CLUSTAL format seed alignment for MF_01576

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

FOLD_BACSU       ---------------MTATIIDGKETAREKREQLAKEVEELKK-Q-GVTPGLAVILIGDD
FOLD_BACLD       ---------------MTATIIDGKETAKEKRGQLAKEVEELKK-Q-GVTPGLAVILIGDD
FOLD_BACCZ       ---------------MVAVIIKGNEVAEKKRAQLKEEVVKLKE-Q-GIVPGLAVILVGED
FOLD_BACHK       ---------------MVAVIIKGNEVAEKKRAQLKEEVVKLKE-Q-GIVPGLAVILVGED
FOLD_BACAN       ---------------MVAVIIKGNEVAEKKRAQLKEEVVKLKE-Q-GIVPGLAVILVGED
FOLD_BACC1       ---------------MVAVIIKGNEVAEKKRAQLTEEVVKLKE-Q-GIVPGLAVILVGED
FOLD_BACCR       ---------------MVAVIIKGNEVAEKKRAQLTEEVVKLKE-Q-GIVPGLAVILVGED
FOLD_GEOKA       ---------------MTAQIISGTEMARTIRTALADEAAQLKA-D-GVEPGLAVILVGDD
FOLD_BACHD       ---------------MSAVLLDGKALAAKKRDELKSEVTKLKE-R-GITPGLAVILVGND
FOLD_OCEIH       ----------------MATLLNGKELSEELKQKMKIEVDELKE-K-GLTPHLTVILVGDN
FOLD_LISMF       ----------------MGEIIDGKKLAKEIQEKVTREVAELVK-E-GKKPGLAVVLVGDN
FOLD_LISMO       ----------------MGEIIDGKKLAKEIQEKVTREVAELVK-E-GKQPGLAVVLVGDN
FOLD_LISIN       ----------------MGEIIDGKKLAKEIQEKVTSEVAELVK-Q-GKKPGLAVVLVGDN
FOLD_STAA3       ---------------MVAKILDGKQIAKDYRQGLQDQVEALKE-K-GFTPKLSVILVGND
FOLD_STAAC       ---------------MVAKILDGKQIAKDYRQGLQDQVEALKE-K-GFTPKLSVILVGND
FOLD_STAAS       ---------------MVAKILDGKQIAKDYRQGLQDQVEALKE-K-GFTPKLSVILVGND
FOLD_STAAW       ---------------MVAKILDGKQIAKDYRQGLQDQVEALKE-K-GFTPKLSVILVGND
FOLD_STAA8       ---------------MVAKILDGKQIAKDYRQGLQDQVEALKE-K-GFTPKLSVILVGND
FOLD_STAAM       ---------------MVAKILDGKQIAKDYRQGLQDQVEALKE-K-GFTPKLSVILVGND
FOLD_STAAN       ---------------MVAKILDGKQIAKDYRQGLQDQVEALKE-K-GFTPKLSVILVGND
FOLD_STAAB       ---------------MVAKILDGKQIAKDYRQGLQNQVEALKE-K-GFTPKLSVILVGND
FOLD_STAAR       ---------------MVAKILDGKQIAKDYRQGLQNQVEALKE-K-GFTPKLSVILVGND
FOLD_STAHJ       ---------------MVAKILDGKQISKDYRQGLQEQVEALKE-K-GYTPKLSVILVGND
FOLD_STAEQ       ---------------MVAKILDGKQIAKEYRQRLKNQVNDLKE-Y-GFTPKLSVILVGND
FOLD_STAES       ---------------MVAKILDGKQIAKEYRQRLKNQVNDLKE-Y-GFTPKLSVILVGND
FOLD_STAS1       ---------------MVAKILDGKQIAKDYRQGLKDQVEALQA-E-GYTPKLSVILVGND
FOLD_STRTR       ----------------MAIIMDGKALAVNMQEQLQEKVARLKE-KEWIVPGLVVIMVGEN
FOLD_STRT1       ----------------MAIIMDGKALAVNMQEQLQEKVARLKE-KEWIVPGLVVIMVGEN
FOLD_STRT2       ----------------MAIIMDGKALAVNMQEQLQEKVARLKE-KEWIVPGLVVIMVGEN
FOLD_STRA1       ----------------MTELIDGKALSQKMQAELGRKVERLKE-QHGIIPGLAVILVGDN
FOLD_STRA3       ----------------MTELIDGKALSQKMQAELGRKVERLKE-QHGIIPGLAVILVGDN
FOLD_STRA5       ----------------MTELIDGKALSQKMQAELGRKVERLKE-QHGIIPGLAVILVGDN
FOLD_STRMU       ----------------MTEIIDGKALAQKLQLHLANKVEQMKE-KHGLVPGLVVILVGDN
FOLD_STRP8       ----------------MTELIDGKALAQKMQQELAAKVNNLKQ-KKGIVPGLAVILVGDD
FOLD_STRPM       ----------------MTELIDGKALAQKMQQELAAKVNNLKQ-KKGIVPGLAVILVGDD
FOLD_STRP1       ----------------MTELIDGKALAQKMQQELAAKVNNLKQ-KKGIVPGLAVILVGDD
FOLD_STRP3       ----------------MTELIDGKALAQKMQQELAAKVNNLKQ-KKGIVPGLAVILVGDD
FOLD_STRP6       ----------------MTELIDGKALAQKMQQELAAKVNNLKQ-KKGIVPGLAVILVGDD
FOLD_STRPB       ----------------MTELIDGKALAQKMQQELAAKVNNLKQ-KKGIVPGLAVILVGDD
FOLD_STRPC       ----------------MTELIDGKALAQKMQQELAAKVNNLKQ-KKGIVPGLAVILVGDD
FOLD_STRPD       ----------------MTELIDGKALAQKMQQELAAKVNNLKQ-KKGIVPGLAVILVGDD
FOLD_STRPF       ----------------MTELIDGKALAQKMQQELAAKVNNLKQ-KKGIVPGLAVILVGDD
FOLD_STRPN       ----------------MTQIIDGKALAAKLQGQLAEKTAKLKE-ETGLVPGLVVILVGDN
FOLD_STRR6       ----------------MTQIIDGKALAAKLQGQLAEKTAKLKE-ETALVPGLVVILVGDN
FOLD_ENTFA       ----------------MSTVINGRELADQMQAEIQKDVEKMTQ-Q-GIQPGLVVLLVGEN
FOLD_LACLA       -----------------MNLIDGKALAAKMQAELKVKVDKLKE-A-DNVPGLAVILVGED
FOLD_LACS1       ---------------MVATILDGRMLSKKIRTNVSEKVSLLKQ-E-GITPKLVVILVGED
FOLD1_LACJO      ----------------MTNIINGRQIAKQLNQETKTRVDKLKE-E-GIIPGIVVILVGDD
FOLD_LACPL       ----------------MTKIIDGKAVAKKVNAQTATAVAELAA-Q-GIQPGIAVIIVGDD
FOLD_LACSS       -----------------MELLDGRALANELTHAQQTAVETLKE-Q-GVTPKLVVIMVGDD
FOLD_RICCN       ----------------MNNIIDGKALANEILADLKLEIQELTS-QTNASPKLAIVLVGDN
FOLD_RICFE       ----------------MNNIIDGKALANEILADLKLEIQELKS-QTNTSPKLAIVLVGDN
FOLD_RICPR       ---------------MVNNIIDGKALANEILADLKLEIQGFKE-KTKTSPKLAIVLVGDN
FOLD_RICTY       ----------------MNNIIDGKALANEILADLKLEIQGFKE-KTQTSPKLAIVLVGDN
FOLD_RICBR       ----------------MNNVIDGKALANEILSELKHEVQRLKD-KTGESPKLAIVLVGDN
FOLD_PELUB       -----------------MILIDGKKIAAELREQLRQEVVELKA-KHNKIPGLTVILIGEM
FOLD_ANAMM       ----------------MREIIDGKLVARGLLDRLRVSVDRLKA-EHGIVPHLVVVIVGDD
FOLD_ANAPZ       ------------MGIYENNIIDGKAAAADLLGRLKVVMEGLKE-EHGLFPSLVVIIVGDD
FOLD_EHRCJ       ---------------MEANIINGKAIAEDITGTLATCINDLKL-QYSLVPCLIVVLVGDD
FOLD_EHRCR       ---------------MEENIINGKVIAEDITSTLAVCINDLKV-QHNVTPCLIVILVGDD
FOLD_EHRRG       ---------------MEGNIVSGKAVADNITNILATCISDLKV-QHNLTPCLIVVLVGDD
FOLD_EHRRW       ---------------MEGNIVSGKAVADNITNILATCISDLKA-QHNLTPCLIVVLVGDD
FOLD_WOLPM       ----------------MTIIIDGKKIANDLCERLSQKIDILKR-EYNIFPCLKVILIGSN
FOLD_WOLTR       ----------------MTIIIDGKKIASGLCEKLSQRIDVLKR-EHSIFPCLKVIFVGNN
