CLUSTAL format seed alignment for MF_01571

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

SYP_DEIRA       ---MTKDGGKKDNQGQDKKAQQYGVTPQSVDFNDWYNEVVKKADLADN--SPVAGAMVVR
SYP_DEIGD       MPPMTKAEGK-----QDKKAQQYGVTPQSVDFNDWYNEVVKKADLADN--SPVAGAMVVK
SYP_THET8       ------------------MAKEKGLTPQSQDFSEWYLEVIQKAELADY--GPVRGTIVVR
SYP_THET2       ------------------MAKEKGLTPQSQDFSEWYLEVIQKAELADY--GPVRGTIVVR
SYP_MYCLE       -----------------MGCNKRGVTRQEDDFSAWYNEVVAKAGLIDR--GPAKGTMVIR
SYP_FRACC       ---------------------MAVLTSRSTDFPRWYQDVLAKAELADN--GPVRGTMVIR
SYP2_STRAW      ------------------MAKAPVLTPRADDFPRWYQDLINKAELADN--GPVRGTMVIR
SYP2_BACCZ      ----------------MAKEQVQAITKMEEDFAQWYTDIVKKAELVDY--SSVKGCMILR
SYP2_BACHK      ----------------MAKEQVQAITKMEEDFAQWYTDIVKKAELVDY--SSVKGCMILR
SYP2_BACC1      ----------------MAKEQVQAITKMEEDFAQWYTDIVKKAELVDY--SSVKGCMILR
SYP2_BACCR      ----------------MAKEQVQAITKMEEDFAQWYTDIVKKAELVDY--SSVKGCMILR
SYP2_BACAN      ----------------MAKEQVQAITKMEEDFAQWYTDIVKKAELVDY--SSVKGCMILR
SYP_OCEIH       -------------MGKKNKQFVEKITAMEDDFAQWYTDVVKQADLVDY--GQVRGTMIIK
SYP_ACESD       -------------MAKKDQEFVKDITNMDEDFPQWYTDVITKTDLVDY--SPVKGFMVIK
SYP_MYCGE       ------------------------MTKKTQDLTSWYDQLLVKAKLICH--GEVKGTVCFL
SYP_MYCPN       ------------------------MANKDQNLTLWYDQLLSKAQLVSY--GDVKGTNCFL
SYP_MYCGA       -----------------MAFKKNLASSKDDNISDWYTEVISKGNLIHY--SNIKGFMSFL
SYP_MYCPE       ---------------------MSKIVKQEENFSKWYTSIIENANLVDY--GLVKGTIMFK
SYP_UREPA       -----------------MSKKLEKITTRKENFADWYTSIVNNAKLIQY--TDIKGMMVFQ
SYP_MYCH2       ------------------MKKPEKITSRTANFAKWYVDVITQADLMNY--GPIKGTIYFK
SYP_MYCHJ       ------------------MKKPEKITSRTANFAKWYVDVITQADLMNY--GPIKGTIYFK
SYP_MYCH7       ------------------MKKPEKITSRTADFAKWYVDVITQADLMNY--GPIKGTIYFK
SYP_MYCPU       ------------------MKKLEKITPLEENFAKWYTDVVKNGELIDY--GPVKGTLIFK
SYP_MYCS5       ------------------MKQLEKITPLEKDFAQWYTDVVTNGNLMNY--GPAKGTIIYK
SYP_MYCMO       ----------------MNIKLLDKITPLEQDFAKWYTDVITKGNLATY--GVLKGNIVFM
SYP_MYCCT       -----------------MKKQLNKITPRNIDFSQWYTDIVLNTKLASY--GPVKGTMIFR
SYP_MYCMS       -----------------MKKQLDKITPRNIDFSQWYTDIVLNTKLASY--GPVKGTMIFR
SYP_MESFL       ------------------MKQLEKITPRDVDFSQWYTDTVINAKLASY--GPVKGTIIFR
SYP_AYWBP       ---------------MKTMKRVKTVATRLSDFGKWYTDICLKAELIAY--SEAKGFIIYL
SYP_ONYPE       ---------------MKTMKRVKTVTARSSDFGKWYTDVCLKAELIAY--SEAKGFIIYL
SYP_BORBU       --------------------MSDFIASKEDDYSKWYLDIVQKAKLADY--SPVKGCMVIM
SYP_BORBP       --------------------MSDFIASKEDDYSKWYLDIVQKAKLADY--SPVKGCMVIM
SYP_BDEBA       ------------------MADTAITPTRSQNYPEWYQQVIVAADMAEN--SPVRGCMVIK
SYP_RHOBA       ----------MRGDRMSKAPRTAISPTREENYPEWYQQVIRAADLAEN--SPVRGCMVIK
SYP2_ANADE      --------------MSDASAETAIRPTRAENFSEWYLEVIKAADLAES--SSVRGCMVIK
SYP_MAGSA       ---------------MSKAKKTAVTPTREENFPEWYQQVIKASDMAEN--SPVRGCMVIK
SYP_PARUW       --------------MTSTKDKTAITPTRENDYPEWYQQVVKASDLAEN--SPVRGSMVIK
SYP_NOVAD       --------------MNQPAIKHALNVKRADDFAQWYQAVIAEAELAEE--SGVRGCMVIK
SYP_SPHEL       ------------------MIKHALSVTRDGDFAQWYQTVISEADMAED--SGVRGCMVIR
SYP_BACFN       -----------------MAKELKDLTKRSENYSQWYNDLVVKADLAEQ--SAVRGCMVIK
SYP_BACFR       -----------------MAKELKDLTKRSENYSQWYNDLVVKADLAEQ--SAVRGCMVIK
SYP_BACTN       -----------------MAKELKDLTKRSENYSQWYNDLVVKADLAEQ--SAVRGCMVIK
SYP_PORGI       -----------------MAKELKELTPRSESYSQWYQDLVIKADLAEN--SAVRGCMVIK
SYP_SALRD       --------------------MADAVTPRDEDYSQWYQDVVRNGQLAEN--SPARGCMIIK
SYP_CHLTE       --------------------MADKITSRQEDYSQWYIDLVRSAKLADY--SDVRGCMVIR
SYP_PELLD       --------------------MADKITARNEDYSQWYIDLVRSAKLADY--SDVRGCMVIR
SYP_CHLCH       --------------------MADKITSRSEDYSQWYIDLVRSAKLADY--ADVKGCMVIR
SYP_SYMTH       --------------MKEEKSFVKEITPQSEDFSRWYIDVIRKADLMDY--TPVRGCIVFK
SYP_HALMA       ---------------MSGEQELGITESKEHSPGEWYAEVVQKAGLADY--APMGGFIVTR
SYP_NATPD       ----------------MTDQELGITESKEHNPGEWYAEVVQKAGLADY--APMGGFIVTR
SYP_HALSA       --------------MSDDDQELGITESKEHSPGDWYAEVVQKAGLADY--APMGGFIVTR
SYP_METAC       ----------------MAESEKEAALPPKEEFSDWYNELLWMAEIMDV-RYPVKGLYVWY
SYP_METMA       ----------------MAESEKEAALPPKEAFSDWYNELLWMAEIMDV-RYPVKGLYVWY
SYP_METBF       ----------------MAESEKEAALPPKEEFSEWYNELLWMAEIMDV-RYPVKGLYVWY
SYP_METHJ       ------------------MEEQEGTLPQKADFSGWYNDILWRAEIMDV-RYPVKGLYVWF
SYP_ARCFU       -----------------------MTLPSKENFSEWYHEVIQTAEIMDV-RYPVKGLYVWF
SYP_METJA       -----------------------------MEFSEWYSDILEKAEIYDV-RYPIKGCGVYL
SYP_METMP       -----------------------------MEFSEWYSDILEKAGIYDL-RYPIKGCGVYL
SYP_METTH       ------------MQKPIKKDPNRYHGEKMTEFSEWFHNILEEAEIIDQ-RYPVKGMHVWM
SYP_METST       ----------------------------MKNFSEWFHNILEEAELMDA-RYPIKGMSVWL
SYP_METKA       -----------MHAFLGNAQLPSTPRGDRLEFSEWYAEVLRSAEIMDV-RYPVKGMYVWL
SYP_PYRAB       ---------------------MVERKRWSENFSEWFNEVIEEAGILDK-RYPVKGMNVWL
SYP_PYRHO       ---------------------MVERKRWSEEFSEWFNEVIEEAGILDK-RYPVKGMNVWL
SYP_PYRFU       ---------------------MVERKKWSENFSEWFNEVIEEAGILDK-RYPVKGMNVWL
SYP_THEKO       --------------------MAVERKKWSENFSEWYNELIETAGIQDK-RYPVKGMNVWL
SYP_SULAC       --------------------MKLTREKWENNFSEWFDWVIREAEIYDYGRYPVKGMGVWL
SYP_SULTO       --------------------MKVSKEKWEKNFSEWLDWVLREAEIYDYGRYPVKGMGVWM
SYP_SACS2       --------------------MQITREKWSKNFSEWFDWVLREGEFYDYGRYPIKGMGVWM
SYP_AERPE       ------------------MLGPPSREKWSSDFPRWFDWVIETAEVYDYGRYPVKGMGVWM
SYP_PYRAE       -------------MELIREARPHSREKLKSNLIEWFHWLLREAELYDV-RYPVKGAYVWR
SYP_THEAC       ------------------------MENKKENFSEWYNEIITLAELSDK-RYPVKGMNVWL
SYP_THEVO       ------------------------MENKKENFSEWYNEIVTISDLSDK-RYPIKGMNVWR
SYP_PICTO       ------------------------MENKKENFSEWYNEIIDLAKLSDK-RYAIKGMNVWL
                                                  *         .         *     

SYP_DEIRA       PYGSALWENIQRWLDDRFKASG-------------------HESLIFPTLIPMNFIMKEA
SYP_DEIGD       PYGTALWENIQRWLDDRFKATG-------------------HESLIFPTLIPMNFITKEA
SYP_THET8       PYGYAIWENIQQVLDRMFKETG-------------------HQNAYFPLFIPMSFLRKEA
SYP_THET2       PYGYAIWENIQQVLDRMFKETG-------------------HQNAYFPLFIPMSFLRKEA
SYP_MYCLE       PYGYRIWELLQDELDSKIKELG-------------------HENAYFPMLIPENYFNREA
SYP_FRACC       PYGYAIWERMQAEVDSRIKAAG-------------------AVNAYFPLFIPESYLRREA
SYP2_STRAW      PYGYGLWERMQQEMDARIKETG-------------------TQNAYFPLLIPQSYLTKEA
SYP2_BACCZ      PYGYALWENMQKVMDEKLKATG-------------------HENVYMPMFIPESLLQKEK
SYP2_BACHK      PYGYALWENMQKVMDEKLKATG-------------------HENVYMPMFIPESLLQKEK
SYP2_BACC1      PYGYALWENMQKVMDEKLKATG-------------------HENVYMPMFIPESLLQKEK
SYP2_BACCR      PYGYALWENMQKVMDEKLKETG-------------------HENVYMPMFIPESLLQKEK
SYP2_BACAN      PYGYALWENMQKVMDEKLKATG-------------------HENVYMPMFIPESLLQKEK
SYP_OCEIH       PYGYAIWENIKNELDRMFKETG-------------------HTNVAFPLFIPESLLQKEK
SYP_ACESD       PYGYAIWENIQAFLDRRFKETG-------------------HQNCYFPLLIPESLLNKEK
SYP_MYCGE       NNSWGLWMEIQQLYNDAIANKNQLSAIALTKFQPTTSFCYQVFQVQLPTLSFYSEYQKEK
SYP_MYCPN       PNSWNLWLQIQRLYNNATALIKLKDKVILKQFIPIEPLPYTVEQVQLPTLSFYSEYQKEK
SYP_MYCGA       PNGWKIWQLIKKELTKEFDQRD-------------------ILELCLPSLISQNDFLLEK
SYP_MYCPE       PYGFAIWKRIQEEFNKILVSLN-------------------TAEVCFPMLIPYSEFMKEK
SYP_UREPA       PNAWAIWEAIKNQIDVEFKKHG-------------------VRNLAMPTLIPLSEFQKEK
SYP_MYCH2       PLGYKIWENIVKIVNAYFVKQK-------------------IENVYFPLLIPQDFIEKEK
SYP_MYCHJ       PLGYKIWENIVKIVNAYFVKQK-------------------IENVYFPLLIPQDFIEKEK
SYP_MYCH7       PLGYKIWENIVKIVNAYFVKQK-------------------IENVYFPLLIPQDFIEKEK
SYP_MYCPU       PNSYGIWENIQLQFNKILKAKG-------------------IKNVYLPLLIPESLMKAEF
SYP_MYCS5       PNSYGIWENIQKTLNEVFKKHG-------------------VENIYAPLFIPESLFKIEK
