGKP-VPVHMGSHGIGVSRLIGAIIEASHDDKG--IIWPEGVTPFHCGI
SYP_JANSC       SEKLGAHVQNDEGER-VPLHMGSHGIGVSRLLGAIIEASHDDKG--IIWPEGVTPFHCGI
SYP_RHOS4       SEPMGANVVTADGSR-VPVHMGSHGIGVSRLLGAIIEASHDDKG--IIWPEGVTPFHAGI
SYP_ZYMMO       SKPMGFTLPGPDGKP-IPIQMGSYGIGISRLLGAIIEASHDDNG--IIWPEAVAPYHVGL
SYP_GLUOX       TASMGIEVSGPDGAP-FHPHMGSYGVGVSRLVGAIIEASHDDAG--IIWPASVAPYRAAI
SYP_PELUB       SKALNAAVDLPGGKK-DFVKMGSYGIGVSRLVGAIIEAKYDQKDEIMKWPFSVAPYELAI
SYP_RICPR       SVNMNALINDEYGKL-IPVEMSSYGIGISRLAAAIIEANCDKKG--IIWPCSVAPFKVSL
SYP_RICTY       SVNMNALINDEYGKL-IPVEMSSYGIGISRLAAAIIEANCDKKG--IIWPFSVAPFKVSL
SYP_RICCN       SVNMNALINDEYGKL-TPIEMSSYGIGISRLVAAIIEANCDEKG--IIWPSSVAPFKVSL
SYP_RICFE       SVNMNALINDEHGKL-TPVEMSSYGIGISRLVAAIIEANCNEKG--IIWPSNVAPFKVSL
SYP_RICBR       SVNMNALINDEHGKL-TPIEMSSYGIGISRLVAAIIEANSDAKG--IIWPIAVAPFKISL
SYP_NEOSM       SAPMQARFSGRDGKK-KNFYMGSYGIGISRLLAAIIEVHSDDKG--IIWPESIAPFKIGL
                :  :   .             ..:*:* :**  . **.  :  .  : **  ::*:   :

SYP_ANAMM       VNLL-TTNEDCKTTAETIYAAL-AD--SSLYDDSTDSPGVKLARMDLLGMPWQVIIGNSF
SYP_ANAPZ       VNLF-SKNEECKRVSERIHSVL-PN--DSLYDDRDDTPGVKLSRMDLIGLPWQVIVGNSF
SYP_EHRCJ       VNLY-SSNDKCIKVAENLHMQL-HN--DVLYDDTDDSPGIKLTRTDLLGMPWQIIIGKST
SYP_EHRCR       VNLY-TSNDKCKKVAENLHMQL-YD--DVLYDDTDDSPGIKLARTDLLGMPWQVIIGKST
SYP_EHRRG       VNVF-SANKECRNISENLYAKLDSN--DVLYDDTEDSTGIKFSRMDLLGMPWQVIIGKTT
SYP_EHRRW       VNVF-SANKECHNISENLYAKLGSN--DVLYDDTEDSTGIKFARMDLLGMPWQVIIGKTT
SYP_WOLPM       INLQ-TKVTE---AADKIYKALKSD--EVLYDDTEGSVGVKFSRMDLIGLPWQIIVGKKA
SYP_WOLTR       INLQ-TKTAEYVEIANKIYSTLKSD--EVLYDDTEGSIGVKFAKMDLIGLPWQIIVGKKA
SYP_RHOPA       LNLK-QGDAATDAACDQLYRELSAKGVDVLYDDTDQRAGAKFATADLIGIPWQIHVGPRG
SYP_RHOP2       LNLK-QGDAATDAACEQLYKELAAKGVDVLYDDTDQRAGAKFATADLIGIPWQVLVGPKG
SYP_RHOPB       LNLK-QGSADTDAACEALYKELSAKGVDVLYDDTDQRAGGKFATADLIGIPWQILVGPKG
SYP_BRADU       LNLK-QGDAAVDAACEKLYAELQAKGVDVLYDDTDQRAGAKFAAADLIGIPWQIMIGPKG
SYP_NITWN       LNLK-QGASDTDEACERIYRELSARGVDVLYDDTDQRAGAKFATADLIGSPWQVMVGPKG
SYP_CAUVC       VNMR-QGDAACDAACETAYNALKAAGREVLYDDTDARGGAKFATMDLIGLPWQLIVGPKG
SYP_RHORT       INLK-VGDAATDGVCADLYGRLRAAGKDVLFDDTDDRAGAKFATMDLIGLPWQVIAGPKG
SYP_RHIEC       INMK-VGDQACDDTCELIYAALKKAGKDVLYDDTDDRAGTKFATADLIGVPVQIIAGPRA
SYP_RHIL3       INMK-AGDQACDDTCELIYAALSKAGKDVLYDDTDDRAGTKFATADLIGVPVQIIAGPRA