FOLD_NEOSM       ----------------MTQLIDGFRIAAGICESIATSVAHLRK-NNGLVPSLRVIIVGEN
FOLD2_PSE14      ---------------MSARIIDGKAAAARVLEQVSTEVKILKA-D-GIEPALAVILVGND
FOLD2_PSESM      ---------------MSARIIDGKAAAARVLGQVRDDVHTLKA-E-GIEPALAVILVGND
FOLD2_PSEU2      ---------------MSAHIIDGKAAAARVLQQVRHDVNILKA-E-GIEPALAVILVGND
FOLD1_ACIAD      -------MSLALLQQHSPKIIDGKAIAQSVLEEVKLEVERYKA-Q-GIEPCLAVVLVGED
FOLD_GLUOX       -----MSMLSPEKPSEPAKIIDGKGIARALTDQVGREVAKFVE-QGNTIPGLAVVLVGND
FOLD1_PSEPK      ---------------MTAQLIDGKALAAQVRQEVEEGVAAFIA-DGWAAPGLAVVLVGCD
FOLD_SPHCR       ----------------MASIISGTAAAEGLLADLTRDVARFSQ-VHGYAPTLVAVLVGDD
FOLD_METC4       ---------------MIAQVIDGRAEAARLTDNVRARAHRFTD-EFGRCPGLAVVLIGDD
FOLD1_RHIEC      ----------------MATVIDGKNVAASVIQTVKSATAALEK-ASGVTTGLAVIIVGDD
FOLD2_RHIEC      ----------------MVEVIDGKLIAASVIQTVKSATAALEM-VSGVTTGLAVIIVGDD
FOLD_RHIL3       ----------------MTTVIDGKNVAASVIQTVKSATAALEK-SSGVTTGLAVVIVGDD
FOLD_RHILT       ----------------MTTVIDGKNVAASVIQTVKSATAALEK-SSGVTTGLAVVIVGDD
FOLD2_RHIME      ----------------MTTVIDGKNVAASVIETVKSATSALES-ETGVRAGLAVVIVGDD
FOLD1_RHIME      ----------------MTTIIDGKAVAASINGAIKDANAELQE-QTGRKTGLSVIIVGDD
FOLD_AGRFC       ----------------MAVVIDGKAKAASVTEAVRKSAEALEA-EKGVKPGLAVVIVGND
FOLD_BARHE       ----------------MNNIIDGKKLAEKIIMKVKAETTKLRN-NYKIQPGIAVIIVGND
FOLD_BARQU       ----------------MNNIIDGKKLAEEIIVKVKAETIKLRN-NYKIQPGIAVIIVGDD
FOLD_BRUA2       ----------------MAQLIDGKKLAEDVVSTVKTETEKLVA-ATGVVPGIAVVIVGED
FOLD_BRUAB       ----------------MAQLIDGKKLAEDVVSTVKTETEKLVA-ATGVVPGIAVVIVGED
FOLD_BRUME       ----------------MAQLIDGKKLAEDVVSTVKTETEKLVA-ATGVVPGIAVVIVGED
FOLD_BRUSU       ----------------MAQLIDGKKLAEDVVSTVKTETEKLVA-ATGVVPGIAVVIVGED
FOLD1_RHILO      ----------------MAEVIDGKSVAEDVVRTVKALTAELVA-KGKAKPGLAVVIVGED
FOLD_CHESB       ----------------MVQIIDGKAVAATILEKVTRETQDLKA--NGVTPGLAVVIVGED
FOLD_SINFN       -------------MSIGCKLISGREVAESIIDQVKAHTVALSA--NGITPGLAVIIVGSD
FOLD_NITHX       ---------------MTASIIDGKVIAADLRARVAFEVARVKR-DHGLTPGLAVVLVGSD
FOLD_NITWN       ---------------MAASIIDGKVIAADLRARVAGEVTRIKR-DHGLTPGLAVVLVGND
FOLD_BRADU       ---------------MTAKIIDGKVIAADLRARVADEVARVKR-EHNLVPGLAVVLVGND
FOLD_RHOP2       ---------------MTATIIDGKIISAELRARVAAEVTRIKA-DHGITPGLAVVLVGSD
FOLD_RHOPS       ---------------MTARIIDGKIISADLRGRVAAEVTRIKA-EHGITPGLAVVLVGSD
FOLD_RHOPB       ---------------MTARIIDGKTISAELRGKLADEVARVVR-DHGVTPGLAVVLVGSD
FOLD_RHOPA       ---------------MTARIIDGKTISAEVRARVAAEVTRLKT-DHGITPGLAVVLVGND
FOLD2_ROSDO      ---------------MAATIIDGKAFAAKVRAQVAEHVTRIKQ-DHGITPGLAVVLVGED
FOLD_RUEST       ---------------MAAEIIDGKAFAAKVRGQVTEHVTRLKE-EHGITPGLAVVLVGED
FOLD1_ROSDO      ---------------MSATLIDGKAFAARVRAQVAEHVTRLKA-DHGITPGLAVVLVGQD
FOLD1_RUEPO      ---------------MAATVIDGKAFAARIRGQVAEHVAELKA-GHGITPGLAVVLVGED
FOLD_RHOS4       ---------------MTAKRIDGKAFAAGVRARVAEEVARLKE-GHGIVPGLAVVLVGED
FOLD_JANSC       ------MTEPQTNRTSGAKIIDGKAFAADVRGQVAGHVQRLKD-EHGITPGLAVVLVGED
FOLD_MAGSA       --------------MTDAKLIDGNLFSAKLRETITARVAEMKA-AHHITPGLAVVLVGED
FOLD_NOVAD       ---------------MTAAVIDGKAFAATLRGRVGDLATAFEA-RAGRKAGLAVVLVGED
FOLD_SPHAL       ----------MTGPVPDARVIDGKAFAAGLRARIADAVPAFRA-ATGRAPGLAVVLVGDD
FOLD_CAUVC       --------------MAQAKLIDGKAFAADLRAKIAEEVAALKA-EHGVTPGLAVVLVGED
FOLD_ZYMMO       --------------MTEAIIIDGKEFSSNLRNKIAEDVKAFKK-ERNVVPGLAVVLVGED
FOLD_RHORT       ---------------MGAHLIDGKAIAQQLRERIAQEVADLKA-HRGLVPGLAVVLVGED
FOLD_HYPNA       ---------------MTATRLDGNAVAADVRSAV----AAAVS-ALPGQPCLAVVLVGED
FOLD_MARMM       ---------------MSAHLIDGKAIAAEIDARAGEVGAKLAS-SLGRPPCLAVVLVGED
FOLD_CHLTR       ------------------MLLKGAPAADHILATIKENIRAC-----SKAPGLAVVLIGNN
FOLD_CHLTA       ------------------MLLKGAPAADHILATIKENIRAC-----SKAPGLAVVLIGNN
FOLD_CHLMU       ------------------MLLKGAPAADGILATVKDNIRSQ-----SGSPGLAVVLIGNN
FOLD_CHLAB       ------------------MLLKGTPVAERVLEKIKQEISHS-----STPPGLAVVLIGND
FOLD_CHLCV       ------------------MLLKGAPVAERVLNKIKQEISNS-----STRPGLAVVLIGND
FOLD_CHLFF       ------------------MLLKGTPVAERILEKLKQKISQS-----PTPPGLAVVLIGND
FOLD_CHLPN       ------------------MLLRGIPAAEKILQRLKEEISQS-----PTSPGLAVVLIGND
FOLD_PARUW       ------------------MIIDGKRIAEEIQLEIKELIQQSL----CRPPCLAVLIVGSH
FOLD_BACFN       -----------------MTLIDGKAISEQVKQEIAAEVAEIVA-HGGKRPHLAAILVGHD
FOLD_BACFR       -----------------MTLIDGKAISEQVKQEIAAEVAEIVA-HGGKRPHLAAILVGHD
FOLD_BACTN       -----------------MTLIDGKAISEQVKQEIAAEVAEIVA-RGGKRPHLAAILVGHD
FOLD_PORGI       -------------METTYKLLDGKKISGEIKQEIAAVVNELLE-KGGRRPHLAGVLVGHD
FOLD_CYTH3       -----------------MQLLDGKITSDQIKEELKTKVEAIKA-KGGKIPHLAAVLVGDS
FOLD1_GEOMG      -----------------MKLLDGKKCAESLVADIARKVAGYEE-SGLRKPHMTVILVGEH
FOLD1_GEOSL      -----------------MNLLDGKKCAESLVAEIARKVAGYTE-SGLRTPHMTIILVGEH
FOLD_CHLCH       -----------------MIVIDGKKVSLELKNELRERVEALNA-KCGKVPGLTVIIVGED
FOLD_PELLD       -----------------MLIIDGKKVSLDMKEELKASVESYRS-ITGKVPGLTVIIVGSD
FOLD_HELPY       ------------MPNRGVVLLDGQALADNIEKDLKHKIQIITA-QTHKRPKLAVILVGKD
FOLD_HELPH       ------------MPNRGVVLLDGQALAYDIEKDLKNKIQTITA-QTHKRPKLAVILVGKD
FOLD_HELPJ       ------------MPNRGVVLLDGQALAYNIEKDLKNKIQIITA-QTHKRPKLAVILVGKD