SYP_MYCMO       PNSYGIWENVQSNFNKIIKELN-------------------VKNLYLPTLIPESLINSEK
SYP_MYCCT       PYGYRIWELIQKYLDEEFKKVN-------------------VDNVYFPLLIPESLFNKEK
SYP_MYCMS       PYGYRIWELIQKYLDEEFKKVN-------------------VDNVYFPLLIPESLFNKEK
SYP_MESFL       PYGYAIWELIQKYLDAKFKELE-------------------VQNVYFPLLIPQSLFQKEK
SYP_AYWBP       PYGYALWENIQKHLNCTLQKTG-------------------HQNVYFPLVFPEKLFHKEK
SYP_ONYPE       PYGYALWENIQKHLNCTLQKTG-------------------HQNVYFPLVFPEKLFHKEK
SYP_BORBU       PYGYSIWSKIQSILDKKFKETG-------------------HENAYFPMLIPYSFLEREK
SYP_BORBP       PYGYSIWSKIQSILDKKFKETG-------------------HENAYFPMLIPYGFLEKEK
SYP_BDEBA       PWGYAVWENMQGVLDRMFKDTG-------------------HVNAYFPLLIPLSFLEKEA
SYP_RHOBA       PWGYQLWENVQRALDDMFKATG-------------------HQNAYFPLFIPMSFLEKEA
SYP2_ANADE      PWGYALWEHVQRVLDGMFKATG-------------------HVNAYFPLFIPLSLLEKEA
SYP_MAGSA       PWGYGIWEAIQRDLDRRIKETG-------------------HENCYFPLFIPLSFLEKEA
SYP_PARUW       PWGYGIWENIQRQLDDRIKETG-------------------HENAYFPLFIPLSFLEKEA
SYP_NOVAD       PWGYGIWERIQKLMDAEIKEAG-------------------VENCYFPLFIPLSYFTKEA
SYP_SPHEL       PWGYGIWERIQRLLDDRIKATG-------------------HENCYFPLFIPLSYFEKEA
SYP_BACFN       PYGYAIWEKMQRQLDDMFKETG-------------------HVNAYFPLLIPKSFLSREA
SYP_BACFR       PYGYAIWEKMQRQLDDMFKETG-------------------HVNAYFPLLIPKSFLSREA
SYP_BACTN       PYGYAIWEKMQRQLDDMFKETG-------------------HVNAYFPLLIPKSFLSREA
SYP_PORGI       PYGYAIWEKMQRQLDDMFKETG-------------------HVNAYFPLFIPKSFLSREA
SYP_SALRD       PNGMALWENMRDQLDQMFKDTG-------------------HQNYYFPLFIPERYMEREA
SYP_CHLTE       PNGYAIWEKMQAALDGMFKQTG-------------------HVNAYFPMFIPESFIAKEA
SYP_PELLD       PNGYAIWEKMQAALDRMFKETG-------------------HVNAYFPLFIPESFIAKEA
SYP_CHLCH       PNGYAIWEKMQAALDRMFKETG-------------------HVNAYFPLFIPESFIAKEA
SYP_SYMTH       PDGYELWERIQAGLDKRFKETG-------------------HRNAYFPMLIPESFFQKEK
SYP_HALMA       PRGYAIWERIQNNLDGWFKDTG-------------------VQNAYFPLFIPESYLEKEK
SYP_NATPD       PRGYALWERLQDHLDGWFKETG-------------------VQNTYFPMFIPESYLEREK
SYP_HALSA       PRGYALWEAIQDNLDGWFKDTG-------------------VENAYFPMFIPEDYLEREK
SYP_METAC       PFGFAIRRSTYNIIREILDNSG-------------------HQETLFPLLIPENEFMKEA
SYP_METMA       PFGFAIRRNTYSIIREILDNSG-------------------HQETLFPLLIPENEFMKEA
SYP_METBF       PFGFAIRRNTYNIIREILDNSG-------------------HQEALFPLLIPENEFMKEA
SYP_METHJ       PFGFGIRKRVYGILRELLDRD--------------------HEETLFPLLIPEPEFMKEA
SYP_ARCFU       PFGFKIRQLVYSKLREIMDRE--------------------HDEVYFPALIPETELGKEG
SYP_METJA       PYGFKIRRYTFEIIRNLLDESG-------------------HDEALFPMLIPEDLLAKEA
SYP_METMP       PYGFKIRRYSFEILRKLLDETG-------------------HDETLFPMLIPENLLAKEG
SYP_METTH       PHGFMIRKNTLKILRRIL-DRD-------------------HEEVLFPLLVPEDELAKEA
SYP_METST       PRGFQIRKYALNALQELL-DKD-------------------HEEVLFPMLIPQSELAKEA
SYP_METKA       PYGFEIRQRVVEKLRRKLRETG-------------------HEEVLFPTLIPETQLKKES
SYP_PYRAB       PYGLKIMKNIEKFIHEEMERTG-------------------HQEVLFPALIPETEFKKEA
SYP_PYRHO       PYGLKIMRNIEKFIHEEMERTG-------------------HQEVLFPALIPETEFKKEA
SYP_PYRFU       PYGLKIMKNIEKFIHEEMERTD-------------------HQEVLFPALIPETEFQKEA
SYP_THEKO       PYGLKIMRNIERFIHAEMERTG-------------------HDEVLFPALIPETEFQKEA
SYP_SULAC       PYGFKIRQAAVDLIRKLLDAKG-------------------HEEVLFPLLVPEDLLRREG
SYP_SULTO       PYGFKIRQNVLQLIRKLLDETG-------------------HEEVLFPLLIPEDLLKKES
SYP_SACS2       PYGFKLRQNIIGIIRNFLDSTG-------------------HEEVLFPLLIPEDLLRRES
SYP_AERPE       PYGFQIRRRVLEVVRGLLDSTG-------------------HEEVLFPLLIPEHLLRRES
SYP_PYRAE       PYGMKIRRNVENLIRKFHDETG-------------------HEEVLFPVFIPYEFFGKES
SYP_THEAC       PYGWKIMSLIDSIVRRAVDKRN-------------------FQEVNFPILIGRSMLEVEF
SYP_THEVO       PYGWKIMKLIDNIIRNAVDKHS-------------------FDEVNFPVLISRGMLEVEF
SYP_PICTO       PYGLKIMRLIDNIIRDNVDNKS-------------------FQEVSFPVLITRSQLETEF
                  .  :                                     .   * .        * 

SYP_DEIRA       DHVEGFAPELFTVNKIGTEE--------------LAEPYVMRPTSETIIGHMWSGWLNSY
SYP_DEIGD       DHVEGFAPELFTVDRIGTEQ--------------LTEPYVLRPTSETIIGYMWSGWLNSY
SYP_THET8       EHVEGFSPELAVVTHAGGEE--------------LEEPLAVRPTSETVIGYMWSKWIRSW
SYP_THET2       EHVEGFSPELAVVTHAGGEE--------------LEEPLAVRPTSETVIGYMWSKWIRSW
SYP_MYCLE       EHVEGFHPELAVVTHAGGKE--------------LSEPLVIRPTSETVIGDMMAKWITSH
SYP_FRACC       EHVEGFSPELAVVTIGGGKE--------------LEEPVVVRPTSETVIGEYLAKWTQSY
SYP2_STRAW      DHVEGFAPELAVVTHGGGKE--------------LEEPAVVRPTSEMIINDYFSKWVQSY
SYP2_BACCZ      DHVEGFAPEVAWVTHGGDEK--------------LAERLCIRPTSETLFCEHFSKIVQSY
SYP2_BACHK      DHVEGFAPEVAWVTHGGDEK--------------LAERLCVRPTSETLFCEHFSKIVQSY
SYP2_BACC1      DHVEGFAPEVAWVTHGGDEK--------------LAERLCIRPTSETLFCEHFSKIVQSY
SYP2_BACCR      DHVEGFAPEVAWVTHGGDEK--------------LAERLCVRPTSETLFCEHFSKIVQSY
SYP2_BACAN      DHVEGFAPEVAWVTHGGDEK--------------LAERLCVRPTSETLFCEHFSKIVQSY
SYP_OCEIH       DHVEGFAPEVAWVTHGGEEE--------------LTERIAVRPTSEVLFCDYYSNNIHSY
SYP_ACESD       EHVEGFAPEVAWVTHGGSEK--------------LAERLCVRPTSETIICSMYSKWLTSY
SYP_MYCGE       THIKGFNPELFLINQVGQKQ--------------LNDPLVLRPTSEIAFCNLWKKQELSY
SYP_MYCPN       RHVEGFNPELFLIEQIGTKK--------------LHDPLVLRPTSEIAFCNLWKKQSFSY
SYP_MYCGA       KHLEGFAPELFIVTKTSNE----------------TEKYILRPTSEIAFCNLWRETLRNY
SYP_MYCPE       EHVEGFNPELFKVSHLGEKK--------------LEDELVIRPTSEISFCNYFKKNIKSY
SYP_UREPA       DHIEGFAPELFMVNQIGDKK--------------LDNSYAIRPTSEILFCNYFKNIVNSY
SYP_MYCH2       KHIEGFAPELLTITKVGDKN--------------LVENIYIRPTSELLFADYFKAEIAKN
SYP_MYCHJ       KHIEGFAPELLTITKVGGKN--------------LVENIYIRPTSELLFADYFKAEIAKN
SYP_MYCH7       KHIEGFAPELLTITKVGDKN--------------LVENIYIRPTSELLFADYFKAEIAKN
SYP_MYCPU       EHIEGFAPELATLTKVGSKN--------------LSENIYLRPTSEVLFQKFFKAEIESY
SYP_MYCS5       EHVQGFNPELATVTQVGNKK--------------LSEKLIVRPTSEVIFANLFKEDINSY
SYP_MYCMO       DHVQGFAPELITVEKVGDKV--------------LNEKLFLRPTSEVLFAEYFKTQLNSY
SYP_MYCCT       DHIDGFSPEIATVTRVGQKQ--------------LEENLFIRPTSEVLMMDYFSNEINSY
SYP_MYCMS       DHIEGFSPEIATVTRVGQKK--------------LEENLFIRPTSEVVMMDYFSNEINSY
SYP_MESFL       DHIEGFSPEIATVTRVGDTP--------------LPEPLFIRPTSEVLMANFFKNEVKSY
SYP_AYWBP       EHIQGFSPEAAMITTTGKKN--------------LSEKLVIRPTSEILFSQYYSKTITSY
SYP_ONYPE       NHIQGFSPEAAMITTTGKKN--------------LSEKLVIRPTSEILFSQYYSKTITSY
SYP_BORBU       DHIDGFSPEFAIIKDAGGE--------------SLAEPLVLRPTSETIIWNMYSKWIKSY
SYP_BORBP       DHIEGFSPEFAIIKDAGGE--------------SLAEPLVLRPTSETIIWNMYSKWIKSY
SYP_BDEBA       AHVEGFAKECAVVTHHRLKGDGNGKLIP---DGELEEPLIIRPTSETIIGHQFAKWVKSY
SYP_RHOBA       EHVEGFAKECAVVTHHRLEPDPDGGLRP---AGKLEEPLIVRPTSETIIGATYAKWVQSY
SYP2_ANADE      AHVEGFAKECAVVTHHRLEAR-DGKLVP---VGELEEPLIVRPTSETIIGESFARWVQSY
SYP_MAGSA       AHVEGFAKEMAVVTHHRLVAE-DGKLVP---SGKLEEPLVVRPTSETIIGDAFARWIQSY
SYP_PARUW       AHIEGFAKECAVVTHHRLEEK-DGRLIP---AGPLEEPLIVRPTSETIIGDSFSRWVESY
SYP_NOVAD       EHVEGFAKEMAVVTHHRLISDGKGGLTPD-PEAKLEEPLVVRPTSETVIGAAMSRWIQSW
SYP_SPHEL       EHVDGFAKEMAVVTHHRLIQK-DGRLVPD-PEAKLEEPLVVRPTSETVIGAAMSRWVQSW
SYP_BACFN       EHVEGFAKECAVVTHYRLKNAEDGSGVVVDPAAKLEEELIIRPTSETIIWNTYKNWIQSY
SYP_BACFR       EHVEGFAKECAVVTHYRLKNAEDGSGVVVDPAAKLEEELIIRPTSETIIWNTYKNWIQSY
SYP_BACTN       EHVEGFAKECAVVTHYRLKNAEDGSGVVVDPAAKLEEELIIRPTSETIIWNTYKNWIQSY
SYP_PORGI       EHVEGFAKECAVVTHYRLKANPDGDGVVVDPQAKLEEELIVRPTSETIIWNTYKNWIQSH
SYP_SALRD       EHVEGFAKECAVVTHSRLTQDEEGD-LVPDPESELGENYIVRPTSETIIWDTYSKWIQSY
SYP_CHLTE       EHIEGFAPECAVVTHGGGE--------------ELAEKLYVRPTSETIIWSSYKKWIQSY
SYP_PELLD       EHIEGFAPECAVVTHGGGE--------------ELAEKLYVRPTSETIIWSSYKKWIQSY
SYP_CHLCH       EHIEGFAPECAVVTHGGGQ--------------ELAEKLYVRPTSETIIWSSYKKWIQSY
SYP_SYMTH       EHVEGFNPELPWVTEAGGE--------------KLEERLALRPTSETIIGHMYAQWIQSY
SYP_HALMA       DVVEGFDPEVAWVTHGGHNE--------------LEERLAVRPTSESIIAPFMAQWTRSH