SYP_RHIME       INMK-TGDEACDAACGKVYSDLGKAGFDVLLDDTDERAGGKFATADLIGVPVQVIVGPRS
SYP_AGRFC       INMK-AGDAACDAACEKLYYQLSNAGKDVLYDDTDDRAGQKFATADLIGVPVQIIVGPRS
SYP_BARHE       INMK-PDDEKCTHACETLYKGLRYAGFDPLLDDRNERPGSKFATMDLIGLPTQIIVGPKS
SYP_BARQU       INMK-PNDEKCTRACETLYSGLMQAGFDPLLDDRNERPGSKFATMDLIGLPTQIIVGPKS
SYP_BRUA2       VNMK-PGDEGCDGVSEKLYEALTNAGVDPLLDDKDERPGAKFATMDLIGLPTQVIVGPRG
SYP_BRUAB       VNMK-PGDEGCDGVSEKLYEALTNAGVDPLLDDKDERPGAKFATMDLIGLPTQVIVGPRG
SYP_BRUME       VNMK-PGDEGCDGVSEKLYEALTNAGVDPLLDDKDERPGAKFATIDLIGLPTQVIVGPRG
SYP_BRUSU       VNMK-PGDEGCDGVSEKLYEALTNAGVDPLLDDKDERPGAKFATMDLIGLPTQVIVGPRG
SYP_RHILO       INMK-VGDADCDRVSEELNAAFTAAGKDVLYDDTDQRPGGKFATADLIGLPWQVIVGPRG
SYP_ROSDO       VNLK-QGDTEADAACDALYASLRALGLDPLYDDRKERAGGKFATMDLIGLPWRITVGPRG
SYP_RUEPO       VNLK-QGDGEADAACDQLYAALSAIGLEPLYDDRNERAGGKFATMDLIGLPWRITVGPRG
SYP_JANSC       VNLK-QGDAEADAACEALETALENAGLEPLYDDRNERAGGKFATMDLIGLPWRITVGPRG
SYP_RHOS4       VNLK-QGDSSTDLACEALYRDLSARGLEPLYDDRDERAGAKFATMDLIGLPWRITVGPRG
SYP_ZYMMO       INLR-IDDENCRAIADSLYQRLEAAGIDTLYDDRNERGGAKFATMDLIGLPWQVVIGPKG
SYP_GLUOX       LNLR-QDDEACDAICDRIYGTDPE---NLLYDDRSERAGVKFNDADLMGHPWQIIVGPRG
SYP_PELUB       IPMINKNDTSALDKANKLFKHFESKNIDTIIDDMDENLSSKIKKFNLIGVPYQIILG-KN
SYP_RICPR       INLN-IHDNKCVELAAKTDKELSHQNIEVLYDDTDARPGSKFATHDLIGSPYQIIIGPKK
SYP_RICTY       INLN-IHDNKCVELAAKTDKELSNKNIEVLYDDTEARPGSKFATHDLIGSPYQVIIGPKK
SYP_RICCN       INLN-IHDSKCVELAEMAYKELSDKNIEVLYDDTEARPGSKFATHDLIGSPHQIIIGPKK
SYP_RICFE       INLN-IHDSKCVELAAKVYKELSAQNIEVLYDDTEARAGSKFATHDLIGSPYQIIIGPKK
SYP_RICBR       INLN-IHDSKCLELAERVYNELLAQNIEVLYDDTDVRAGSKFATHDLIGSPYQIIIGPKK
SYP_NEOSM       INLH----GESCGFAEEIFSKLDS----VIYDDTADSQGVKFARMDLIGVPFQIIVGKNG
                : :           .              : **     . *:   :*:* * ::  *   

SYP_ANAMM       VKDKVVELKNRANGATERCTVDA--LIARMQA------------------------
SYP_ANAPZ       IKDGVLELKNRATGDIELLSVDD--VVSRISV------------------------
SYP_EHRCJ       VEQDLIEVRNRSNKDKFLISVEQ--FLKKFKK------------------------
SYP_EHRCR       VEQDLIEVRNRLTKDKVLISTEQ--FLNKLKK------------------------
SYP_EHRRG       IEHGLIEVRQRSSKKSLLMSTEQ--FLNNFKKS-----------------------
SYP_EHRRW       IEHGLIEVRQRSSKKSLLMSTEQ--FLNNFKKS-----------------------
SYP_WOLPM       VSENIVEVKNRATGEVKEMQIEE--AINHFSAK-----------------------
SYP_WOLTR       VSENIIEIKNRATGKVEEVQIEE--AINYFNVK-----------------------