FOLD_HELHP       -----------------MTLLDGKSLSVTIERDLTEQIAALVS-QGVT-PGLAVILVGNN
FOLD_SULDN       -----------------MQLLDGKALSAKIETTVAKEVKELKN-STNLVPGLAVILVGQD
FOLD_WOLSU       -----------------MQLLDGKALSLEIEAKVKEEVMILTS-SRGVTPGLAVILVGSD
FOLD_CAMJE       -----------------MTLLDGKALSAKIKEELKEKNQFLKS--KGIESCLAVILVGDN
FOLD_CAMJR       -----------------MTLLDGKALSAKIKEELKEKNQFLKS--KGIESCLAVILVGDD
FOLD_AQUAE       ----------------MALILDGKSLSKKIREEIKKEVENFTS-KGFRPPALAVILVGND
FOLD_FUSNN       ------------------MLMDGKELARDIKVKIKAEIDNIKK-IHNINPMVATILVGDD
FOLD_FRAT1       -----------------MILIDGKSLSKDLKERLATQVQEYKH-HTAITPKLVAIIVGND
FOLD_FRATT       -----------------MILIDGKSLSKDLKERLATQVQEYKH-HTAITPKLVAIIVGND
FOLD_FRATH       -----------------MILIDGKSLSKDLKERLATQVQEYKH-HTAITPKLVAIIVGND
FOLD_FRATO       -----------------MILIDGKSLSKDLKERLATQVQEYKH-HTAITPKLVAIIVGND
FOLD_MYCCT       -----------------MVILDGKLVSKTRKQLVKQQIDIYLN-KGYRKPKLAVILIGND
FOLD_MYCMS       -----------------MVILDGKLVSKQIKQTLKKQIDTYLN-KNYKKPKLAVILIGND
FOLD_MESFL       -----------------MIILDGKKVASRRKEELTAKISKYHN-KGLRKPKLVVIMVGND
FOLD_SPICI       --------------MDKTKIIDGKMVSELIKAKITEQILKIKA-KKQRVPALTIIQIGNN
FOLD_BUCAI       ---------------MPAIIIDGNKIAKKIELKILKKVKQRKK-NGERIPGLAMILVGNH
FOLD_BUCAP       ---------------MSAIIIDGIKIAKKIELNLLKKIEEREK-NKKRIPGLAVILIGKN
FOLD_BUCBP       ---------------MLKKVLNGTRIAKKLEFKILKQVNYKLS-LGQRPPGLAVILIGSN
FOLD_BLOFL       ---------------MNTKIIDGTYIAERIKKDITQKVYADMN-MGKRAPGLAMLLIGNN
FOLD_BLOPB       ---------------MIAKIIDGKYVSEKIKQEIAKQVRKNMN-SGKRAPGLAMILVGHN
FOLD_WIGBR       ---------------MIAKVINGKNIAKKIISKINLKIKKYSK-LGMRPASLAMINVGNN
FOLD_ECOLI       ---------------MAAKIIDGKTIAQQVRSEVAQKVQARIA-AGLRAPGLAVVLVGSN
FOLD_SHIDS       ---------------MAAKIIDGKTIAQQVRSEVAQKVQARIA-AGLRAPGLAVVLVGSN
FOLD_SHIFL       ---------------MAAKIIDGKTIAQQVRSEVAQKVQARIA-AGLRAPGLAVVLVGSN
FOLD_SHISS       ---------------MAAKIIDGKTIAQQVRSEVAQKVQARIA-AGLRAPGLAVVLVGSN
FOLD_SHIBS       ---------------MAAKIIDGKTIAQQVRSEVAQKVQARIA-AGLRAPGLAVVLVGSN
FOLD_ECO57       ---------------MAAKIIDGKTIAQQVRSEVAQKVQARIA-AGLRAPGLAVVLVGSN
FOLD_ECOL5       ---------------MAAKIIDGKTIAQQVRSEVAQKVQARIA-AGLRAPGLAVVLVGSN
FOLD_ECOL6       ---------------MAAKIIDGKTIAQQVRSEVAQKVQARIA-AGLRAPGLAVVLVGSN
FOLD_ECOUT       ---------------MAAKIIDGKTIAQQVRSEVAQKVQARIA-AGLRAPGLAVVLVGSN
FOLD_SALTY       ---------------MAAKIIDGKTIAQQVRSEVAQKVQARVA-AGLRAPGLAVVLVGSN
FOLD_SALCH       ---------------MAAKIIDGKTIAQQVRSEVAQKVQARVA-AGLRAPGLAVVLVGSN
FOLD_SALPA       ---------------MAAKIIDGKTIAQQVRSEVAQKVQARVA-AGLRAPGLAVVLVGSN
FOLD_SALTI       ---------------MAAKIIDGKTIAQQVRSEVAQKVQARVA-AGLRAPGLAVVLVGSN
FOLD_PHOLL       ---------------MPAKIIDGKTIAQTIRSEVAVRVQQRVA-AGRRAPGLAVVLVGEN
FOLD_YERPA       ---------------MSAKIIDGKTIAQQVRNEVAAVVQQRLA-AGKRAPGLAVVLVGEN
FOLD_YERPE       ---------------MSAKIIDGKTIAQQVRNEVAAVVQQRLA-AGKRAPGLAVVLVGEN
FOLD_YERPN       ---------------MSAKIIDGKTIAQQVRNEVAAVVQQRLA-AGKRAPGLAVVLVGEN
FOLD_YERPS       ---------------MSAKIIDGKTIAQQVRNEVAAVVQQRLA-AGKRAPGLAVVLVGEN
FOLD_PECAS       ---------------MAAKIIDGKTIAQQVKDEVAARVTQRLA-EGKRAPGLAVVLVGDN
FOLD_SODGM       ---------------MVAKIIDGRAVAQQVRSEVAARIQARLK-AGKRAPGLAVVLVGGD
FOLD_BAUCH       ---------------MVAQIIDGKKIAQQIKSEVAHLVQMRIK-AGDAAPCLAVVLVGHD
FOLD_PHOPO       ---------------MSAQIIDGKIISQTVRQEVAARVKARTD-AGLRAPGLAVVLVGQD
FOLD_PHOPR       ---------------MAAQIIDGKLIAQTVRQEVAARVKARVE-AGLRAPGLAVVLVGQD
FOLD_VIBVU       ---------------MTAQNIDGTLISQTVRSEVAARVKARVA-AGLRAPGLAVVLVGED
FOLD_VIBVY       ---------------MTAQNIDGTLISQTVRSEVAARVKARVA-AGLRAPGLAVVLVGED
FOLD_VIBPA       ---------------MTAQNIDGTLISQTVRSEVAARVKARVA-AGLRAPGLAVVLVGED
FOLD_VIBCH       ---------------MTAQNIDGTLISQTVRSEVAARVKARVQ-AGLRAPGLAVVLVGED
FOLD_ALIF1       ---------------MTAQIIDGKLISQTVRSEVGARVKARVE-AGLRAPGLAVVLVGQD
FOLD_PSEHT       ---------------MTANIIDGKAIAKQVRSAVAQRVSERVA-QNLRAPGLAVVLVGLD
FOLD_IDILO       ---------------MPAQIIDGKTIAATVRQAVKQQVKERID-SGLRAPGLAVVLVGSD
FOLD_PSEA6       ---------------MPAQKIDGKLIAQQVRQHVKSHVESIVS-SGKRPPGLAVVLVGSD
FOLD_SHEDO       ---------------MTAQLIDGKAIAQTIRSTLKQKVAARIE-AGKRAPGLAVILVGLD
FOLD_SHEFN       ---------------MTAQIIDGKAIAQSIRTTLKQKVTQRRQ-AGFRAPGLAVILVGSD
FOLD_SHESM       ---------------MTAQIIDGKAIAQSIRTQLREKVTARKE-AGQRVPGLAVILVGAD
FOLD_SHESR       ---------------MTAQIIDGKAIAQSIRTQLREKVTARKE-AGQRVPGLAVILVGAD
FOLD_SHEON       ---------------MTAQIIDGKAIAQSIRTQLREQVTARKE-AGQRVPGLAVILVGAD
FOLD2_COLP3      ---------------MRASLIDGKAIAKKLRDSVKEEVNLRIS-NGQRVPGLAVILVGCD
FOLD_HAEIN       ---------------MAAKIISGTELSKQIKANLADKITHYIE-QGKRAPGLAVILVGAD
FOLD_HAEI8       ---------------MAAKIISGTELSKQIKANLADKITHYIE-QGKRAPGLAVILVGAD
FOLD_HAES1       ---------------MPAQIISGTELSKNIKFNVAEKIQHYLQ-QGKRAPGLAVILVGAD
FOLD_PASMU       ---------------MTAQVISGTELSKTIKSQVAQKIETYTQ-QGKRSPGLAVILVGAD
FOLD_MANSM       ---------------MTAQVISGSALAKKVKTEVGQKIEQYVA-QGKRAPGLAVILVGAD
FOLD_HAEDU       ---------------MAAKIISGINIAKQIKQNIAQKIAQYIV-NGYRRPGLAVILVGAD
FOLD_COXBU       ---------------MIARILDGRTCAEKVKARVKENIRLLQE-KGLPSPGLAVILVGND