SYP_NATPD       DIVDGFDPEVAWVTHGGHDE--------------LEERLAVRPTSESIITPFIAEWVRSY
SYP_HALSA       DIVEGFDPEVAWVTQGGHDD--------------LDQRLAVRPTSESIIAPYLSQWVRSH
SYP_METAC       EHIKGFENEVYWVTHGGKDS--------------LDIPLALRPTSETAIYPMYKMWVRSH
SYP_METMA       EHIKGFENEVYWVTHGGKDP--------------LDIPLALRPTSETAIYPMYKKWVRSH
SYP_METBF       EHIKGFEDEVYWVTHGGRDT--------------LDIPLALRPTSETAIYPMYKMWVRSH
SYP_METHJ       EHIKGFENEVYWVTHGGTTP--------------LDIKLALRPTSETAIYPMYALWVRSH
SYP_ARCFU       EHIKGFEDEVYWITHGGLTP--------------LDVKLALRPTSETAMYPMFRLWVRNH
SYP_METJA       EHIKGFEDEVYWVTHGGKTQ--------------LDVKLALRPTSETPIYYMMKLWVKVH
SYP_METMP       EHIKGFEDEVFWVTHGGKTP--------------LEVKLALRPTSETTMYYMMKQWIKVH
SYP_METTH       IHVKGFEDEVYWVTHGGLSK--------------LQRKLALRPTSETVMYPMFALWVRSH
SYP_METST       IHVKGFEEEVYWVTKGGKRD--------------LNEHLALRPTSETSIYPMFSLWVRSH
SYP_METKA       EHIAGFEDEVYWVTHGGLKE--------------LDEKLALRPTSETAIYPMFALWIRSH
SYP_PYRAB       EHIAGFEGEVFWITHAGHEP--------------LDVKLILRPTSETAMYSMFALWIRSH
SYP_PYRHO       EHIAGFEGEVFWVTHAGHEP--------------LDVRLVLRPTSETAMYSMFALWIRSH
SYP_PYRFU       EHIAGFEGEVFWVTHAGHEP--------------LDVRLVLRPTSETAMYSMFALWIRSH
SYP_THEKO       EHIKGFEGEVYWVTHAGLEP--------------LDVRLILRPTSETAMYSMFSLWIRSH
SYP_SULAC       EHIKGFESEVFWVTKGGEEN--------------LDIRLALRPTSETAITYMETYWVQSY
SYP_SULTO       EHIRGFEEEVYWVTKGGSQD--------------LDVKLALRPTSETSITFMESFWVKSY
SYP_SACS2       THIKGFEEEVFWVTKGGSTD--------------LDVKLALRPTSEVAITTMENLWLKSY
SYP_AERPE       EHIRGFEGEVYWVTHGGREE--------------LDVKLALRPTSETSITYMETFWIKSY
SYP_PYRAE       QHIKGFEKEVFWVSKGG--E--------------AGERLVLRPTSETAIMPMVKLWIQDY
SYP_THEAC       EHIRGFENEIYWVTKGGKEK--------------LEEELALRPTSESAMYPMFSLWIRSH
SYP_THEVO       EHIRGFENEIYWVTKGGKEK--------------LEEELALRPTSESAMYPMFSLWVRSH
SYP_PICTO       EHIKGFENEIYWVTKGGSEK--------------LDIELALRPTSESAMYTMFPLWIRSH
                  : **  *   :                           :*****  :           

SYP_DEIRA       RDLPFLHYQWGSVFRAELR-TKAFLRTSEF-FWHEGHTAHADEAEARAEVRQQ-LDLYHE
SYP_DEIGD       RDLPFLHYQWGSVFRAELR-TKAFLRTSEF-YWHEGHTAHASEEEARREVRQI-LDLYHE
SYP_THET8       RDLPQLLNQWGNVVRWEMR-TRPFLRTSEF-LWQEGHTAHATREEAEEEVRRM-LSIYAR
SYP_THET2       RDLPQLLNQWGNVVRWEMR-TRPFLRTSEF-LWQEGHTAHATREEAEEEVRRM-LSIYAR
SYP_MYCLE       RDLPLRLNQWSNVVRWELR-PRMLLRTIEF-LWQEGHSAHIEKSDALRETLFA-LDIYTT
SYP_FRACC       RDLPLLLNQWANVVRWELR-PRLFLRSSEF-LWQEGHTAHADEADAAAYARRIALEVYRD
SYP2_STRAW      RDLPLLINQWANVVRWELR-PRLFLRTTEF-LWQEGHTAHATYEEARDFAAHIHRHVYAD
SYP2_BACCZ      NDLPKLYNQWCSVVRWEKT-TRPFLRTTEF-LWQEGHTIHETAEESQAETLNI-LNLYAS
SYP2_BACHK      NDLPKLYNQWCSVVRWEKT-TRPFLRTTEF-LWQEGHTIHETAEESQAETLNI-LNLYAS
SYP2_BACC1      NDLPKLYNQWCSVVRWEKT-TRPFLRTTEF-LWQEGHTIHETAEESQAETLNI-LNLYAS
SYP2_BACCR      NDLPKLYNQWCSVVRWEKT-TRPFLRTTEF-LWQEGHTIHETAEESQAETLNI-LNLYAS
SYP2_BACAN      NDLPKLYNQWCSVVRWEKT-TRPFLRTTEF-LWQEGHTIHETAEESQAETLNI-LNLYAS
SYP_OCEIH       RDLPKLYNQWGNVVRWEKT-TRPFLRSSEF-HWQEGHTAHATDEEATEETNRM-LETYAK
SYP_ACESD       RELPYLYNQWCSVVRWEKS-TRPFLRTSEF-LWQEGHTLHETAEEAQAETLQM-LAIYKE
SYP_MYCGE       HDLPLIYNQWTQVFRAEKN-TRPFLRNSEF-YWQETHGLFVDQSQSEQAAISF-WNLYQD
SYP_MYCPN       QNLPVIYNQWTCVFRAEKN-TRPFLRNSEF-YWQETHGLFSDGVNSESAAIAF-WKLYQD
SYP_MYCGA       RQLPIKHNQWTSVFRVEKN-TRPFLRNSEF-FWHEIHSCFETEEQSNDFAVDI-WKLYQR
SYP_MYCPE       NDLPCILNQWGSVFRVEKN-TRPFLRTSEF-LWQEQHAVFADKKEAFDFSITM-VNEYKK
SYP_UREPA       NDLPIKNNQWCSVMRAEKT-TRPFLRNAEF-HWQELHAIFASENEADSFAKVI-LDVYTD
SYP_MYCH2       NILPIKLNQWSQVLRWEKT-TNPFLRNTEF-LWQEGHTIHASKVEADQFAKKI-ARFYKY
SYP_MYCHJ       NILPIKLNQWSQVLRWEKT-TNPFLRNTEF-LWQEGHTIHASKVEADQFAKKI-ARFYKY
SYP_MYCH7       NILPIKLNQWSQVLRWEKT-TNPFLRNTEF-LWQEGHTIHASKVEANQFAKKI-ARFYKY
SYP_MYCPU       KDLPKIYNQWANVIRWEKT-TNPFLRSTEF-LWQEGHSSHESAIEARKFTREM-LKTYCK
SYP_MYCS5       NDLPKIYNQWANVVRWEKV-TKPFLRTREF-LWQEGHTSHSSAEEARSFTVKM-IKEYEK
SYP_MYCMO       NDLPLLLNQWANVFRWEKT-TSPFLRNSEF-LWQEGHTSHYSEEEAHQFSKKM-IQIYAN
SYP_MYCCT       RDLPLIYNQWCNVMRWEKT-TRPFLRTSEF-LWQEGHTVHSSYNEAENFCLKI-LNIYEK
SYP_MYCMS       RDLPLIYNQWCNVMRWEKT-TRPFLRTSEF-LWQEGHTIHSSYNEAENFCLKI-LNIYEK
SYP_MESFL       RDLPLIFNQWTNVMRWEKT-TRPFLRTSEF-LWQEGHTVHSERKEASDLTLKI-LDTYTE
SYP_AYWBP       RDLPKLYNQWCNVVRWEKT-TKPFLRGKEF-LWQEGHTVHATEQEAMQQTLSI-LDIYQK
SYP_ONYPE       RDLPKLYNQWCNVVRWEKT-TKPFLRGKEF-LWQEGHTVHATEQEAMQQTLSI-LDIYQK
SYP_BORBU       RDLPLKINQWANVVRWEKR-TRPFLRTTEF-LWQEGHTAHATEEEALEETLLI-LDVYKR
SYP_BORBP       RDLPLKINQWANVVRWEKR-TRPFLRTTEF-LWQEGHTAHATEEEAVEETLLI-LDLYKR
SYP_BDEBA       RDLPILVNQWCNVMRWEMR-TRMFLRTAEF-LWQEGHTVHATAKEAQEETLQM-LNVYSE
SYP_RHOBA       RDLPILINQWANVVRWEMR-TRMFLRTAEF-LWQEGHTVHATSEEAVEETEKM-VEVYRD
SYP2_ANADE      RDLPLLINQWANVVRWEMR-TRMFLRTAEF-LWQEGHTAHATEPEAIDETMQM-LGIYAR
SYP_MAGSA       RDLPMLVNQWANVVRWEMR-PRIFLRTAEF-LWQEGHTAHATAEEAMDETLKM-LEVYRV
SYP_PARUW       RDLPLLINQWANVVRWEMR-PRIFLRTTEF-LWQEGHTAHATHEEALQETMTM-LEVYRS
SYP_NOVAD       RDLPLLTNQWANVVRWEMR-TRMFLRTSEF-LWQEGHTAHVDEADAMKETLRA-LEMYRA
SYP_SPHEL       RDLPVLINQWANVVRWEMR-TRMFLRTAEF-LWQEGHTAHATVEEAQEETRKM-LEVYRD
SYP_BACFN       RDLPILCNQWANVFRWEMR-TRLFLRTAEF-LWQEGHTAHATREEAEEEAIRM-LNVYAE
SYP_BACFR       RDLPILCNQWANVFRWEMR-TRLFLRTAEF-LWQEGHTAHATREEAEEEAIRM-LNVYAE
SYP_BACTN       RDLPILCNQWANVFRWEMR-TRLFLRTAEF-LWQEGHTAHATREEAEEEAIRM-LNVYGE
SYP_PORGI       RDLPILCNQWANVVRWEMR-TRLFLRTAEF-LWQEGHTAHATKEEAEEEARRM-LEVYAT
SYP_SALRD       RDLPLLYNQWANVVRWEMR-PRLFLRTAEF-LWQEGHTAHATETEAVEEAERM-LDVYTT
SYP_CHLTE       RDLPILINQWANVVRWEMR-TRLFLRTTEF-LWQEGHTAHATPEEAQEEVIRM-INIYRT
SYP_PELLD       RDLPILINQWANVVRWEMR-TRLFLRTTEF-LWQEGHTAHATPEESQEEVMRM-INVYRT
SYP_CHLCH       RDLPLLINQWANVVRWEMR-TRLFLRTTEF-LWQEGHTAHATHEEAQEEVLRM-INVYKT
SYP_SYMTH       RDLPVLINQWANVFRWEKR-TLPFLRTSEF-LWQEGHTAHATEEEAREETMRM-LEVYRD
SYP_HALMA       RDLPMRLNQWCSVVRWEATETKPFFRTKEF-LWQEGHTAHADEDGAWEETMTR-LDQYAR
SYP_NATPD       RDLPLRVNQWCSVVRWEATETKPFFRTKEF-LWQEGHTAHATEESAWDETMTR-LEQYER
SYP_HALSA       RDLPLRVNQWNSVVRWEATETKPFFRTKEF-LWQEGHTAHATDEAAWAETTLR-LDQYHR
SYP_METAC       ADFPIKLYQIVNTFRYETKHTRPLIRLREITSFKEAHTVHATWEDAEAQVKEA--VELYT
SYP_METMA       ADFPLKLYQIVNTFRYETKHTRPLIRLREITSFKEAHTVHATWEDAEAQVKEA--IGLYT
SYP_METBF       ADFPIKIYQIVNTFRYETKHTRPLIRLREITSFKEAHTVHATWEDAEAQVKEA--IGLYT
SYP_METHJ       ADLPIKVYQIVNTFRYETKHTRPLIRLREITSFKEAHTVHATWEDAERQVEDA--IARYR
SYP_ARCFU       ADLPLKVYQIVNTFRYETKHTRPLIRLREITSFKEAHTVHKDFEEAAEHVKKA--IGFYK
SYP_METJA       TDLPIKIYQIVNTFRYETKHTRPLIRLREIMTFKEAHTAHSTKEEAENQVKEA--ISIYK
SYP_METMP       TDLPLKLYQVVNTFRYETKHTRPLIRLREIMSFKEAHTAHATKKECDAQIEEA--LTLYK
SYP_METTH       TDLPMRFYQVVNTFRYETKHTRPLIRVREITTFKEAHTIHATASEAEEQVERA--VEIYK
SYP_METST       MDLPIKVYQTVNTFRYETKHTRPLIRVREITTFNETHTAHATEEEAEKEVMEG--IEIYK
SYP_METKA       ADLPLKIFQIVNTFRYETKHTRPLIRMREITTFKEAHTAHATEEEAEEQVKEA--VEIYS
SYP_PYRAB       ADLPFKVYQIVNVYRYETKHTRPLIRVREISRFFEAHTAHADFEDAERQIKED--LEIFD
SYP_PYRHO       ADLPFKVYQIVNVYRYETKHTRPLIRVREISRFFEAHTAHADFEDAERQIKED--LEIFD
SYP_PYRFU       ADLPFKVYQIVNVYRYETKHTRPLIRVREISRFFEAHTAHADFEDAERQIKED--LEIFD
SYP_THEKO       ADLPFKIYQIVNVYRYETKHTRPLIRVREISRFFEAHTAHDSYEDAERQIKED--LEIFD
SYP_SULAC       KQLPKKYYQIVSVFRYETKATRPMIRLREVSTFKEAHTLHETYEDAERQVKEA--IEIYK
SYP_SULTO       KQLPKKYYQIVSVFRYETKATRPMMRLREITTFKEAHTLHETYEDAARQVDEA--INIYK
SYP_SACS2       KQLPKKYYQIVSVFRYETKATRPMIRLREITTFKEAHTVHETYDDAQKQVEEA--IEIYK
SYP_AERPE       RQLPKKYYQVVSIFRYETKATRPMIRLREVTTFKEAHTVHESFEDAERQVLEA--IEVYK
SYP_PYRAE       KDLPLRVYQIVSVFRAETKMTHPMIRLREISMFKEAHTVHADKEDAERQVREA--VEIYK
SYP_THEAC       ADLPLKIYQIVSVYRYETKHTRSFIRIREI-HFFEAHTAHATYEDAEAQMDQY--KEIWR
SYP_THEVO       ADLPLKIYQIVSVYRYETKHTRSFIRIREI-HFFEAHTAHESYEDAEKQMDEY--RIIWT
SYP_PICTO       QDLPLKIYQIVSVYRYETKHTRSFIRVREI-HFFEAHTAHVDYGDAERQMSEY--MDIWS
                  :*    *     * *   .  ::*  *.  : * *  .     .              