SYP_RHOPA       LAEGKVELKRRSDGARENLALAD--VVARLT-------------------------
SYP_RHOP2       LADGKIELKRRSDGSRENIALAE--TVARLAP------------------------
SYP_RHOPB       LAEGKVELKRRADGSRENVTPAE--AVARLTT------------------------
SYP_BRADU       LADGKVELKRRSDGSRETMSPAD--AVARLVG------------------------
SYP_NITWN       LAEGKVEIKRRGDGSRENVALED--AVARLMA------------------------
SYP_CAUVC       IAEGVVEIKHRKTGERHTASLES--VLDGLTKSKTT--------------------
SYP_RHORT       VAKGMVELKERATGERHELSIDS--ALAKLLG------------------------
SYP_RHIEC       VANGEVEVKDRKTGARETMTIEA--AINRFVA------------------------
SYP_RHIL3       VANGEVEVKDRKTGARETMTIEA--AINRFVA------------------------
SYP_RHIME       IANGEVEVKDRKTGARETMTVEA--AINKLVAAR----------------------
SYP_AGRFC       VANGEVEVKDRKTGERETVTIEA--AMNKALG------------------------
SYP_BARHE       VAQNEVEIKDRKTGIKKSLTVEN--VLNQFSVI-----------------------
SYP_BARQU       IAQNEVEIKDRKTGVKKSLTVEN--VLNQFFRI-----------------------
SYP_BRUA2       VAAGEVEVKDRKTGERQSLGIKA--AINMLTAQA----------------------
SYP_BRUAB       VAAGEVEVKDRKTGERQSLGIKA--AINMLTAQA----------------------
SYP_BRUME       VAAGEVEVKDRKTGERQSLGIEA--AINMLTAQA----------------------
SYP_BRUSU       VAAGEVEVKDRKMGERQSLGIEA--AINMLTAQA----------------------
SYP_RHILO       VAAGEVEIKNRRTGERETLPIAD--AKKRFGVAA----------------------
SYP_ROSDO       LKNGVVELTSRKTGESSELPPEE--AIEKIAKIYAPHHVSGNL-------------
SYP_RUEPO       LKNGVVELTSRKTGESVELSPEE--AVKKVADIYAPHHPHLSREEPMAGRSFHTWL
SYP_JANSC       LKNGVVELTSRRTGESEELTPDA--AVARVAEVYAAHKPVNAAV------------
SYP_RHOS4       ISAGKVELTNRRTGESEEMSSGA--AVDRLAQIYAGI-------------------
SYP_ZYMMO       AEKGVVELKNRANGEKQTISVEN--AFNLLTAGHQQR-------------------
SYP_GLUOX       AKEGKVELKQRATGERFELSVED--ALAKIGAA-----------------------
SYP_PELUB       SEDNLLEFKEIGKDPK-SLTLDQ--ITQILTEQKLKN-------------------
SYP_RICPR       AANNIVELKDRKTGVLEDIEVEN--IINYIKNIDSI--------------------
SYP_RICTY       AANNIVELKDRKTGVLEDIEIEN--LINYIRI------------------------
SYP_RICCN       AANNIVELKDRKSGVIEDIEVGS--LMSVL--------------------------
SYP_RICFE       AADDIVELKNRKIGVIEDIEVEN--LIHYIK-------------------------
SYP_RICBR       AANNIVELKNRKNGEIEDIDLNKRALNSYLTFFNS---------------------
SYP_NEOSM       PIHGTIELKYRLDSKRESRSLNE--LVSLFSHT-----------------------
                     :*.