FOLD_LEGPH       ---------------MPASLIDGREISALRRAELKQRVLYHVE-QGQRAPGLAVVLIGND
FOLD_LEGPL       ---------------MPASLIDGREISALRRTELKQRVQYHVE-QGQRAPGLAVVLIGND
FOLD_LEGPA       ---------------MPASLIDGREISALRRNELKQRVQHHVG-LGQRPPGLAVVLIGND
FOLD1_PSE14      ---------------MTAKLIDGKAIAASLRQQIAKRVAERSQ-QGLRTPGLAVILVGSD
FOLD1_PSESM      ---------------MTAKLIDGKAIAASLRQQIAKRVAERSQ-QGLRTPGLAVILVGSD
FOLD1_PSEU2      ---------------MTAKLIDGKAIAASLRQQIAKRVAERSQ-QGLRTPGLAVILVGSD
FOLD_PSEF5       ---------------MTAQLIDGKAIAASLRQQIAKRVAERRQ-QGLRTPGLAVILVGSD
FOLD_PSEPF       ---------------MTAQLIDGKSIAASLRQQIAQRVAERRQ-QGLRTPGLAVILVGSD
FOLD2_PSEPK      ---------------MTAHLIDGKAIAASLRQQIAQRVVERRQ-QGLRTPGLAVILVGTD
FOLD_PSEAE       ---------------MTAQLIDGKAIAANLRQQIAQRVTERRQ-QGLRVPGLAVILVGTD
FOLD_HAHCH       ------MTMTHAQNNHHARLIDGKQVAADVRANVAEGVKARID-SGLRPPGLAVVLVGED
FOLD_CHRSD       ---------------MTAQLIDGKAIAANVREQVSRQVQARRQ-EGKRAPGLAVVLVGED
FOLD_METFK       ---------------MTAQIINGKAIAEATLSETKSLIDKRLE-KGLRAPTLAVILLGSD
FOLD_NITOC       ---------------MSANILDGKAIAANIRRNIKKRVQERIT-AGLRPPGLAVILLGSD
FOLD2_HYDCU      ---------------MSAQVINGKVVAKTVIDRVKQRVQLRKS-QGLRAPGLAVILIGDD
FOLD_THIDA       ---------------MSARILDGKAMADTILAVIHDKVAEREV-QGKRRPGLAVILVGGD
FOLD_NEIMA       ---------------MSAQLINGKEVSQKRLQAVAEAVAQRQQ-DNLHMPCLAVVLVGGD
FOLD_NEIMB       ---------------MSAQLINGKEVSQKRLQAVAEAVAQRQQ-NNLHHPCLAVVLVGGD
FOLD_NEIG1       ---------------MSAQLINGKEVSQKHLQAIAEAVAQRQQ-DNLHTPCLAVVLVGGD
FOLD_CHRVO       ---------------MSAQLIDGKAVAEKLLEKVSAGVGERLA-QGKRAPALAVILVGDN
FOLD1_HYDCU      ---------------MSAQILDGKAIALELRDSIQKEVEAQVA-NGKKPPGLAVILVGED
FOLD_ALKEH       ---------------MSAQILDGKAIAAELREQVRKQVEARVE-RGGRRPGLAVVLVGAD
FOLD_XANAC       ------MTASAPAASASARLLDGRRIAEELLDGLKLRVDARVA-AGKARPGLAVVLVGGD
FOLD_XANC5       ------MTASAPAASASARLLDGRRIAEELLDGLKLRVDARLA-AGKARPGLAVVLVGGD
FOLD_XANOM       ------MTASAPAASTSARLLDGRRIAEELLDGLKSRVDARLA-AGKARPGLAVVLVGGD
FOLD_XANOR       ------MTASAPAASTSARLLDGRRIAEELLDGLKSRVDARLA-AGKARPGLAVVLVGGD
FOLD_XANC8       ------MTAPAPAALAPARLLDGRRIAEELLDGLKLRVDARLA-AGKTRPGLAVVLVGGD
FOLD_XANCP       ------MTAPAPAALAPARLLDGRRIAEELLDGLKLRVDARLA-AGKTRPGLAVVLVGGD
FOLD_XYLFA       ------MIVSMLAATDLARILDGRRIADDLLDALKTRVDARVA-AGKLPPTLAVVLVGSD
FOLD_XYLFT       ----------MLAATDLARILDGRRIADDLLDALKTRVDARVA-AGKLPPTLAVVLVGSD
FOLD_ANADE       -----------------MNLIDGKQIAAKVKGEVATEVRALA--ARGVQTGLTVVRVGDD
FOLD2_MYXXD      ---------------MNAQLIDGKAVAARVRAEVKAEVDRLKL-EHGLTPGLAVVRVGED
FOLD2_GEOMG      ----------------MSTIIDGKAIAAKLRAEIATEVKILK--EKGIIPGLATVLVGED
FOLD2_GEOSL      ----------------MATIIDGKAIAEKIRADLAAQVKELQ--SRGITPGLATVLVGSD
FOLD_MOOTA       ---------------MPAQILDGKKIAAEVRAEVKEEVSRLK--AEGINPGLAVVLVGED
FOLD_AROAE       ---------------MTARILDGNALSARVRGELAERAAALA--DGGVQPCLAVILVGVN
FOLD_DECAR       ---------------MTAQIIDGKALAEELRQGFKARVEALT--AKGHKPGLVVILVGAD
FOLD_BORBR       ---------------MTARIIDGAALSQRIREEVAQRVQALT--AKGVRPGLAVVLVGDD
FOLD1_BORPE      ---------------MTARIIDGAALSQRIREEVAQRVQALT--AKGVRPGLAVVLVGDD
FOLD1_BORPA      ---------------MTARIIDGAALSQRIREEVAQRVQALT--AKGVRPGLAVVLVGDD
FOLD_BORA1       ---------------MTARIIDGVALSQRIREEVAERAAALT--AQGVRPGLAVVLVGED
FOLD2_BORPA      ---------------MKDKVIDGSRASARIREQLKERVACLR--ARNIRPGLAVLLVGED
FOLD2_BORPE      ---------------MKAKVIDGSRASARIREQLKERVACLR--ARNIRPGLAVLLVGED
FOLD_BURCA       ---------------MTALLIDGNALSKTLRAQAAERAAALT--ARGHQPGLAVILVGAN
FOLD_BURL3       ---------------MTALLIDGNALSKTLRAQAAERAAALT--ARGHQPGLAVILVGAN
FOLD_BURP1       ---------------MTATLIDGNALSKTLRAQAAERAAALA--ARGHRPGLAVILVGDN
FOLD_BURPS       ---------------MTATLIDGNALSKTLRAQAAERAAALA--ARGHRPGLAVILVGDN
FOLD_BURMA       ---------------MTATLIDGNALSKTLRAQAAERAAALA--ARGHRPGLAVILVGDN
FOLD_BURTA       ---------------MTATLIDGNALSKTLRAQAAKRAAALA--ARGHRPGLAVILVGDN
FOLD_PARXL       ---------------MTAKLIDGLALSKTLRADVAARAAALT--ARGHQPGLAVVLVGDN
FOLD_CUPPJ       ---------------MSAQLIDGNALAKQIRSEAAVRAARLT--ERGHQPGLAVVLVGED
FOLD_CUPMC       ---------------MSAHLIDGNALAKQIRAEAAQRAARLT--AAGHQPGLAVVLVGED
FOLD_RALSO       ---------------MTAQLIDGNALAKQLRTEAAQRAAALT--ARGHQPGLAVILVGDD
FOLD_POLSJ       ---------------MTAQLIDGNALSRQLRAEVARRAAALR--ARGITPGLAVVLVGEN
FOLD_RHOFT       -----------MTTQKFGQIIDGVALSAKLRADVATRVLALK--ARGVTPGLAVILVGED
FOLD_NITEU       ---------------MSATIISGSLIASKFREELKQRVKILS--ETWMQPGLAVILAGDN
FOLD_NITMU       ---------------MSAKIIDGKRLSQEVRAECRARAARLA--EKGTQPGLAVVIVGDN
FOLD_PSYA2       ----MSIASIASTAQGSATILDGKALAKQIEQQLSTRVDAIKA-KTGRTPSLATILVGDD
FOLD_PSYCK       ----MSIASITSTAQGSATVLDGKALAKQIEQQLRTRVDAIKA-KTGRTPSLATILVGDD
FOLD2_ACIAD      ----------------MALVLDGRALAKKIEADLLVRVEALKA-KSGRTPILATILVGDD
FOLD_ALCBS       ---------------MTAQILDGKTLAQQFEQEMRLRVDVLKAKANGHTPILATILVGAD
FOLD_SACD2       ---------------MSALILDGKALAKKTEDELTQCVDKLKA-SSGHTPILATILVGDD
FOLD1_COLP3      ---------------MSALILDGKSVTKKSEEDLRSRVARLKELSNGAVPILATILVGND
FOLD_BACSK       --------------MAEPMILDGNDVSKRIKDKLALQVAALEQ--KGVRPCLATILVGDD
FOLD_LEPIC       ---------------MNPVLLDGKKLSEKIKEEIRSAIEERKT-KNFRIPKLATILVGNN