SYP_DEIRA       FCRDVLALPVVRGEKTASERFAGAVATYSIEGMMRDGKALQSGTSHYLGQNFSRAFDVKY
SYP_DEIGD       FCRDILALPVVRGEKTASERFAGAVATYSIEGMMRDGKALQSGTSHYLGQNFSKAFDVKF
SYP_THET8       LAREYAAIPVIEGLKTEKEKFAGAVYTTTIEALMKDGKALQAGTSHYLGENFARAFDIKF
SYP_THET2       LAREYAAIPVIEGLKTEKEKFAGAVYTTTIEALMKDGKALQAGTSHYLGENFARAFDIKF
SYP_MYCLE       LARDMAAIPIVSGEKTAGERFAGALNTYTIEAMMRDGKALQSATTHYLGDNFARAFNIRY
SYP_FRACC       FMTQVLAVPVFVGVKTRRERFAGATNTMTCEGMMGDGKALQMATSHELGQNFARAFDIDF
SYP2_STRAW      FMENVLAMDVVLGRKTAKERFAGAVNTLTLEGMMGDGKALQMGTSHELGQNFARAFHTQY
SYP2_BACCZ      FCEDYLAIPVIKGQKTEKEKFAGAKATYTIESLMHDGKALQTGTSHNFGTNFSEAFDIKF
SYP2_BACHK      FCEDYLAIPVIKGQKTEKEKFAGAKATYTIESLMHDGKALQTGTSHNFGTNFSEAFDIKF
SYP2_BACC1      FCEDYLAIPVIKGQKTEKEKFAGAKATYTIESLMHDGKALQTGTSHNFGTNFSEAFDIKF
SYP2_BACCR      FCEDYLAIPVIKGQKTEKEKFAGAKATYTIESLMHDGKALQTGTSHNFGTNFSEAFDIKF
SYP2_BACAN      FCEDYLAIPVIKGQKTEKEKFAGAKATYTIESLMHDGKALQTGTSHNFGTNFSEAFDIKF
SYP_OCEIH       LVEEYLAVPVLKGRKTDKEKFAGAKFTLTIEALMHDGKALQSGTSHHFGTGFAEAFDINY
SYP_ACESD       MAEDLLAIPVVDGRKSDRERFAGAAATYTIEALMHDGKALQSGTSHNLAQHFTKAFDITF
SYP_MYCGE       LIINKLCIPAFVGLKSESEKFAGAKNTWTIEAIMPDGQSLQCATSHDLGDTFTKSFTISY
SYP_MYCPN       IIVNQLCIPAFVGLKSPNERFAGAQNTWTVESIMPDGQALQCATSHDLGQTFTKPFGLTF
SYP_MYCGA       FIKDILCIPLVAGEKTEAEKFAGAKTTYTVETIMPDGQALQSATSHNLSQNFSKAFDIRY
SYP_MYCPE       FVNDYLSIAVLMGEKTENERFAGADNTFTIEALMPDGQVLQSATSHYLGTNFAKSYDLKY
SYP_UREPA       FVQNYLCIPVIKGLKTPWERFAGAQKTYTIEAMMQDGQALQSATSHYLGQFFAKAYDIKF
SYP_MYCH2       FLENYLAIPVISGQKTEREKFAGAVNTYTVEAMMQNFRALQSATAHFLGQNFAKNFEIFY
SYP_MYCHJ       FLENYLAIPVISGQKTEREKFAGAVNTYTVEAMMQNFRALQSATAHFLGQNFAKNFEIFY
SYP_MYCH7       FLENYLAIPVISGQKTEREKFAGAVNTYTVEAMMQNFRALQSATAHFLGQNFAKNFEIFY
SYP_MYCPU       FLRKFLAIPTIMGKKTPREKFSGAYSTYTLEAMMKDGKALQSGTTHYLAQNFSEAYDVNF
SYP_MYCS5       FLKNYLAIPVVSGKKTCNEKFAGAVSTYTVEAMMKDGKALQTGTSHYLGQKFSRPYGISF
SYP_MYCMO       FFEEFLAIPVIIGQKTESEKFAGAHTTYTIEAMMKDGRALQSGTSHYLGQNFAKAFDISF
SYP_MYCCT       FAKEILLLPVICGKKTEKEKFAGAKDTYTIESLMFDGQALQCGTSHFFADNFTKVYDIKF
SYP_MYCMS       FAKEILLLPVICGKKTEKEKFAGAKDTYTIESLMFDGQALQCGTSHFFADNFTKVYDIKF
SYP_MESFL       FAQNALLLPVIPGKKTEKEKFAGADSTYTIESLMHDGQALQCGTSHYFADNFSKPYEIKF
SYP_AYWBP       LGKDLLALPFVCGKKTETEKFAGALITYSIEALMHDGQALQAGTSHYLGIIFAKSFQIQF
SYP_ONYPE       LGKNLLALPFVCGKKTETEKFAGALITYSIEALMHDGQALQAGTSHYLGTNFAKSFQIQF
SYP_BORBU       FIEDYLAIPVFCGKKSEKEKFAGAVSTYSIEALMQDKKALQAATSHYLGLNFAKAFDVKF
SYP_BORBP       FMEDYLAIPVFCGKKSEKEKFAGAVSTYSIEALMQDKKALQAATSHYLGLNFAKAFDVKF
SYP_BDEBA       FAEQYMAMPVIKGMKTPDERFPGAVDTYTIEALMQDKKALQAGTSHFLGQNFAKASEIKY
SYP_RHOBA       FAENWMAMPVIVGSKTPLERFPGAVETLSIEAMMQDRKALQAGTSHFLGQNFSKAQEIKF
SYP2_ANADE      FAEEWMALPVVQGEKTESERFPGAVRTYCIEAMMQDRKALQAGTSHFLGQNFAKASGIQF
SYP_MAGSA       MAEEVLAMPVIVGEKPAHERFPGADKTYSIEAMMQDGKALQAGTSHFLGQHFSKAQNIRY
SYP_PARUW       FVEDVLAIPVIVGEKSPGERFPGAENTFTLEAMMQDRKALQSCTSHYLGQNFAKGSNIRF
SYP_NOVAD       FAEGPLAMPVIAGPKPENERFPGAVETFSIEAMMQDGKALQAGTSHYLGTTFAKAAGIQY
SYP_SPHEL       FAETCLAMPVVAGEKPENERFPGAVSTFSIEAMMQDGKALQAGTSHFLGTTFSSAQDIKF
SYP_BACFN       FAEKYMAVPVVKGVKSANERFAGALDTYTIEAMMQDGKALQSGTSHFLGQNFAKAFDVQF
SYP_BACFR       FAEKYMAVPVVKGVKSANERFAGALDTYTIEAMMQDGKALQSGTSHFLGQNFAKAFDVQF
SYP_BACTN       FAEKYMAVPVVKGVKSANERFAGALDTYTIEAMMQDGKALQSGTSHFLGQNFAKAFDVQF
SYP_PORGI       FAEEYMAMPVVKGVKSANERFAGAVDTYTIEALMQDGKALQSGTSHFLGQNFAKAFNVTF
SYP_SALRD       FAEEYMAMPVLQGRKTESERFPGAVDTYCIEAMMQDGKALQAGTSHFLGQNFAKAFDCTF
SYP_CHLTE       FAEEYMAMPVIVGKKSESEKFAGADATYCIEAMMQDGKALQAGTSHNLGQNFAKAFDCQF
SYP_PELLD       FAEEYMAMPVIMGRKTDSEKFAGAEETYCIEAMMQDGKALQAGTSHNLGQNFAKAFDCQF
SYP_CHLCH       FAEEYMALPVILGKKSDSEKFAGALETFCIEAMMQDGKALQAGTSHDLGQNFAKAFDCKF
SYP_SYMTH       FVETEMAIPLYVGQKTPSEKFAGAVDTYSIEAMMKDGKALQAGTSHYLGQNFAKGFEIKF
SYP_HALMA       LYEEVMAMPPLKGRKPPHDKFPGAHTTTTIETLMPDGKTVQAATSHYLGTSFGEAFDITY
SYP_NATPD       LYEEVMAIPGMTGRKPEHDKFPGADTTTTIEALMPDGKSVQAGTSHYLGTSFAEAFDIEY
SYP_HALSA       LYEDVLGIPVLRGRKPDHDKFPGADTTMSVEALMPDGKSVQGGTSHHLGQSFADAFDITF
SYP_METAC       EIYRRLAVPVLRSRRPDWDKFPGADYTDAIDAMMPDGRTLQIGTVHHLGDNFAKTFDIKY
SYP_METMA       EIYRRLAVPVLRSRRPDWDKFPGADYTDALDAVMPDGKTLQIGTVHHLGDNFAKTFDIKY
SYP_METBF       EIYRRLGVPVLRSRRPDWDKFPGADYTDALDAIMPDGRTLQIGTAHHLGDNFAKTFDIKY
SYP_METHJ       EFYDRLNIPVLISKRPDWDKFPGADYTIAVDTIMPDGRTLQIGTVHHLGDHFSKTFSIQY
SYP_ARCFU       EFYDFLAIPYMVIRRPEWDKFPGAAYTIAFDTIMPDGRTLQIGTVHHLADNFARTFDIKY
SYP_METJA       KFFDTLGIPYLISKRPEWDKFPGAEYTMAFDTIFPDGRTMQIATVHNLGQNFSKTFEIIF
SYP_METMP       AFFDEIGVPYVISKRPEWDKFPGADYTMAFDTIYPDGKTMQIGTVHNLGQNFAKTFELEF
SYP_METTH       EFFNSLGIPYLITRRPPWDKFPGSEYTVAFDTLMPDGKTLQIGTVHNLGQTFARTFEIKF
SYP_METST       TFFDELGIPYSISKRPEWDKFPGSKYTMAFDMIMPDGKTLQIATVHNLGTTFAHTFDIQF
SYP_METKA       SFFDELGIPYIASVRPEWDKFPGAEYTVAFDTLMPDGRTLQIGTVHMLGQNFARTFEVTY
SYP_PYRAB       NLMKRLAIAYIISKRPEWDKFPGAFYSLGAEVVMPDGRTLQIGTMHNYKQNFAKAYNILY
SYP_PYRHO       NLMRKLALAYIISKRPEWDKFPGAFYSLGAEVVMPDGRTLQIGTMHNYKQNFSKAYNILY
SYP_PYRFU       NLMKKLAIAYVISKRPEWDKFPGAYYSLGAEVVMPDGRTLQIGTMHNYKQNFAKAYNILY
SYP_THEKO       NLARFLALPYIISKRPEWDKFPGAYYSLGAEVMMPDGRTLQIGTMHNYRQNFAKAYNIQY
SYP_SULAC       NFFEELGIPYIMSQRPEWDKFAGAIYTIAFDTIMPDSRVLQIGTVHHLGQHFTKAFDLKV
SYP_SULTO       AFFDELGIPYMISKRPEWDKFAGAEYTIAFDTILPDSRVLQIGTVHHLGQHFTKAFDFKI
SYP_SACS2       KIFDTLTIPYVLSERPEWDRFAGALHTYAFDTIMPDGRAMQIGTVHHLGQNFSKALDFKI
SYP_AERPE       AIFDRLLIPYVISKRPEWDKFAGALYTIAFDTIMPDGRALQIGTVHHLGQSFTRAFDFRI
SYP_PYRAE       RIFDEMCLAYLINKRPEWDKFAGAEYTIAFDTILPDGRSLQIGTVHYLGTNFTKVFEVTY
SYP_THEAC       EISSLLCLPYFYDQRPDWDKFPGAMYTIAFDTVLPSGRSLQIGTIHQYGTNFSKNYDIKY
SYP_THEVO       EIADALCLPFLYDQRPEWDKFPGAMYTIAFDTVMPSGRSLQIGTIHQYGTNFSKNYDIKY
SYP_PICTO       SIAEKLCLPYNIDMRPDWDKFPGAKYTLAFDTLMPSGRSLQIGTIHEYGENFARNYDIKY
                       :      :.  ::*.*:  :   : :  . : :*  * *     *        