FOLD_LEPIN       ---------------MNPVLLDGKKLSEKIKEEIRSAIEERKT-KNFRIPKLATILVGNN
FOLD1_STRAW      -----------MSATQTAQLMDGTGHARRIVEEAAAKAAEISQ-RTGTAPCLATVLVGDD
FOLD2_FRACC      ---------------MSAVIIDGKAVARRVRENVAREVAEFRDRT-GIQPGLATVLVGDD
FOLD_SYMTH       ---------------MTAGVIDGKQVAAQVQEEVAREVAALKAE--GLTPGLAVVLVGDD
FOLD_DEHM1       ---------------MSAHIINGTEIAAAIREEIRSEVTALKA-KHGIVPGLATVLVGDD
FOLD_DEHMC       ---------------MSAHIINGTEIAAAIREEIRSEVTALKT-KAGIVPGLATVLVGDD
FOLD_DESPS       ---------------MSAKIISGTEIRKEILGEIKDAVTEMKD-KYGTVPGLVTILVGES
FOLD_LAWIP       ---------------MAADIINGMEIRESILEELRGEVANLKR-DYNVVPGLVTILVGNH
FOLD_SYNAS       ---------------MAAIIIRGSDIAQEIREDLKKEAAWLK--AYGVVPGLVTILVGQD
FOLD_TREDE       ---------------MSAKIIDGARIAADLRADIAKDVEKIK--AKGVQPTLAVILVGND
FOLD1_MYXXD      ----------------MARTLDGTEISRVMRAEMAQDVAALQA-A-GVTPGLSVVLVGNN
FOLD_TREPA       ---------------MDARLIDGKQAAHECTARLATRVQALRA-AVGTAPFLAAVLVGDD
FOLD1_HALMA      ----------------MTEIIDGNAVAQSIRDDLVASIDRLAD-A-GHRPSLATVLMSED
FOLD_NATPD       ----------------MTEVIDGNAVASDIRDDLTDAIATLAD-A-GARPGLATVLMGDD
FOLD2_HALMA      ----------------MTTVIDGNEIGDQITEGVAACTDTLVS-E-GVTPGLATVLMSDD
FOLD_HALSA       ----------------MTEIIDGDAVAAQLRADLTGAVETLET-A-GVTPRLATVLMNDK
FOLD_HALWD       MRFKYVASKYSCVTQTQTQLIDGTEVAASIRSDLISSVTRIVN-T-GTTPQLATVLMNDD
FOLD_SALRD       -----------MPDASDADLLDGQALSQAVRDEVKADIQAWTD-D-HRPPFLSAVLVGDN
FOLD_RHOBA       ---------------MPATRLDGKKIAAEIRSEVAADVETFVS-GGNPPPQLAAVLVGED
FOLD_NOSS1       ------------METKTAKILDGKTLAEKIQKELTAQIIDAQA-KIGRPPGLAVLMVGDN
FOLD_TRIV2       ------------METKTAKILDGKTLAEKIQKELTAQIIEVQA-KIGRPPGLAVLMVGDN
FOLD_TRIEI       ----------------MTNKLDGKALAKKIKAELQQKVQSLQI-KIGRPPGLAVLMVGDN
FOLD_SYNY3       ----------MTAVPPSCQILDGKALAQKMQGELQRDIAQLVA-QGHRSPGLAVLMVGDN
FOLD_GLOVI       ---------------MSAAILDGKALAARIQAELTCEVQSLQE-RFGRPPGLSVLWVGDN
FOLD_SYNJA       ---------------MSAKILDGKALAGRLQAEMAAQVQAWLP-RVGRPPGLAVLRVGED
FOLD_SYNJB       ---------------MPAKILDGKALAARLQAEMAAQVQAWIP-QVGRPPGLAVLRVGED
FOLD_THEEB       ------------MVAHAATCLDGKSLAQSIERQLADHVRTFQA-QWGRSPGLAVLRVGND
FOLD_SYNP6       ---------------MAAAILDGRALAAQRRQQLREQVEAIAP-AVGRRPGLAVIMVGDN
FOLD_SYNE7       ---------------MAAAILDGRALAAQRRQQLREQVEAIAP-AVGRRPGLAVIMVGDN
FOLD_PROM9       ----------------MSLKLDGKKLSLEIEERLNDYIFINKK-IAKRAPGLAVIRIGED
FOLD_PROMP       ----------------MSLKLDGKKLSLEIEERLRNYILTNKT-IAKRNPGLAVIRIGED
FOLD_SYNS9       ----------------MALRLDGKALAKAVESRLQAQIESNLP-QAGRPPGLAVLRVGDD
FOLD_SYNSC       ----------------MALRLDGKVLARDVEHRLQTLIERCLA-EAGRPPGLAVLRVGDD
FOLD_SYNPX       ----------------MALRLDGKALAATVERRLTSVVDAHSK-TVGQPPGLAVLRVGDD
FOLD_SYNS3       ----------------MALRLDGKQLAAQLEVRLQQQIQKGIA-AAGRSPGLAVLRIGDD
FOLD_PROMM       ----------------MALRLDGKQLAAELEQRLQAEIAAGLV-QAGRPPGLAVLRIGDD
FOLD_PROMA       ----------------MTNILDGKKLAKELELRLHEDITEFSP-EVGRPPGLAVIRVGDD
FOLD_PROMT       ----------------MPKILDGKKLAQEIELILQQAIESGLE-VAKRRPGLAVLRVGDD
FOLD_DESAG       -----------------MILLDGKATAAAVREELKKDVDALKD-RAGRAPGLAVILVGDD
FOLD_DESVH       -----------------MQLLDGKATAATIREELRAEIAALTP-RARRAPGLAVILVGED
FOLD_THET2       ---------------MAAQVLSGHEAAEAVYEEIRARLRSLS-----FTPSLRVIRLGED
FOLD_THET8       ---------------MAAQVLSGHEAAEAVYEEIRARLRSLS-----FTPSLRVIRLGED
FOLD2_DEIGD      ---------------MTARLLRGGPAADALLAEATARAARLP-----APPQLVMLRLGED
FOLD1_RUBXD      ----------------MARLLDGRSVAAQIRAEVAEGVSELKR--RGVPVRLDVILAGED
FOLD_KORVE       ---------------MLATILDGNKISAEIKTEVAAEVAELKA--KGLTPGLAVVLVGHN
FOLD_COREF       ---------------MTAIKLDGNLYRDEIFADLAQRVAALKE--KGIVPGLATVLVGDD
FOLD_CORGL       ---------------MTAIKLDGNLYRGEIFADLEQRVAALKE--KGIVPGLATVLVGDD
FOLD_CORJK       ---------------MAATKLDGKLYRDEIFADLEQRVAALKE--KGVTPGLATVLVGDD
FOLD_CORDI       ---------------MSAIKLDGNLYRDEIFEDLKGRVNSLRE--KGIVPGLATVLVGDD
FOLD_MYCBO       ---------------MGAIMLDGKATRDEIFGDLKPRVAALDA--AGRTPGLGTILVGDD
FOLD_MYCTU       ---------------MGAIMLDGKATRDEIFGDLKQRVAALDA--AGRTPGLGTILVGDD
FOLD_MYCPA       ---------------MGAITLDGKATRDEIFVDLKQRVAALTA--AGRTPGLGTILVGDD
FOLD_MYCLE       ---------------MGAITLDGKATRDEILIDLKQRVAALTE--SGRTPGLGTILVGDD
FOLD_MYCFO       ------------MAPVGSIVLDGKATRDEIFVDLKQRVAKLTE--AGRTPGLGTVLVGDD
FOLD_MYCSS       ---------------MGAITLDGKATRDEIFVDLKERVAALTE--QGRTPGLGTVLVGDD
FOLD2_RHOJR      ---------------MTATILDGKATRDEIFEDLKVRVSALKD--RGITPGLGTVLVGDD
FOLD2_STRAW      ---------------MTAQILDGKATAAAIKSDLTARVAALKE--KGVTPGLGTILVGDD
FOLD_STRCO       ---------------MTAQILDGKATAAAIKSELTARVAALKE--RGVTPGLGTVLVGDD
FOLD_THEFY       ---------------MTAQVLDGKATAAAIREELKERVAALRA--RGVVPGLGTILVGDD
FOLD_CUTAK       ---------------MTAQKLDGKATAAAIKSELAERVAALRD--QGVVPGLGTVLVGED
FOLD_LEIXX       ---------------MSARTLDGKATAAAIKAELRERVSALRE--RGVVPGLGTILVGDD
FOLD_BIFLO       ---------------MMSTKIDGKQIAAEIKTNLAERVNKLKA--QGIQPGLGTLLVGED
FOLD_PELCD       ---------------MSAQLLEGKVVAAAVLEDVARRVAVLKD--KGISPGLGTILVGDD
FOLD_TROW8       ---------------MVAKVLDGLAVSAGIFERLHRACCELEN--NGVCPKLATVLVGNN
FOLD_TROWT       ---------------MVAKVLDGLAVSAGIFERLHRACCELEN--NGVCPKLATVLVGNN
FOLD_BDEBA       ----------------MVLILDGKEVAKEVRASLVPRVAKFKE-TYGRAPQLSVVIVGDD
FOLD_LACAC       ----------------MGKILDGKFVANLLGEKLKEKVKDLKE--EGITPHFCVINIGDD
FOLD_LACDA       ----------------MGEILDGKKLAWELGEKLGSEVDSLKE--HGVSPKLCVINIGDD
FOLD2_LACJO      ----------------MKKLLEGKTPANEIKENLIEEIKKLKS--DGINPTLCVIEVGDD
FOLD_METHJ       ------------------MILDGKGLAARRLELLKEDI---IE--GGLSPTLATVIVGDD
FOLD_CLOD6       -------------MSTKGQIIKGKPVADKISEELIKEVDLLVK-EG-INPKLTIVRVGAR
FOLD1_DESHY      ----------------MTQILNAKPVVQAMKENLRQEVAALQA-EG-KAPTLGIIRVGSR
FOLD_CARHZ       ----------------MAERLTGKPVADAIKEELKGRVADLKA-KG-IVPKLGIVRVGAR
FOLD_CLOAB       ----------------MGDIINGKAESQKYKDKIIEFINERKK-QGLDIPCIASITVGDD
FOLD_CLOTE       ----------------MAVAIDGKRVSEELRKELKNFIDERVE-KGLKVPCVSSILIGND
FOLD_CLOP1       ----------------MDKILSGKTVAIDIKGQIKNYTEELKA-SG-KSLKISSILVGDD
FOLD_CLOPE       ----------------MDKILSGKTVAIDIKGQIKSYTEELKA-SG-KSLKISSILVGDD
FOLD_CLOPS       ----------------MDKILSGKTVAIDIKGQIKSYTEELKA-SG-KSLKISSILVGDD
FOLD2_SYNWW      ------------------MLIYGKDIREQIKERVRQSAEEVKM-GL------AIIRVGDD
FOLD2_DESHY      ----------------MAQLLDGKEISKVLKEEIKEEVKRWKE-QG-VNPKLAVVLVGDD
FOLD_CALS4       ---------------MKRMIIDGKEISNRIKEEVKREIQEF----G-YKPRLAILMAGDD
FOLD_METAC       ----------MSDESYESRIIDGKVLAQQVEEEVRSGVEDLES-NRGIVPGLATILVGDD
FOLD_METMA       ----------MLDESYESRIIDGKVLAQQVEEEVRSGVEDLES-NRGITPGLATILVGDD
FOLD_METBF       ----------MLDEGYESRIIDGKVLAKKIEDEVRSGVEALVS-GRGITPGLATVLVGDD
FOLD_METBU       -----------MPDTDNTKIIDGRAIAKKVEAEVKADVERLVR-EKGITPGLSAILVGED
FOLD1_SYNWW      -----------------MEIISGSQIAQEIRQKLKEKNER-----EGISPCLAMILVGGQ
FOLD2_RUBXD      ---------------MGARVIDGRPIAGELKKRVASEVEGLAA--RGVRPGLATVLVGED
FOLD3_RUBXD      ---------------MGARVIDGRPIAGELKKRVASEVEGLAA--RGVRPGLATVLVGED
FOLD_NOCFA       ---------------MDTVSLTGKELAAALNADTKQRAEALT--AGGVAARLALIVANDD
FOLD1_RHOJR      ----------------MTRSLGGAELATSIRNDASVAAAALN--DLGTRPKLAVVQATDD
FOLD_ARTGO       ---------------MTASLLSGKPLAKLIQQQAQTEAKVLA--EEGTCPTLAVVVATED
FOLD1_FRACC      -----------------MRMLDGRSMAAEIGRYVVDEAERLA--AAGVTPTLAVVLPTAD
FOLD3_ROSDO      --------------MQDPRLLMGKPVRERILEEVRSVTE-----KVDRIGKLVSISIGDV
FOLD2_RUEPO      -----------MSTVADTRLLPGKPVRARILSEVSAYVN-----QVGRIGKLVSISIGNV
FOLD_RHOCB       -----------MADRRDHRIIDGKAVQQRLLAGIRAELEAAA--ETHPVGRLVSISIGPS
FOLD2_RHILO      -----------MSLPDDSRYLKGGPVAQRIIAAVREDAAIAK--AEGFPPKLISITVGDT
FOLD_PYRAE       ----------------MVTWIRGEELHARTKEWARSHVKRLEE--VGITPKLAVLLLNDD
FOLD_THEAC       -----------------MKILRGEEIAEKKAENLHGIIER-----SGLEPSLKLIQIGDN
FOLD_THEVO       ---------------MAVKLLKGEEIAEKKAEELKERIEK-----MGVSPRLVLLQVGNY
FOLD_PICTO       ------------------MIIDGVKISETKMERLKNEIEKIK--NTGINPKMKIILIGND
FOLD_THEMA       ------------------MWIDCKTIARSIEERTKERVEK-----LGFTPKLVSVACTDD
FOLD1_DEIGD      ---------------MTKAQLFGKPLADDVTRGVRAALKEWAGAEPGFQPHLVSVLASED
FOLD_DEIRA       ------MQTSSEPAASETAALLGKPLADRVMRGVRADLKAWAQLDPPFEPQLVSVLASDD
FOLD_MYCPE       ------------------MIVNCIDIANNILDKFKSDLEKLK--KKKIIPHMAIVKINDD
FOLD_BORBU       ---------MGFKGYILSIVFNGKDFANKYYLMLKEFLKQHNL---RDKIALKVVLANDE
FOLD_BORBP       ----------------MNTVFNGKDFANKYYLILKEFLKQHDL---RDKIALKVVLANNE
FOLD_BORAP       ----------------MNTVFNGKDFANKYYLMLKEFLKERNL---RNKITLKVVLANDE
FOLD_MYCMO       -----------------MIILDGKKLSQKDTIFLKEKVNQFKIK-----PVFTIVQVGNL
FOLD_MYCPU       ----------------MMKKLLSNELVQIKRAELKEKFSKLDQK-----VKFAIVLIGDN
FOLD_MYCS5       -----------------MKILSGREKAEQDLKQLKKELDELNLNR---PIKLAIIQVGDK
FOLD_MYCGE       ------------------MSFDGKLKAQSILETYKNFDWSKCK--------LVIIQANDD
FOLD_MYCPN       ------------------MSFDGKQLAHEILLTYKNRDWSQVK--------LVILQTNND
FOLD_MYCGA       ----------------MFIKLDGTKLSQKLKEDLAKKVNNQKI-------KILIIISDPS
                                     .                                 :     

FOLD_BACSU       ----PASHSYVRGKKKAAETMGM---NFKLDQFDSSLTEAELLSIIDQYNQDPEFHGILV
FOLD_BACLD       ----PASLSYVRGKKKAAEAMGI---RFQLDHFDASFTEQELLEVIDQYNQNDDFHGILV
FOLD_BACCZ       ----PASRSYVKGKEKGCEQVGI---YSELIEFPETITEERLLTEIDRLNGDDRINGILV
FOLD_BACHK       ----PASRSYVKGKEKGCEQVGI---YSELIEFPETITEERLLAEIDRLNGDDRINGILV
FOLD_BACAN       ----PASRSYVKGKEKGCEQVGI---YSELIEFPETITEERLLAEIDRLNGDDRINGILV
FOLD_BACC1       ----PASRSYVKGKEKGCEQVGI---YSELIEFPETITEERLLAEIDRLNGDDRINGILV
FOLD_BACCR       ----PASRSYVKGKEKGCEQVGI---YSELIELPETITEERLLAEIDRLNGDDRINGILV
FOLD_GEOKA       ----PASHSYVKGKQKACAEVGI---RSFLYTFPAAIDEETLLAKIRELNVDPAVHGILV
FOLD_BACHD       ----PASTVYVRSKQKACEQIGI---YSVLKELPASTSEEELLTEIDRLNNDPTIHGILV
FOLD_OCEIH       ----PASKSYVKGKEKACAVTGI---SSNLIELPENISQDELLQIIDEQNNDDSVHGILV
FOLD_LISMF       ----QASRTYVRNKQKRTEEAGM---KSVLIELPENVTEEKLLSVVEELNEDKTIHGILV
FOLD_LISMO       ----QASRTYVRNKQKRTEEAGM---KSVLIELPENVTEEKLLSVVEELNEDKTIHGILV
FOLD_LISIN       ----QASRTYVRNKQKRTEEAGM---KSVLIELPETVTEEKLLKVVEELNEDNTIHGILV
FOLD_STAA3       ----GASQSYVRSKKKAAEKIGM---ISEIVHLEETATEEEVLNELNRLNNDDSVSGILV
FOLD_STAAC       ----GASQSYVRSKKKAAEKIGM---ISEIVHLEETATEEEVLNELNRLNNDDSVSGILV
FOLD_STAAS       ----GASQSYVRSKKKAAEKIGM---ISEIVHLEETATEEEVLNELNRLNNDDSVSGILV
FOLD_STAAW       ----GASQSYVRSKKKAAEKIGM---ISEIVHLEETATEEEVLNELNRLNNDDSVSGILV