SYP_DEIRA       QTREQKEEFAHTTSWAISSRIIGAIIMTHGDDSGLMMPPRIAPIQVVVIPVGRKDN----
SYP_DEIGD       QTREQREEYAYTTSWAISSRIIGAIIMTHGDDFGLIMPPRIAPIQVVVIPVSRKEN----
SYP_THET8       QDRDLQVKYVHTTSWGLSWRFIGAIIMTHGDDRGLVLPPRLAPIQVVIVPIYKDES----
SYP_THET2       QDRDLQVKYVHTTSWGLSWRFIGAIIMTHGDDRGLVLPPRLAPIQVVIVPIYKDES----
SYP_MYCLE       TTAEEQQAFVHTTSFGLSTRMIGAIVMVHGDDKGLVLPPQVAPYQVVIVPITTGNK----
SYP_FRACC       LGADGARHLAWTTSWGCSTRMVGGLIMAHGDDNGLRVPPRLAPTQVVVLPVRDEE-----
SYP2_STRAW      LSKEGKQELVWQTSWGSTTRMIGALVMMHGDDNGLRVPPRLAQTQVVVLAIKGDE-----
SYP2_BACCZ      LDRTGKWQYVHQTSWGVSTRMIGGLIMVHGDNNGLVMPPKVAPVQVVIVPIAQ-------
SYP2_BACHK      LDRNGKWQYVHQTSWGVSTRMIGGLIMVHSDNNGLVMPPKVAPVQVVIVPIAQ-------
SYP2_BACC1      LDRNGKWQYVHQTSWGVSARMIGGLIMVHSDNNGLVMPPKVAPVQVVIVPIAQ-------
SYP2_BACCR      LDRNGKWQYVHQTSWGVSTRMIGGLIMVHSDNNGLVLPPKVAPVQVVIVPIAQ-------
SYP2_BACAN      LDRNGKWQYVHQTSWGVSTRMIGGLIMVHSDNNGLVMPPKVAPVQVVIVPIAQ-------
SYP_OCEIH       LDKDGKSQFVHQTSWGLSTRIMGALIMVHGDNRGLVVPPKIAPTQAMIVPIAQ-------
SYP_ACESD       QGRTGELEYPHHTSWGASTRLIGGIIMVHGDNRGLVLPPRVAPTQVVIIPIAQ-------
SYP_MYCGE       QSKTNQKMTPSSFSCGMSTRILGAIFLTHSDDYGLVLPWYLASKQVKL-YLFDK------
SYP_MYCPN       QNQANQQAIPYSFSCGISTRILGALLLTHSDDFGLVLPWKVAPIQVKL-YLFDK------
SYP_MYCGA       QTKNNDYQNVFSMSAGVSTRIIGAIIMTHGDDDGLVFPTKVAPYHISLNCIFDD------
SYP_MYCPE       QTKNNNYDLMFQTSAGLSTRIIGAIIMSHSDNNGLVLPFKIAPIQFAI-----V------
SYP_UREPA       QGQDNQMHYVHQMSAGLSTRIIGALIMVHADDQGLILPPDIAFNQIAILTIFSN------
SYP_MYCH2       KNKENKSQIPFQTSWGLSTRLIGAIVMVHSDDNGLIFPPKIAPIQVDILEFFSK------
SYP_MYCHJ       KNKENKSQIPFQTSWGLSTRLIGAIVMVHSDDNGLIFPPKIAPIQVDILEFFSK------
SYP_MYCH7       KNKENKSQIPFQTSWGLSTRLIGAIVMVHSDDNGLIFPPKIAPIQVDILEFFSK------
SYP_MYCPU       KDSENKKQFVYQTSWGLSTRLIGAIIMTHGDNRGIIIPPFVAPCQIDILAFNPR------
SYP_MYCS5       KNKNNEEDFVYQTSWGVSTRLLGAIIMVHGDNRGVIIPPKIAPIKVDILEILAD------
SYP_MYCMO       KDKDNSKSFVYQTSWGISTRLIGAIIMVHGDNRGIIMPPKIATNQVDIITVFAN------
SYP_MYCCT       QNKENKLEHAYSTSWGVSTRLIGALIMTHSDDNGLVLPSKISPIQVQIIQI---------
SYP_MYCMS       QNKENKLEHAYSTSWGVSTRLIGALIMTHSDDNGLVLPSKISPIQIQIIQI---------
SYP_MESFL       QNKEGKLEHAYSTSWGVSTRLIGAIIMTHSDDNGLVLPSMVSPVQVRLIQI---------
SYP_AYWBP       QDCDNQKKYAHQTSWGVSTRLIGALIMVHSDDEGLVLPPYVAPMQIVIIPLQ--------
SYP_ONYPE       QDCDHQKKYVHQTSWGVSTRLIGALIMVHSDDEGLVLPPYVSPMQIVIIPLQ--------
SYP_BORBU       QDKDGKMRHVFASSWGVSTRLIGALIMVHSDEKGLVLPPRIAPIEIIVIPIFKKEDEINK
SYP_BORBP       QDKDGKMRHVFASSWGISTRLIGALIMVHSDEKGLILPPRIAPIEIIVIPIFKKEDEINK
SYP_BDEBA       LSAEGKEEFAWTTSWGVSTRLIGGLIMTHSDDNGFVVPPRLAPLHVVIIPIYRN-DEERA
SYP_RHOBA       QSESGDIEFAWTTSWGVSTRLIGALIMTHSDDDGLVLPPRLAPTHVVIQPIYK--DDSRA
SYP2_ANADE      QDEKGTLTHAWTTSWGLSTRMIGAMIMTHGDDDGMVCPPRLAPQQVVIIPVIQK-PEVRE
SYP_MAGSA       QTAQGGEEFCYTTSWGVSTRLIGGVIMSHADDNGLRVPPRIAPKQIVFVPITRA-DGDEA
SYP_PARUW       SNMEGQLEYAYTTSWGMTTRLIGSLIMCHGDDDGLRLPPRIAHKQIVIVPVIPK-PELEA
SYP_NOVAD       QNKEGQQALAHTTSWGVSTRLIGGVIMTHGDDDGLRVPPQVAPQQIVILPMLRD-NEGDD
SYP_SPHEL       QNSEGQFELAQTTSWGVSTRMIGGLIMVHGDDDGLRVPPMVAPWQIVIVPMLRD-QPEDA
SYP_BACFN       VNKENKLEYVWATSWGVSTRLMGALIMTHSDDNGLVLPPHLAPIQVVIVPIYKN-DEQLK
SYP_BACFR       VNKENKLEYVWATSWGVSTRLMGALIMTHSDDNGLVLPPHLAPIQVVIVPIYKN-DEQLK
SYP_BACTN       VNKENKMEYVWATSWGVSTRLMGALIMTHSDDNGLVLPPHLAPIQVVIVPIYKN-DEQLK
SYP_PORGI       ADKDGNRDFVWATSWGVSTRLMGALIMSHSDDNGLVLPPKLAPYQVVIIPIYRN-EEQLA
SYP_SALRD       TNEDNEEEYVWATSWGVSTRLIGGLIMTHSDDQGLVLPPKLAPHQVVIVPLFFD-DDQEG
SYP_CHLTE       QTKDGVLDYVWATSWGVSTRLIGALIMAHSDDKGLVLPPKLASRQVVIIPILKG-NKD--
SYP_PELLD       QTKDSRLDYVWATSWGVSTRLIGALIMAHSDDRGLVLPPKLASRQVVIIPILRG-DKA--
SYP_CHLCH       QTHEKTLEYVWATSWGVSTRLIGALIMAHSDDRGLVLPPRLATRQVVIIPILKG-DKE--
SYP_SYMTH       LDRDNQLKYVHTTSWGVSTRLIGALIMVHGDDRGLALPPRLAPIQVIMIPVGPP--KFRD
SYP_HALMA       ADADEEENTAHTTSWGLSWRAMGALIMTHSDDQGLVLPPALAPDQVVVVPIWQE------
SYP_NATPD       TDEDETKQTAHTTSWGLSWRALGALIMTHSDDQGLVIPPALAPTQVVVVPIWQA------
SYP_HALSA       ADEDEAERTAYTTSWGLSWRAIGALVMSHSDDQGLVLPPTVAPKQVVIVPIWQE------
SYP_METAC       EAPDGEQRYAHQTCYGISERSIAATISIHGDDKGLVLPPEIAPVQVVIIPIIFKKGAEE-
SYP_METMA       EAPDGEQRYAHQTCYGISERSIAATISIHGDDKGLVLPPEIAPVQVVIIPIIFKKGAEE-
SYP_METBF       ETPDGEQRYAYQTCYGISERSIAATISIHGDDKGLVLPPEIAPVQVVIIPIIFKKGAEE-
SYP_METHJ       EDTKGQQQYCHQTCYGISERSIAALISMHGDDRGLMLPPEVAPVQIVIVPVIMKKREEE-
SYP_ARCFU       EAPNGEHYYAHQTCYGISERCIAALISVHGDDLGLVLPFEVAPVQIVIIPILYKGKEEA-
SYP_METJA       ETPTGDKDYAYQTCYGISDRVIASIIAIHGDEKGLILPPIVAPIQVVIVPLIFKGKEDI-
SYP_METMP       ETPDGEKDFVYQTCYGISDRAIASLISVHGDEKGLVIPVDVAPIQIVLIPLLFKGKEEI-
SYP_METTH       ETPEGDHEYVHQTCYGLSDRVIASVIAIHGDESGLCLPPDVAAHQVVIVPIIFKKAAEE-
SYP_METST       ENEDGTHDYVHQVCYGLSDRVIASLIAAHGDEKGLSLPPVVAPEQVIIIPIIFKENQDV-
SYP_METKA       ETEEGDQEYVYMTCYGISDRVVASMIAIHGDERGLVLPPDVAPYQVVMVPILKKGVRRK-
SYP_PYRAB       EKEDGTHDYVHQTTFGMSERLLAAVIAIHGDDRGMVLPPTIAPIQVVIVPIPKKEKQEI-
SYP_PYRHO       EKEDGTHDYVHQTTFGMSERLLAAVIAIHGDDRGMVLPPTIAPIQVVIVPIPKKGSEEE-
SYP_PYRFU       EKEDGTHDYVHQTTFGMSERLLAAVIAIHGDDRGMVLPPTIAPIQVVIVPIPKKGSEEE-
SYP_THEKO       ETETGDHEYVHQTTFGMSERLLAAVIAIHGDDRGMVLPPTIAPIQVVIVPIPKKDSEAD-
SYP_SULAC       QRKDGTLDYPHQTSYGISDRVIAVAVSINGDDHGTILSPVLAPIKAVIIPIPAKDEKETE
SYP_SULTO       QRKDGSLDYPHQTSYGISDRVIAVLIAINGDDHGPVLNPVIAPIKVVIVPIPAKDEETTA
SYP_SACS2       QKKDGSLDYPHQTSYGISDRAVASVIAIHGDDHGPVLPPSVAPIKVVVIPIPAKNEEETQ
SYP_AERPE       QMRDERLDHPWQTSYGVSDRVVASLIAVHGDDRGLVIPPSVAPIQVVVIPITPGDEEKRG
SYP_PYRAE       LDADGTRKLAHTTSYGISERSIAAMLITHGDDGGTTLPPKLAPIQVVVIPIYYG-EEEAP
SYP_THEAC       LKEDGTFDYAHQTTYGMSERLLAAIIGIHGDDKGLVLPPDVAPIQVIIIPIPGA------
SYP_THEVO       LKEDGTFEYVHQTTFGMSERLLAAIIGIHGDDKGLILPPAIAPIQVVIVPIPGE------
SYP_PICTO       LDINGDLKYVSQTTFGLSERLLAAVIGIHGDDTGLILPASIAPVQAIIIPIPGKSF---K
                               . : * :.  .  :.*: *      ::  .  .            