FOLD_STAA8       ----GASQSYVRSKKKAAEKIGM---ISEIVHLEETATEEEVLNELNRLNNDDSVSGILV
FOLD_STAAM       ----GASQSYVRSKKKAAEKIGM---ISEIVHLEETATEEEVLNELNRLNNDDSVSGILV
FOLD_STAAN       ----GASQSYVRSKKKAAEKIGM---ISEIVHLEETATEEEVLNELNRLNNDDSVSGILV
FOLD_STAAB       ----GASQSYVRSKKKAAEKIGM---ISEIVHLEETATEEEVLNELNRLNNDDSVSGILV
FOLD_STAAR       ----GASQSYVRSKKKAAEKIGM---ISEIVHLEETATEEEVLNELNRLNNDDSVSGILV
FOLD_STAHJ       ----GASQSYVNSKKKAAEKIGM---ISEIVHLDEDTSEEDVLKELDRLNNDDSVSGILV
FOLD_STAEQ       ----GASQSYVKSKKKAAEKIGM---ISEIIHLDESTSEEVVLSELNRLNNDDTVSGILV
FOLD_STAES       ----GASQSYVKSKKKAAEKIGM---ISEIIHLDESTSEEVVLSELNRLNNDDTVSGILV
FOLD_STAS1       ----GASQSYVNSKKKAAEKIGM---ISEIVHLDESTSEADVLNELKRLNEDDSVSGILV
FOLD_STRTR       ----PASQVYVRNKERAAKKAGF---HSKTVNLSESISEEELIEVIEKYNQNPLFHGILV
FOLD_STRT1       ----PASQVYVRNKERAAKKAGF---HSKTVNLSESISEEELIEVIEKYNQNPLFHGILV
FOLD_STRT2       ----PASQVYVRNKERAAKKAGF---HSKTVNLSESISEEELIEVIEKYNQDPLFHGILV
FOLD_STRA1       ----PASQVYVRNKERSALEAGF---KSETLRLSESISQEELIDIIHQYNEDKSIHGILV
FOLD_STRA3       ----PASQVYVRNKERSALEAGF---KSETLRLSESISQEELIDIIHQYNEDKSIHGILV
FOLD_STRA5       ----PASQVYVRNKERSALEAGF---KSETLRLSESISQEELIDIIHQYNEDKSIHGILV
FOLD_STRMU       ----PASQVYVRNKERSAIKAGF---KSETICLSDSISEEELIEIIEGYNQDPSFHGILV
FOLD_STRP8       ----PASQVYVRNKERAALTVGF---KSETVRLSEFICQEELIAVIERYNADNTIHGILV
FOLD_STRPM       ----PASQVYVRNKERAALTVGF---KSETVRLSEFICQEELIAVIERYNADNTIHGILV
FOLD_STRP1       ----PASQVYVRNKERAALTVGF---KSETVRLSEFICQEELIAVIERYNADNTIHGILV
FOLD_STRP3       ----PASQVYVRNKERAALTVGF---KSETVRLSEFICQEELIAVIERYNADNTIHGILV
FOLD_STRP6       ----PASQVYVRNKERAALTVGF---KSETVRLSEFICQEELIAVIERYNADNTIHGILV
FOLD_STRPB       ----PASQVYVRNKERAALTVGF---KSETVRLSEFICQEELIAVIERYNADNTIHGILV
FOLD_STRPC       ----PASQVYVRNKERAALTVGF---KSETVRLSEFICQEELIAVIERYNADNTIHGILV
FOLD_STRPD       ----PASQVYVRNKERAALTVGF---KSETVRLSEFICQEELIAVIERYNADNTIHGILV
FOLD_STRPF       ----PASQVYVRNKERAALTVGF---KSETVRLSEFICQEELIAVIERYNADNTIHGILV
FOLD_STRPN       ----PASQVYVRNKERSALAAGF---RSEVVRVPETITQEELLDLIAKYNQDPAWHGILV
FOLD_STRR6       ----PASQVYVRNKERSALAAGS---RSEVVRVPETITQEELLDLIAKYNQDPAWHGILV
FOLD_ENTFA       ----PASQTYVRNKERAAAKIGI---LSKVEKLPETISEEELLAEIDKYNQDSRFHGILV
FOLD_LACLA       ----PASQIYVRNKARQATAIGL---NSSVVRLPETVSEQELLDLIEQYNQSEQWHGILV
FOLD_LACS1       ----PASQVYVRNKRKTAHALGI---EAVDIRLPENVEEDELIRLIDELNSDGTVHGILV
FOLD1_LACJO      ----PASVIYTRNKQKNAEKLGM---KSILRKFPKDVSQAEVLQAIHHYNDDPTIHAILI
FOLD_LACPL       ----AASQIYVRNKNRKATKLGM---HSVVRQLPATTSQDELLAIIAAYNADDSIHGILV
FOLD_LACSS       ----PASAIYTQSKQKRATKIGM---ASELKRLSAETTEAELLALVKTLNDDRTVDGILV
FOLD_RICCN       ----PASIIYVRHKIKNAHKIGI---YTLLINLSATIHTNDLISKINELNLDNEISGIIV
FOLD_RICFE       ----PASIIYVKNKIKNAHKIGI---DTLLVNLSTTIHTDDLISKINELNLDNEISGIIV
FOLD_RICPR       ----PASMIYVKNKIKNAHQVGI---DTLLVNLSTNIYTDDLILKINELNLDKGISGIIV
FOLD_RICTY       ----PASMIYIKNKIKNAQQVGI---DTLLVNLSTNIYTDDLISKINELNLDKEISGIIV
FOLD_RICBR       ----PASIIYVKNKIKHANKIGI---DTLLLNLPITIKTEDLIAKISELNLDQNVSGIIV
FOLD_PELUB       ----APSQIYVRMKEKAANEVGL---KSEVIRYPEAVEEKTVLDKIEELNKDESISGILV
FOLD_ANAMM       ----PASKLYVGNKQRKAEELGL---QSRTIALEHDTSQEELLRIIDELNRDAAVHGILV
FOLD_ANAPZ       ----PASRLYVGNKQRKAEELGI---NSKTIALPYETTQEELLGIIQELNEDENVHGILV
FOLD_EHRCJ       ----PASHLYVRNKQRKAEMLGL---RSETILLPSTTSESSLIDKIHELNNDDNVHGILV
FOLD_EHRCR       ----PASHLYVRNKQRKAEMLGL---RSETMLLPSTTSESSLIDTIRRLNNDDSVHGILV
FOLD_EHRRG       ----PASQLYVRNKQRKAEMLGL---RSETMLLPSTISESSLIEKIHQLNNDDSVHGILV
FOLD_EHRRW       ----PASQLYVRNKQRKAEMLGL---RSETMLLPSTISESSLIEKIHQLNNDDSVHGILV
FOLD_WOLPM       ----PASQVYVRNKQKKAESIGI---SSETIVLPNNILEDELIEKINELNEDPSVHGILV
FOLD_WOLTR       ----PASQVYVRNKQKKAESIGI---SSETIVLPDNILENELIEKINELNNDRFVNGILV
FOLD_NEOSM       ----PASQVYVRSKQKKAESLGI---DAETIALPKDTSEVELIRLVNSLNDDTSINAILV
FOLD2_PSE14      ----PASEVYVRNKILRAEEAGI---RSLEHRLPAKSSQAQVLALIAELNADDSVNGILL
FOLD2_PSESM      ----PASEVYIRNKIVRAEEAGI---RSLEHRLPADCSEARLLALIAELNTDRSVNGILL
FOLD2_PSEU2      ----AASEVYVRNKILRAGEAGI---RSLEHRLPADSSQARLLALIAELNADNTVNGILL
FOLD1_ACIAD      ----PASQVYVRNKVQKAAFVGI---RSLEFRFDADLSEDELLTQIDRLNTERGVHGILV
FOLD_GLUOX       ----PASEVYVKNKAIQTHRVGM---RSFMHMLPQSTSQDELLDLIAQLNANPKIHGILV
FOLD1_PSEPK      ----AASQVYVENKIRQTEAVGM---RSERFLLPADTDESQLLTLIEQLNNNDAIHGILV
FOLD_SPHCR       ----PASHIYVRKKIEQCRKVGM---ESVEHRLPADCSEEDLLALIASLNADERVHGILV
FOLD_METC4       ----PASSVYVKAKTEKARSTGI---LSSSHRLPSDTTEDALLRLIDQLNRDRTVDGILV
FOLD1_RHIEC      ----PASHAYVGSKSRMAKECGF---KSVQHTLPAETTQEELAGLVATLNADPSIHGILV
FOLD2_RHIEC      ----PASHAYVGSKSRMAKECGF---KSVQHTLPAETTQEELAGLVATLNADPSIHGILV
FOLD_RHIL3       ----PASHAYVGSKGRMAKECGF---KSVQHTLPADTKQEDLAALVAALNADPSIHGILV
FOLD_RHILT       ----PASHAYVGSKGRMAKECGF---KSVQHTLPADTKQEDLAALVAALNADPSIHGILV
FOLD2_RHIME      ----PASHTYVSAKSRMAKECGF---LSVQHTLPEETSQEELAALVAELNADPSIHGILV
FOLD1_RHIME      ----PASHAYVGAKSRMAKECGF---FSVQHTLPKETTQQELAGLVHQLNADDGIHGILV
FOLD_AGRFC       ----PASHAYVNSKSKMAKQCGF---NSIQHTLPEETTQAALLKLVGELNTDASIHGILV
FOLD_BARHE       ----PASQVYVTSKSKKAEECGF---FSIKHMISKETQEKELLHLIATLNSDPQIHGILV
FOLD_BARQU       ----PASHVYVTSKSKKAEECGF---FSIKHMLSKETSEKELLQLIATLNSDPKIHGILV