SYP_DEIRA       ---FDQMVQEGEKLAAELRAQGLRVKVDGRD---GVTNGFKYNDWELKGVPVRIELGPRD
SYP_DEIGD       ---FDQMVAEGEKLAHELRAQGLRVKVDRRE---GVTNGFKYNDWELKGVPVRIELGPRD
SYP_THET8       ---RERVLEAAQGLRQALLAQGLRVHLDDRD---QHTPGYKFHEWELKGVPFRVELGPKD
SYP_THET2       ---RERVLEAAQGLRQALQAKGLRVHLDDRD---QHTPGYKFHEWELKGVPFRVELGPKD
SYP_MYCLE       ---ASEVGHAAADLARRLQAAGVRTHVDARP---QLTPGWKYNEWELRGVPIRLELGPRD
SYP_FRACC       -----TVVAKARQIAAALTDAGLRVQVDARP---GLSFGRRVTDAEIKGIPVRVEVGPRD
SYP2_STRAW      -----AVLAKVRETGDRLKAAGLRVQVDDRT---DVPFGRRAVDWELKGVPVRVEVGPRD
SYP2_BACCZ      --HKEGVLAKAIELQGHI-QKVARVKIDA----SNKTPGWKFNEYEMKGIPIRLEVGPKD
SYP2_BACHK      --HKEGVLAKAIELQGHI-QKVARVKIDA----SNKTPGWKFNEYEMKGIPIRLEVGPKD
SYP2_BACC1      --HKEGVLAKATELQEHI-QKVARVKIDA----SNKTPGWKFNEYEMKGIPIRLEVGPKD
SYP2_BACCR      --HKEGVLAKATELQAHI-QKVARVKIDA----SNKTPGWKFNEYEMKGIPIRLEVGPKD
SYP2_BACAN      --HKEGVLAKATELQGHI-QKVARVKIDA----SNKTPGWKFNEYEMKGIPIRLEVGPKD
SYP_OCEIH       --HKEGVLDKAYELRDKL-AKVARVDIDG----SDKMPGWKFNEYEMKGIPVRVEMGPKD
SYP_ACESD       --NKEGVLDKAYEIKKELEAKGIRVTLDDD---TNYSPGWKFNQYEMKGVPLRLEIGPRD
SYP_MYCGE       --NNNPKTRALAFLVKDFLE-KLKIRFSFIE--INNQLGKQLLKGEIEGIPLQMIVDNE-
SYP_MYCPN       --KGDTKTVELAQKVQTLLE-QLAIRFQFIK--VENQLGKQLGQGEVNGIPFQLIVDNP-
SYP_MYCGA       --TNQELNAKLKELANKYSQ-KYRVHLNVNKDSTGEIIKNSQLRGDCCVLLMGPNDLKK-
SYP_MYCPE       --TSNEVNKDSDELKAIYKN-LFGYKYQTYF--VEKSLGLQLQENEIKGIPFQLILGKKE
SYP_UREPA       --KNPQLLKISQQICEQLNN-YRLFEDHSDK-----GIGYKLAQQEIEGTPICILVGAKE
SYP_MYCH2       --KNQEVKIFAKKIAKILKNAKISYKIDDTD----QQIGYKINNSEVHGAPIRIEIGPNE
SYP_MYCHJ       --KNQEVKIFAKKIAKILKNAKISYKIDDTD----QQIGYKINNSEVHGAPIRIEIGPNE
SYP_MYCH7       --KNQEVKIFAKRIAKILKNAKIAYKIDDTD----QQIGYKINNSEVHGAPIRIEIGPNE
SYP_MYCPU       --RSAEIEKFVNQVEKILKK-PFRVNVDRSD----KTLGFKASQSEIQGVPLRIEIGPRD
SYP_MYCS5       --KNPEVSKVANKIYKELSK-KLSVRLDASN----KSPGFKASQSEIEGVPLRIEVGPRD
SYP_MYCMO       --KNPEVLQKANDLFKTLKN-DFRVRINDSN----KSVGFKAAQSEIEGTPIRIEIGPED
SYP_MYCCT       --KNTEQIDQVVEIIKDKLSD-YRIDVDNSD----KSFGFKISEAEIKGIPIRIEIGPRD
SYP_MYCMS       --KNTEQIDQVVENIKDKLSD-YRIDVDNSD----KSFGFKISEAEIKGIPIRIEIGPRD
SYP_MESFL       --KETDEVIKVTEDIKEALKNKYRVDIDKTD----KSFGFKISEAEIKGIPLRIEIGPRD
SYP_AYWBP       --TQDESVKQVSENLFSILQKNYRVHLDLQD----KTAGWKFSQYELKGVPLRIEIGKRG
SYP_ONYPE       --PQDDAVKQTSENLFSILQKNYRVHLDLQD----KTAGWKFSQYELKGVPLRIEIGKRG
SYP_BORBU       KILDYSDCVVDALKKAEF-----RVEIDKDV---RSSPGFRFSSAEFKGIPIRLEVGIND
SYP_BORBP       KILDYSDCVVHALKKAEF-----RVEIDKDV---RSSPGFRFSSAEFKGIPIRIEVGIND
SYP_BDEBA       QVLDYVKALEKDLKAQNYVGSSVRVKIDDRD---MRG-GEKAWQYIKQGVPVRVEVGPRD
SYP_RHOBA       EVMEYVQSLRDELAAQTYANAPVRVTIDDRD---IRG-GEKKWYHVKRGVPIRLEVGPKD
SYP2_ANADE      QVLAWCTALKRELEAQTYAGAPVRVHLDARD---LQG-AKKSWEWIKKGTPVRLEVGPRD
SYP_MAGSA       LIEDFLAPIVKDLSAQSFGGERLRVHVDRRP---LAP-PEKRWEWVKKGAPIICEVGPRD
SYP_PARUW       QVLEYAENLAAELRKQIFYGKPLTVHIDKRD---KRG-GEKNWEWVKKGVPLRLEVGPRD
SYP_NOVAD       ALLAYCEEIRASLVKLSVFGERIRVLLDKRP---GKA-TQKRWAWVKKGMPLILEIGGRD
SYP_SPHEL       ATIDYCKSLQAELAKLTALGEPVRALLDLKA---VKA-QTKRWGWVKKGAPIVIEVGGRD
SYP_BACFN       LIDAKVEGIVARLKQLGI-----SVKYDNAD---NKRPGFKFADYELKGVPVRLVMGGRD
SYP_BACFR       LIDAKVEGIVARLKQLGI-----SVKYDNAD---NKRPGFKFADYELKGVPVRLVMGGRD
SYP_BACTN       QIDAKVEGIVAKLKALGI-----SVKYDNAD---NKRPGFKFADYELKGVPVRLVMGGRD
SYP_PORGI       QIDEKATQITQALRAKGI-----SVKYDNSD---NKKPGWKFAEYELKGIPVRLAMGARD
SYP_SALRD       PVMETCERLQERLEDHGI-----RVKMDQNH---TQSPGWRFSEHELRGVPLRLAIGPRD
SYP_CHLTE       EVRARARFIAKTLNRHGI-----PTFVDDSE---NNSPGWKFAEYELQGIPVRIELGPRD
SYP_PELLD       AVLEQADAMAASLKAAGI-----PAFVDGSE---QNSPGWKFAEYELQGIPVRIEVGPRD
SYP_CHLCH       SVLHHADNIAAALTKAGI-----SAFVDSSE---QNSPGWKFAEYELQGIPLRLELGPRD
SYP_SYMTH       KVMARFDPLFDALKAAGV-----RVKADLRE---ETP-GWKFNEWEMRGVPLRIEIGPRD
SYP_HALMA       -DNKDEVIDYAADLAAELDEADVRVELDDRE---HRNPGFKYNEHELHGVPLRVEIGPHE
SYP_NATPD       -DTEEAVKEYAADLAAELDE-QFRVELDDRD---ERNPGFKFNEHELQGVPLRIEIGPNE
SYP_HALSA       -DTKDDVEQYGAEIAAELEAQGVRVHFDDRD---GRNPGFKFNEWELNGVPVRFEIGPNE
SYP_METAC       ------VLAACRDVQERLKKTGVKVEIDAS----DLRPGAKYYRWEMKGVPLRLEIGPRD
SYP_METMA       ------VFAACKDVQERLKKAGIRVEVDAS----DLRPGAKYYKWEMKGVPLRLEIGPRD
SYP_METBF       ------VLAACKDVKERLTKAGIRVEIDAS----DLRPGAKYYKWEMKGVPLRLEIGPRD
SYP_METHJ       ------IMQAAELLEKELQNAGYRVKIDTR----DLRPGAKYYYWEMRGVPLRLEIGPRD
SYP_ARCFU       ------VMEACRKLAEKLK--AFRVVLDEG----EDRPGAKYYKWELKGVPIRFEIGPRD
SYP_METJA       ------VMEKAKEIYEKLKGK-FRVHIDDR----DIRPGRKFNDWEIKGVPLRIEVGPKD
SYP_METMP       ------VMDKIKELNNTLKSE-FRVHLDDR----DIRPGRKYNDWELKGVPLRIELGPRD
SYP_METTH       ------VMEACRELRSRLEAAGFRVHLDDR----DIRAGRKYYEWEMRGVPLRVEIGPRD
SYP_METST       ------VLNFTDNLEKLLKNNGIRVKQDKR----ELRPGKKYYEWEKRGVPLRIEVGPRD
SYP_METKA       ------ILERAAEVEEMLREEGVRVKVDDR----DMSPGRKFHYWELKGVPLRIELGARE
SYP_PYRAB       ------VYEYAREIEEELRTAGIRVHLDMR----EKRPGWKFYDWELKGVPVRIEVGPRD
SYP_PYRHO       ------VYSYAKGIEEELRDAGIRVYLDLR----DKRPGWKFYDWELKGVPVRVEVGPID
SYP_PYRFU       ------VYSYAREIEEELKLAGIRVHLDLR----DKRPGWKFYDWELKGVPVRIEVGPRD
SYP_THEKO       ------VFAYAREIAEELRTAGIRVHVDER----DIRPGRKYYDWELKGVPLRIEVGPRD
SYP_SULAC       -----KIIEYSEDVAKILVSNGINTVIDKDT---EKTPGEKYYIWEIKGVPLRIEIGPRE
SYP_SULTO       -----KIINYAKEVGENLKNRGITVVIDDDK---EKTPGEKFYIWELKGVPLRIEIGPKE
SYP_SACS2       -----QVMKYSIEICEMFNKNNITCLTDQDT---EKTPGEKFYIWEIKGVPIRLEIGPRE
SYP_AERPE       -----KVLTYTAKAAEALEKAGLRVHVDDRE---WERPGAKFYYWEAKGVPIRVEIGLRE
SYP_PYRAE       -----LVMPLVRETANRLNEAGIRVYVDERA---DKTPGWKFYYWELKGVPLRVEIGKRD
SYP_THEAC       -----GVMEYARDVENTLNSINIRVKVDDRE---NYTPGYKFNDWEMRGVPLRIEIGERE
SYP_THEVO       -----GVERYAKDIETTLNGIGIRCHVDNRD---NYTPGYKYNDWEMRGVPLRIEVGERE
SYP_PICTO       -----EVLDYSGKILSMLKDINVRAEIDSRE---NYTPGYKYNDWEMRGVPLRIEIGSRE
                                                                   .        

SYP_DEIRA       LESGVLVVKNRHSE-------DKETLPRAEAVSGMSA-RLDTIHDFLMKRATDFLLANTA
SYP_DEIGD       LEQGVVVVKNRNAE-------EKETLPREEAIRGMAN-RLDSIHNWLLQRATDFLLTHTV
SYP_THET8       LEGGQAVLASRLG--------GKETLPLAALPEALPG-KLDAFHEELYRRALAFREDHTR
SYP_THET2       LEQGQAVLASRLG--------GKETLPLAALPEALPG-KLVAFHEELYRRALAFREAHTR
SYP_MYCLE       LEAGTTVMVRRIGEK------AKQPIAIAAAPTELPG-ILEEFQRTLLERATQFRDDHTT
SYP_FRACC       LAAGNVTLVRRDTS-------EKVPVPLAEVATRVPV-LLGEVQADLYAEALALRESRTT
SYP2_STRAW      LENGTAMVARRIPG-------GKEPVALDALAALLPT-ALEEDQALLLRQARERRASRTS
SYP2_BACCZ      IEKNQVVLVRRDTKE-------KEFISMDQLEERIPA-LLEEIHNSLFNKAKVFRDENTY
SYP2_BACHK      IEKNQVVLVRRDTKE-------KEFISMDQLEERIPA-LLEEIHNSLFNKAKVFRDENTY
SYP2_BACC1      IEKNQVVLVRRDTKE-------KEFIAMEQLEERIPA-LLEEIHNSLFNKAKVFRDENTY
SYP2_BACCR      IEKNQVVLVRRDTKE-------KEFVPMDQLEERIPA-LLEEIHIALFNKAKAFRDENTY
SYP2_BACAN      IEKNQVVLVRRDTKE-------KEFISMDQLEERIPA-LLEEIHNSLFNKAKVFRDENTY
SYP_OCEIH       IEKEQVVLVRRDTGE-------KEFVPVAEVETRLVE-LLDEVQSNLYQRALDHRNEMTT
SYP_ACESD       IENNVAMIARRDTLS-------KDSYSLDNIGDTVKN-LLDTVHTDMLERARAHRDSKTF
SYP_MYCGE       ---KTINIFNRLTRL-------KTSLTFANLQTEFVN-LVNNYHTEMYRKANDLVEQKLA
SYP_MYCPN       ---QTVNIFNRLTRV-------KTAYSFEQLASRFVE-LVQQYHQAMYDKAKAVVQQKVV
SYP_MYCGA       ---NEIVFIDRITKQ-------KQFINLDHLDQKLEE-LFSTFDQKLYQKAKAVFETKVD
SYP_MYCPE       IENNTITIYRRDTRE-------KQNISFKEFNQNFIENLIKEYSSNLFNKTEKRLNSSIE
SYP_UREPA       LVNQQVVIVRRDTHE-------KINVDLTDLKLIIPK-LLADIKRNIYEKAKKDLEDSIV
SYP_MYCH2       VKNNQICLVRRDNHQ-------KFFFNIDLLKEKCRK-ILEQIQADLFKKAKIRLLENTV
SYP_MYCHJ       VKNNQICLVRRDNHQ-------KFFFNIDLLKEKCRK-ILEQIQADLFKKAKIRLLENTV
SYP_MYCH7       VKNNQICLVRRDNHQ-------KFFFNIDLLKEKCRK-ILEQIQADLFKKAKIRLLENTV
SYP_MYCPU       FENNQVTLVRRDTLE-------KQSVSINDIVKVSRE-TLQAIHNNLYEQAKIRLKNNIV
SYP_MYCS5       LENNCVTFVRRDTLE-------KTKVDLENVKKEVNN-YLKLIQNNLYQAAKQRLEENTV
SYP_MYCMO       LKQNKVILIRRDTQE-------KIDVKIDELKSEIFS-QIEKIHENLLMQAKRLLNEKIV
SYP_MYCCT       LENNQITISRRDQQEN------KIKVDYKDIKSVVDQ-MIKDYDLALYNNALENRKNRTF
SYP_MYCMS       LENNQITISRRDQQEN------KIKIDYKDVKKVVDQ-MIKDYDLSLYNSALENRKNRTF
SYP_MESFL       LENNQVTISRRDTRE-------KIQVNVNEVTNIVDQ-MIKEYDANLYAKALKNREERTS
SYP_AYWBP       LENDEVTIFQRYNFA-------KQNIKIKDFPSQIPQ-LFETMHNNMYQKALQHLEQNRK
SYP_ONYPE       LENDEVTIFQRYNFA-------KQNIKTKDLPSQIPQ-LFETIHNNMYQKALQHLEQNRK
SYP_BORBU       VLLNSVTISRRDKD-----RKFKYQISLDSLISKVKV-ELDLMQKDLFQRALNFRILNTK
SYP_BORBP       VLLNSVTIMRRDKD-----RKFKYQISLDSLASKVKV-ELDSMQKDLFKKALNFRTLNTK
SYP_BDEBA       MAKGEVFVGRRDRG-----PKEKASMERNAFVANITN-LLQEMQDGLFERAKQMRDESIK
SYP_RHOBA       IAAGTVFCGIRNQ------PKS-VGIDRAELVATIGE-KLATLQQELFDAALKMREDNTV
SYP2_ANADE      IEKGAVFMGRRDRK-----PREKQSVPRAELVAGVGA-LLQEIQDALLERARTMRAAHTR
SYP_MAGSA       VAGGSVAMIRRD-----GELKG-QITPKDELVSRAAA-ILEDIQKTLFTQAATALKERTV
SYP_PARUW       INEQAVMVARRD-----QSPKNKQSLPKQQFVQQAAS-ILEDIQRNYYVQAATYRDQHIY
SYP_NOVAD       AEGGLVSVLRRDRLWRQDAKPNFVGQAKDDFLASAAT-ELESIQAALYDEARARRDAQIV
SYP_SPHEL       VAGGNVSVIQRNKLYREDGKLDSRIMPRGDFVAEAAA-ILESIQQGLYLDARERLDSNIR
SYP_BACFN       LENNTMEVMRRDT------LEK-ETVTCDGIETYVQN-LLEEIQANIYKKARTYRDSRIT
SYP_BACFR       LENNTMEVMRRDT------LEK-ETVTCDGIETYVQN-LLEEIQANIYKKARTYRDSRIT
SYP_BACTN       LENNTMEVMRRDT------LEK-ETVTCDGIETYVQK-LLEEIQANIYKKALDYRNSKIT
SYP_PORGI       LENNTIEIARRDT------LTK-ETVGLDGIEETVAT-LLDDIQKNIFQKALNYRKEHTI
SYP_SALRD       LENDNVEMARRDT------QEK-EVVPQDGIAERVSD-TLDDIQHALHERAQDRQADNTR
SYP_CHLTE       LEQGKCIVARRDT------FEKTELLLDDELTINIEE-ILNNIQQNLYDRALQFRLDNTV
SYP_PELLD       IEKGICIAARRDT------LEKSELQLGETLPGAVQE-ILDAMQKDMYQKALLFREENTV
SYP_CHLCH       IKNGMCVVARRDT------LEKTEIALDDRLVMSINE-ILNDIQQDMFDAALRFRQERTV
SYP_SYMTH       VDNKQCLMVRRDT-------GEKIPVPLDEAVERVQA-LLEEIQRNMFVKAKEFRDAHSH
SYP_HALMA       VEDGEATLVHRPDGE-------TETVDRDGIADTVTD-HLDTVHAKLYASAEETLEGEIR
SYP_NATPD       VEDEAATLVHRPDGE-------SDVAERESITDAVDE-ALETVYAKLYASAEATLEENIR
SYP_HALSA       VEDDEVTVVHRPDGE-------STVEDRAAIADRVHD-HLDEVYDKLYDAAADRLAENVR
SYP_METAC       LENNVAVSVRRDTGEKE------QIPLPEIETG--VLQKFEAIQNSLYEKAKVGLESRIF
SYP_METMA       LQNNVAVAVRRDTGEKD------QITLLEIEAG--VRLKFEAIQKSLYEKAGSELESRIF
SYP_METBF       LQNNVAVAVRRDTGEKE------QISLPEIEAG--VSSKFEAIHENLYQKAKVELENRIF
SYP_METHJ       LDNGVVMGVLRSGG-KE------SLPRADIIAE--VNRKMTEFTAILQERAKTHIKDHLV
SYP_ARCFU       AEKGVAVVSFRDEKRKF------EVPLDEVDEGK-VLEWARELKQRLRNAAAERMAEKVK
SYP_METJA       IENKKITLFRRDTMEK--------FQVDETQLMEVVEKTLNNIMENIKNRAWEKFENFIT
SYP_METMP       IENGHALIVRRDTGEK--------ITVEYSNILEEVEKIVSMYKENLKLKAEEKVKSFIT
SYP_METTH       LEKGAAVISRRDTGEK--------VTADLQGIEETLRELMKDILENLRTRAWERMESEIR
SYP_METST       IENNTIVINRRDTGDKE------FVDYDENTIVDVVKDRLDSITHDMKEASNKFQEEKTF
SYP_METKA       LEEGTAVVFRRDELER--------ETYAFEELPDVVPELLEDIAMELRKRAREKFEKGIF
SYP_PYRAB       VENSTVVLARRDKLEK--------ITIKREELVDKVRELFDDIMKYLYERANEWLNSHIK
SYP_PYRHO       VQNSTVVLARRDKLEK--------ITVKREELVDKVRELFEDIMEFLYERANEWLESHIK
SYP_PYRFU       AAEKTVVLARRDKLEK--------ITVSREELVDKVRELFDDIMQYLYERAKEWLESHIK
SYP_THEKO       VEGKKAVLARRDTLEK--------ITVERDNIVEEVRKTLDAIHENLYQRAKEFLESHIK
SYP_SULAC       LSSNSVFIKRRDTLQG--------ISVKKENLVSEVVKLLETLRKDLKERAWNFLRSKIR
SYP_SULTO       LNNNTVYIKRRDTFEG--------KSVPKDKAVEEVNTLLEKIKNDLHEKALKFLKERII
SYP_SACS2       LISGTVFIKRRDNFKS--------YTVRKEEAINKIKELLNEIQEDLRRKAWEDLKSRIE
SYP_AERPE       AEQDTLTIARRDTLEK--------TEVPLGEAGNRIRELMAQIESSMRERAKSFFGERLL
SYP_PYRAE       VEKRQAVIARRDTLEK--------YAVSINELVDAVKQLMKSVEENLRKRAWEELKGRVV
SYP_THEAC       VKNRTLTISMRNIQGK--------LTIERSKLIYEVPDTLIRIREKMMENAQKVFKDHVF
SYP_THEVO       LKEKTVTLAARNIRGK--------KTVQREKLVYEVPDMLDLVKEKITEDAKKTFNSLVV
SYP_PICTO       MESSTVTVVSRLNKKR--------LNIS-IKEINNIKNMLNEHDKQLTLNAWKMMEENTV
                          *                                       :         

SYP_DEIRA       E-----VDSYD-------AFQREIEAGH-------------WVRAYHCGEPAC-EKSIKE
SYP_DEIGD       P-----ADSYE-------ELKNAIEHGN-------------WVRAFHCGNAEC-EAQIKE
SYP_THET8       K-----VDTYE-------AFKEAVQEG--------------FALAFHCGDKAC-ERLIQE
SYP_THET2       K-----VDTYE-------AFKEAVQEG--------------FALAFHCGDKAC-ERLIQE
SYP_MYCLE       L-----VDNWD-------AFATTVATG--------------WALAIHCGNPEC-EEDIKA
SYP_FRACC       D-----VATVA-------EAARAAQAG--------------FARIPWRLVGEE-GEAELA
SYP2_STRAW      D-----VSTIE-------EAVEAAAGGG-------------WARIPWATLGER-GEAELA
SYP2_BACCZ      S-----VTNFE-------EMKKIADEKQG------------FIKAMWCGELAC-EEKLKE
SYP2_BACHK      S-----VTSFE-------EMKKVADEKQG------------FIKAMWCGEVAC-EEKLKE
SYP2_BACC1      S-----VTKFE-------EMKKVADEKQG------------FIKAMWCGELAC-EEKLKE
SYP2_BACCR      V-----ATNFE-------EMKKIADEKQG------------FIKAMWCGELAC-EEKLKE
SYP2_BACAN      S-----VTNFE-------EMKKLADEKQG------------FIKAMWCGELAC-EEKLKE
SYP_OCEIH       V-----AKDMD-------EFKEKIEE-GG------------FIKAMWCGDVSC-EESIKE
SYP_ACESD       T-----FKDYE-------EFKRKMIETPG------------FAKGMWCGEEEC-EAKIKE
SYP_MYCGE       R-----VQTLK-------EIEQAFKNKK-------------AVLCTVKLTGEL-EQHLKT
SYP_MYCPN       Q-----ATTLK-------QIEQAFNDKK-------------AVLCAVRLTDTL-EQQLKE
SYP_MYCGA       F-----AQTFE-------EFEQKIASGK-------------FVRVFYCNEDLY-EKQIKE
SYP_MYCPE       F-----VNNID-------EFKKALDNKK-------------IISAYWSGNAED-EKKLKE
SYP_UREPA       F-----VNNIE-------ELKQVIAQNK-------------MAKAFFDGTKED-DEQIKL
SYP_MYCH2       F-----VNSIN-------EFEHAVKNNK-------------FVIAPFS-ESPEREQEIQE
SYP_MYCHJ       F-----VNSIN-------EFEQAIKNNK-------------FVIAPFS-ESPEREQEIQE
SYP_MYCH7       F-----VNSIN-------EFEQAIKNNK-------------FVIAPFS-ESPEREQEIQE
SYP_MYCPU       E-----INDYE-------EFKQEIANHK-------------FVISPLCCTTAEAEEEIQK
SYP_MYCS5       Y-----AYNYE-------DFKKHIVDNK-------------FVVVPFCCVTKK-EIEIKE
SYP_MYCMO       D-----VEDYE-------SLKKEIAKGN-------------FVRVPFDGDKKE-EEIIKK
SYP_MYCCT       K-----ANTIE-------EYIEILKQNQG------------FVLVPFCGRVEC-EQDIKT
SYP_MYCMS       K-----ANTIE-------EYIEILKQNQG------------FVLVPFCGRVEC-EQDIKT
SYP_MESFL       R-----ANSIE-------EYKNILAQNQG------------FVLVPFCGEIEC-EDDVKK
SYP_AYWBP       Q-----ATTYE-------EFKTYLKQGG---------------YVAMSISGTDAELQIKQ
SYP_ONYPE       Q-----ATTYE-------EFKTYLKQGG---------------YVAMSISGTDAELQIKQ
SYP_BORBU       EIFRSSKDSYE-------TFKAYVND------------YSGFVLSCWCGSLNC-ENIIKN
SYP_BORBP       EIFRIGKDSYE-------LFKAYMND------------HSGFVLSCWCGGLDC-ENIIKN
SYP_BDEBA       -----TITNLQ-------DFEKYFS--------GGENTAPGFAKVPWCEAGMG-HELLAQ
SYP_RHOBA       -----ELTSEA-------EFRDFFAD------KGDTAITGGFAWCHYCDEDSL-QPLLKE
SYP2_ANADE      -----VIDTKD-------EFYAYFTPPPTRRPNDPTPIHGGFALAHFAGDPAV-EARIKE
SYP_MAGSA       -----TVRTLD-------DFLAVFA--------DDTTFGRKFVRARWCGDSDT-LAKLDE
SYP_PARUW       R----HLETFE-------EMRAFFTP----KNEEKPEIHGGFVLAKWCGDPVT-EEMLSD
SYP_NOVAD       R----DVTDLE-------GLKGYFAE----GNKYPGWVEMGWAKPTGEALDKV-VEQLKA
SYP_SPHEL       R----DVTDFD-------GLAAMFAD----SVKFPGWAEVSWAKPTGAELDAV-VERLKA
SYP_BACFN       -----TVDSYD-------EFKEKIEE-------------GGFILAHWDGTVET-EEKIKE
SYP_BACFR       -----TVDSYD-------EFKEKIEE-------------GGFILAHWDGTVET-EEKIKE
SYP_BACTN       -----TVDTYE-------EFKEKIEE-------------GGFILAHWDGTTET-EEKIKE
SYP_PORGI       -----TVDSYE-------EFKEKIED-------------GGFILAHWDGTSET-EERIKA
SYP_SALRD       -----VVEDYD-------AFREVIGR-------------GGFAWAHWDGTPET-EARIQE
SYP_CHLTE       -----EATTWE-------EFKASVEK-------------G-FVIAHWDGTHET-EALIKE
SYP_PELLD       -----EASSYE-------EFKAAVEK-------------G-FVIAHWDGTAET-EEKIKE
SYP_CHLCH       -----QVNNYD-------DFKVAVEK-------------G-FVIAHWDGTVET-EAKIKE
SYP_SYMTH       L----HINTLA-------ELKAHIAR------CEETGEIAGFVLAGWCGDAAC-EAKVKE
SYP_HALMA       E-----AESRE-------EILGTIGQHGG------------YVKCGWCGDEDC-EEPIKD
SYP_NATPD       K-----AHGRG-------EILGTLGQHGG------------YVKTGWCGDEAC-EAEIKD
SYP_HALSA       E-----ADNRA-------DILGTIGQHGG------------YVKAPWCGDQDC-EAEIKD
SYP_METAC       D-----CTELE---------EVKEKIQKG------------VATIPWCGKKECGLAMEDR
SYP_METMA       D-----CVDLD---------EVKEKIQEG------------VATIPWCGKRECGLAMEDH
SYP_METBF       E-----CTELE---------EVKNKIQDG------------VATIPWCGKRECGRAMEDV
SYP_METHJ       M-----VKEES---------LVNEMVSKG------------VVAVHWCGNRECADRLEEI
SYP_ARCFU       F-----VENTG---------EIEE--WGG------------VVAVYLCSDEDCGHSVEEH
SYP_METJA       I-----LEDIN-----PDEIKNILSEKRG------------VILVPFK-EEIYNEELEEK
SYP_METMP       V-----LDFENDVNSLSEKVKAKLLENKG------------IILIPFN-ESIYNEEFEEL
SYP_METTH       E-----AETLE-------EASRIVDEKRG------------IISFMWCGEEECGMDVEEK
SYP_METST       A-----IEKPE-------QIKKTINKKGG------------IITCSWCGETDCGKDMEEK
SYP_METKA       R-----TDSPE-------EARRLVGE--G------------IVETGWCGSERCGVRMEEE
SYP_PYRAB       R-----VETLE-------EAKKAFEDRRG------------IVEIPWCGEESCGLKMEEE
SYP_PYRHO       R-----VDTLE-------EAKAVFEDRRG------------IVEIPWCGEESCGLKMEEE
SYP_PYRFU       R-----VDTIE-------EAKELFNDRRG------------IVEIPWCGEEECGLKMEEE
SYP_THEKO       R-----VDTIE-------EAKAVFEDRRG------------IVEIPWCGEEECGLRMEEE
SYP_SULAC       Y-----TDNLE-------EAKKMLDSKAG------------IVEVPWCESNECGLKIEET
SYP_SULTO       Y-----TEDLN-------EAKKILEERAG------------VVEVPWCGDNNCGLQLQDV
SYP_SACS2       Y-----SNDIE-------KAKKILGNNSG------------IVEVPWCGSNECGLKIEEL
SYP_AERPE       R-----TESLE-------EARDWVEGRRG------------IAEIPWCGRESCGLEMEER
SYP_PYRAE       K-----AEDIE-------VAKAAIKEGK-------------VVEIPWSGDNDCGIKIQEL
SYP_THEAC       R-----ATKLEE------------FNRDG------------LITAFWCGSKECSDKIEAE
SYP_THEVO       S-----ASSLDD------------FKKEG------------LIKAFWCGSKECSDKIENE
SYP_PICTO       F-----IDDINNI----------PMNKDV------------LIKAYWCGSRECSDALEQK
                                                                            

SYP_DEIRA       DTKATARNVPFDDAE-------------FFAERGEGQCVKCGQ--------------PSA
SYP_DEIGD       DTKATTRNIPLDDAE-------------FFNEREEGVCVKCGQ--------------PSA
SYP_THET8       ETTATTRCVPFE------------------AEPEEGFCVRCGR--------------PSA
SYP_THET2       ETTATTRCVPFE------------------AEPEEGFCVRCGR--------------PSA
SYP_MYCLE       ETAATPRCVPRQ------------------GAPATGRCIRCDA--------------PSA
SYP_FRACC       EEALTVRCIQTP----------------------DG-GIPEAG--------------SDA
SYP2_STRAW      EHAASVRCLVAE----------------------DG-SVPGA---------------DDA
SYP2_BACCZ      EVGVSSRCMPFEQE------------------HLADECVCC----------------GKE
SYP2_BACHK      EVGVSSRCMPFEQE------------------HLADECVCC----------------GKE
SYP2_BACC1      EVGVSSRCMPFEQE------------------HLANECICC----------------GKE
SYP2_BACCR      EFGVSSRCMPFEQE------------------HLAEECICC----------------GKE
SYP2_BACAN      E--VASRCMPFEQE------------------HLAEECVCCVNKWCIGEKRINALLDRKD
SYP_OCEIH       ETTATSRCIPYEEE------------------KVADTCVCC----------------GKK
SYP_ACESD       DTGVTIRCIPFVQE------------------NLGETCQFC----------------GKP
SYP_MYCGE       KYQVSVRCVFKKSD-------------------VTQNCPFTNQ----------------P
SYP_MYCPN       RYQVTVRCCLEQLQ-------------------KPQICPFSGE----------------S
SYP_MYCGA       KTGASSRCIIKYLDE-----------------QTQERCFISNK----------------K
SYP_MYCPE       LTTATPRCFDWNQKI-----------------DKTKKCFFTNK----------------P
SYP_UREPA       LTNASTRCIFDETQ--------------------NGQCFYTNK----------------K
SYP_MYCH2       KTGATARCILPKNSF-----------------FALPQTGNSIFSG-------------EK
SYP_MYCHJ       KTGATARCILPKNSF-----------------FALPQTGNSIFSG-------------EK
SYP_MYCH7       KTGATARCILPKNSF-----------------FALPQAGNSIFSG-------------EK
SYP_MYCPU       ETGATARCIPFDYQK-----------------PGENKCLICKC----------------M
SYP_MYCS5       ETGATPRCILKKVKP-----------------RGVKLECVCKSDGCCD---------DDK
SYP_MYCMO       ETFATPRCIPLNFIG-----------------ETKKCIMTNK-----------------E
SYP_MYCCT       KTLTNSRCIPFDQK------------------EVKAKCFNCKK----------------D
SYP_MYCMS       KTATNSRCIPFDQK------------------EVKAKCFNCKK----------------D
SYP_MESFL       QTSTNSRCIPFDQD------------------NKTEKCFNCNK----------------D
SYP_AYWBP       ETGATARVILETNL-------------------ITANCPVTNK----------------K
SYP_ONYPE       ETGATARVILETNL-------------------ITANCPVTNK----------------K
SYP_BORBU       ETKATIRCIPDDF---------------KARDLTGMTCIYCSS----------------K
SYP_BORBP       ETKATIRCIPDDF---------------KAKDLTGMACIYCAS----------------R
SYP_BDEBA       -LKVTPRCMPLD------------------QEPVQGNCIFSGK----------------P
SYP_RHOBA       -LKVTIRCVPRS------------------DNATEGTCFLTGK----------------P
SYP2_ANADE      DLGVTVRCIPLE------------------PG-EPGTCAFTGQ----------------P
SYP_MAGSA       -YSITIRNVPFD------------------QDGEAGTCVLSGR----------------P
SYP_PARUW       -LKVTIRCLPVK------------------QSGTKGRCILTGR----------------E
SYP_NOVAD       -LKLTIRNTPMD------------------AEKPVGACPFTGE----------------P
SYP_SPHEL       -LKLTFRNVPGT------------------AAPAEGTCLFTGK----------------P
SYP_BACFN       ETKATIRCIPFES--------------FVEGDKEPGKCMVTGK----------------P
SYP_BACFR       ETKATIRCIPFES--------------FVEGDKEPGKCMVTGK----------------P
SYP_BACTN       DTKATIRCIPFDS--------------YVEGDKEPGKCMVTGK----------------P
SYP_PORGI       ETKATIRCIPLN------------------GDMTPGKCMVTGK----------------P
SYP_SALRD       ETSATIRLIPFD-----------------REDHEEGEDMLTGE----------------P
SYP_CHLTE       ETKATIRVIPTDEEYR-----------QQYNMDEPGTCIRSGK----------------P
SYP_PELLD       ETKATIRVLPEEDGYI-----------ERYRMNEPGTCIYSGK----------------P
SYP_CHLCH       ETKATIRVLPQEDDYC-----------DTYGINEPGTCIYSGK----------------P
SYP_SYMTH       ETKFTSRNIPFH------------------PPARKQVCLCCGK----------------E
SYP_HALMA       AIAAEIVMVPLDRD--------------EEPIHE--DCAICGE----------------D
SYP_NATPD       EIAAEIVMLPLDED--------------EPPVYD--TCGVCGD----------------E
SYP_HALSA       QIAAEIVMVPLGEDSAARAASELEGERVPEPDHDGEDCAICGD----------------E
SYP_METAC       IGAGILGIPLTPR-----------------GKGKE-KCPVCG----------------AE
SYP_METMA       IGAGILGIPLTPR-----------------SKGKE-KCPACG----------------EE
SYP_METBF       IGAGILGIPLEQK-----------------RDRKE-KCPICG----------------EE
SYP_METHJ       ADASVLGTEVRTDLI---------------DQTPG-TCIICK----------------KP
SYP_ARCFU       GKSLLGWFEEVPDWL---------------DLEPEGKCVVCG----------------RE
SYP_METJA       VEATILGE--------------------------------TE----------------YK
SYP_METMP       IDASVLGL--------------------------------TT----------------YE
SYP_METTH       VRVDILGI--QEE--------------------GSGTCINCG----------------RE
SYP_METST       FDIDVLGT--QES------------------DLENKTCINCG----------------KD
SYP_METKA       FGGDVLGTPYPEE------------------DTEFERCPICG----------------ET
SYP_PYRAB       LDAKMLGIPYPEEKA---------------KAPEGSRCPVCG----------------RD
SYP_PYRHO       LEAKMLGIPYPEEKA---------------KAPEGSKCPVCG----------------RE
SYP_PYRFU       LEAKMLGIPYPEESA---------------RV-EGKKCPVCG----------------RE
SYP_THEKO       LDAKMLGIPYPEEKA---------------KAPEGKKCPVCG----------------RE
SYP_SULAC       TGARVLGKPYDSPRD---------------VSKS--TCVVCK----------------KP
SYP_SULTO       TNARVLGIPLDEDKD---------------VSNA--KCVMCK----------------KP
SYP_SACS2       TNARVLGYPIE--KR---------------EVND--KCVICK----------------MN
SYP_AERPE       VNGKVLGTPWPEEPV---------------EEGK--RCPLCG----------------RP
SYP_PYRAE       VGADALGIPLDADAS---------------VGGYDLRDLACKE---------------RR
SYP_THEAC       TEKSVLGFMVDSS--------------------ETGKCVVCG-----------------K
SYP_THEVO       TEKSALGFNLNND--------------------ETGKCIVCG-----------------K
SYP_PICTO       KDVTALGTLYNLN--------------------DSGKCIVCG-----------------N
                                                                            

SYP_DEIRA       YGKRVLFGRQY------------------
SYP_DEIGD       YGKRVIFGRQY------------------
SYP_THET8       YGKRVVFAKAY------------------
SYP_THET2       YGKRVVFAKAY------------------
SYP_MYCLE       YDKRVIFARAY------------------
SYP_FRACC       DDLVCLIARSY------------------
SYP2_STRAW      PGNVAVVARAY------------------
SYP2_BACCZ      AKQMVYWGKAY------------------
SYP2_BACHK      AKQMVYWGKAY------------------
SYP2_BACC1      AKQMVYWGKAY------------------
SYP2_BACCR      AKQMVYWGKAY------------------
SYP2_BACAN      EKDFGLHNKCNPKSFLVLQFVSCIFKMEG
SYP_OCEIH       AKELVYWARAY------------------
SYP_ACESD       AKHMVYLAKAY------------------
SYP_MYCGE       CFDSVLIARAY------------------
SYP_MYCPN       AQDYVLIARAY------------------
SYP_MYCGA       AKVEIYFARSY------------------
SYP_MYCPE       NAKLVYFARAY------------------
SYP_UREPA       TNKLTLFARAY------------------
SYP_MYCH2       TNKFVLFAKSY------------------
SYP_MYCHJ       TNKFVLFAKSY------------------
SYP_MYCH7       TNKFVLFAKSY------------------
SYP_MYCPU       TKRFVLFARAY------------------
SYP_MYCS5       AIKYVVFARAY------------------
SYP_MYCMO       TKRYVIFAKSY------------------
SYP_MYCCT       TCLQVIFARAY------------------
SYP_MYCMS       TCLQVIFARAY------------------
SYP_MESFL       TTLKVYFARAY------------------
SYP_AYWBP       ALQTVLFARAY------------------
SYP_ONYPE       ALQTVLFARAY------------------
SYP_BORBU       AKYFVLFAKSY------------------
SYP_BORBP       AKYFVLFAKSY------------------
SYP_BDEBA       ATKWVLFAKSY------------------
SYP_RHOBA       AAQRAIFAKAY------------------
SYP2_ANADE      SPKRVVWAKSY------------------
SYP_MAGSA       ATQEVIFAKSY------------------
SYP_PARUW       ATLDAIFAKSY------------------
SYP_NOVAD       AVEKILIARSY------------------
SYP_SPHEL       AVERILVARAY------------------
SYP_BACFN       SACRVIFARSY------------------
SYP_BACFR       SACRVIFARSY------------------
SYP_BACTN       SACRVVFARSY------------------
SYP_PORGI       SPQRVLFARAY------------------
SYP_SALRD       SEGRVLFAQAY------------------
SYP_CHLTE       AAQKVVFAKAY------------------
SYP_PELLD       AAQKVVFAKAY------------------
SYP_CHLCH       SARKVVFAKAY------------------
SYP_SYMTH       AQHTVWFARAY------------------
SYP_HALMA       AEETAYFAKSY------------------
SYP_NATPD       ATETAYFAKSY------------------
SYP_HALSA       ATRTAYFAKSY------------------
SYP_METAC       TETRVYVARTY------------------
SYP_METMA       TETRVYVARTY------------------
SYP_METBF       TETRVYVARTY------------------
SYP_METHJ       ESVVTLIGRSY------------------
SYP_ARCFU       -GRLAALAKTY------------------
SYP_METJA       GNKYIAIAKTY------------------
SYP_METMP       GKEYISVARTY------------------
SYP_METTH       APTGLTLPEHIS-----------------
SYP_METST       ASYKVLISKTY------------------
SYP_METKA       AEYTVRIAKTY------------------
SYP_PYRAB       AKFIARFARTY------------------
SYP_PYRHO       AKFIARFARTY------------------
SYP_PYRFU       AKFIARFARTY------------------
SYP_THEKO       AKFIARFARTY------------------
SYP_SULAC       AKTTLRLAKTY------------------
SYP_SULTO       AKSLLRLAKTY------------------
SYP_SACS2       AKTVLRIAKTY------------------
SYP_AERPE       AVAWIRLAKTY------------------
SYP_PYRAE       AELWLRLSERY------------------
SYP_THEAC       NGKMAVFSRSY------------------
SYP_THEVO       AGKLAIFSRSY------------------
SYP_PICTO       PGRLSMFARSY------------------
                        .