FOLD_BRUA2       ----PASQVYVASKSRKAKECGF---HSVQHDLPETASEQELLNLIEGLNNDPAIHGILV
FOLD_BRUAB       ----PASQVYVASKSRKAKECGF---HSVQHDLPETASEQELLNLIEGLNNDPAIHGILV
FOLD_BRUME       ----PASQVYVASKSRKAKECGF---HSVQHDLPETASEQELLNLIEGLNNDPAIHGILV
FOLD_BRUSU       ----PASQVYVASKSRKAKECGF---HSVQHDLPETASEQELLNLIEGLNNDPAIHGILV
FOLD1_RHILO      ----PASQVYVASKSRTAKECGF---HSLQHTLPAETSEEALLKIIADLNADPAVNGILV
FOLD_CHESB       ----PASQVYVASKGRKATECGF---HSVQHSLPENTSEEELVSLVEALNRDPAIHGILV
FOLD_SINFN       ----PASQVYVASKGRKAEECGF---LSIKHELPHDVPERRLLELIDSLNADPSIHGILV
FOLD_NITHX       ----PASEVYVRSKHKQTQAAGM---ASFEHVLPADVAQPDLLALVARLNADPAVHGILV
FOLD_NITWN       ----PASEVYVRNKHKQTQAAGM---ASFEHMLPADVAQADVLALIAELNADPAVHGILV
FOLD_BRADU       ----PASEVYVRSKGTQTQAAGM---ASFEHKLPADVSQADLLAVVAKLNRDPAVHGILV
FOLD_RHOP2       ----PASEVYVRSKHKQTQEAGM---ASFEHRLPADVPQAELLALIGQLNADPAVHGILV
FOLD_RHOPS       ----PASEVYVRSKHKQTQEAGM---ASFEHRLPADVAQADLLALIGQLNADPAVHGILV
FOLD_RHOPB       ----PASEVYVRSKHKQTKEAGM---ASFEHKLPADVPQAELLALIGQLNADPAVHGILV
FOLD_RHOPA       ----PASEVYVRSKHKQTQEAGM---ASFEHRLPADVPQAELMALIAKLNADPAVHGILV
FOLD2_ROSDO      ----PASQVYVRSKGKQTVEAGM---NSYEHKLDADTSEADLLAVVDKLNKDPNVHGILV
FOLD_RUEST       ----PASQVYVRSKGKQTVEVGM---NSYEHKLDADTSEADLLALIDQLNKDSEVHGILV
FOLD1_ROSDO      ----PASQVYVRSKGKQTTEVGM---KSVEHKLDADTSETDLLAVVDQLNKDPDIHGILV
FOLD1_RUEPO      ----PASQVYVRSKGKQTVEVGM---NSYEHKLDADTSEADLLALIDRLNGDPDVHGILV
FOLD_RHOS4       ----PASQVYVGAKGKQTVEVGM---ASFEHRLPAGTSEAELLALIDRLNHDPAVHGILV
FOLD_JANSC       ----PASEVYVSHKHKATVEVGM---TSFEHKLPADTSEDDLFALIDKLNADPAVHGILC
FOLD_MAGSA       ----PASQVYVRTKGKRTVETGM---RSFEHKLPADTPEDALLLLIESLNKDPEVHGILV
FOLD_NOVAD       ----PASQVYVRSKGKSTLEAGM---ASFEHKLPADTAEADLLAVVEQLNADPAVDGILV
FOLD_SPHAL       ----PASAVYVGSKGKATVAAGM---ASFEHRLAATATQDEVEALLRQLNADEAVDGILL
FOLD_CAUVC       ----PASQVYVRNKGEQTTAAGM---YSETHRLPETTTQDELLAVVAKLNADPKIHGVLV
FOLD_ZYMMO       ----PASRIYVRKKEEMTTAVGM---NSLSYRLDANASQQELLDLIETLNHDPAVHGILV
FOLD_RHORT       ----AASQVYVGSKEKMAVAVGM---HSVVCRLAATTSEAEVLAKVEALNADPTIDGILV
FOLD_HYPNA       ----PASEVYVRNKVKMTEAAGM---VSIHHRLPADTGQAEVERLIESLNADPEVDGILL
FOLD_MARMM       ----PASDVYVRNKVRRTEAAGL---TSIEIRKSAEATEAEIIAIVERLNADDGVDGILV
FOLD_CHLTR       ----PASEIYVNMKIKRATDLGM---VSKSYRKPSDATLSDILALIHQLNNDENIHGILV
FOLD_CHLTA       ----PASEIYVNMKIKRATDLGM---VSKSYRKPSDATLSDILALIHQLNNDENIHGILV
FOLD_CHLMU       ----PASEIYVNMKVKRARDLGM---ISRSYRKPSDATLSDILSLIHELNCDENIHGVLV
FOLD_CHLAB       ----PASEVYVGMKVKKATDLGM---VSKAHRLPSDATLTDILKLIERLNNDPTIHGILV
FOLD_CHLCV       ----PASEVYVGMKVKKATDLGM---VSKAHRLSSDATLTDILKLIDRLNNDPMIHGILV
FOLD_CHLFF       ----PASEVYVGMKVKKAMNLGM---VSKAHRLPSDATLTDILKLIERLNNDPTIHGILV
FOLD_CHLPN       ----PASEVYVGMKVKKATEIGI---ISKAHKLPSDSTLSSVLKLIERLNQDPSIHGILV
FOLD_PARUW       ----PASQIYVNRKTAACKAVGI---ASIKCELPFTISEEELIREVEKLNVDPQIDGILV
FOLD_BACFN       ----GGSETYVAAKVKACEVCGF---KSSLIRYESDVTEDELLAKVRELNEDDDVDGFIV
FOLD_BACFR       ----GGSETYVAAKVKACEVCGF---KSSLIRYESDVTEDELLAKVRELNEDDDVDGFIV
FOLD_BACTN       ----GGSETYVAAKVKACEVCGF---KSSLIRYESDVTEEELLAKVRELNNDDDVDGFIV
FOLD_PORGI       ----GGSETYMASKVKACEEVGF---TSSLIRYEDDVTEEELLACVHRLNQDPTVDGFIV
FOLD_CYTH3       ----GAAVTYVNAKVKACELVGF---KSTLVKLPETITEADLLAKVAEINADKDIDGYIV
FOLD1_GEOMG      ----APSESYVKSKIKSCGNAGF---EGTLLRFPDTITEAELLEKIRGINADPTTDGLIV
FOLD1_GEOSL      ----APSESYVKSKIATSGLAGF---ESTLLRFPETIRESELLAKIKEVNEDPTTDGLIV
FOLD_CHLCH       ----PASQVYVRNKAKSCKEIGM---NSTVIELPADTTQEHLLKIINDLNNDDTVHGILV
FOLD_PELLD       ----PASEVYVRNKAKTCKEVGM---NSSVIELQEDTPEAHLLEVIDSLNRDPAVHGILV
FOLD_HELPY       ----PASITYVNMKIKACERVGM---DFDLKTLQENITEAKLLSLIKDYNTDQNISGVLV
FOLD_HELPH       ----PASITYVNMKIKACQRVGM---DFDLKTLQEDITEAKLLSLIKDYNTDQNISGVLV
FOLD_HELPJ       ----PASITYVNMKIKACQRVGM---DFDLKTLKENITEAELLSLIKDYNTDQNISGILV
FOLD_HELHP       ----PASCAYVQMKAKACKRVGI---YSVTHEMPSKITQDELLSVIEILNNDPNIDGILV
FOLD_SULDN       ----PASAAYVNMKKKACDRVGF---YSVTHEMPSDISQSAIENTITMMNNNPNIDGILI
FOLD_WOLSU       ----PASQAYVNMKAKACKRAGI---YSITHEMPESTTESQLLNAISILNNDPNIDGILV
FOLD_CAMJE       ----PASQTYVKSKAKACEECGI---KSLVYHLNENITQNELLALINTLNHDDSVHGILV
FOLD_CAMJR       ----PASQTYVKSKAKACEECGI---KSLVYHLNENTTQNELLALINTLNHDDSVHGILV
FOLD_AQUAE       ----PASEIYVNNKRKACEKVGI---KSLFYHLPQDVSEEKLLGLIYELNMNEEVDGILV
FOLD_FUSNN       ----PASQVYLNSQVKSYQDLGI---GVQKYFFSEEISEAYLLNLIDKLNKDTEVDGIMI
FOLD_FRAT1       ----PASKTYVASKEKACAQVGI---DSQVITLPEHTTESELLELIDQLNNDSSVHAILV
FOLD_FRATT       ----PASKTYVASKEKACAQVGI---DSQVITLPEHTTESELLELIDQLNNDSSVHAILV
FOLD_FRATH       ----PASKTYVASKEKACAQVGI---DSQVITLPEHTTESELLELIDQLNNDSSVHAILV
FOLD_FRATO       ----PASKTYVASKEKACAQVGI---DSQVITLPEHTTESELLELIDQLNNDSSVHAILV
FOLD_MYCCT       ----QASELYVSNKIKACNLVGI---ESMLLRFDENINSQTLSDQINQLNNDQLVDAILL
FOLD_MYCMS       ----PASELYVSNKIKACNLVGI---ESVLLRFGQNITSEMLSDQINQLNNDNSVDAILL
FOLD_MESFL       ----PASEVYVSHKIKVANEVGI---YSELLRFDKDIKKEELYNKINELNNDQNIDGILL
FOLD_SPICI       ----KASTTYIKNKKIACEKVGV---TCKVLNYPDIITESALIKIINDLNNNSKIDAILV
FOLD_BUCAI       ----IPSQIYVNKKKISCKNVGF---FSECWNLPSNINEKEILNIISKLNENKNIDGILI
FOLD_BUCAP       ----PASEIYVKRKISVCKKVGF---ISKYWSFPINVDEKDILNLIEKLNNNINIDGILV
FOLD_BUCBP       ----SASTIYVKKKRFMCEQVGF---ISKFWKFSKNIQESKILNLIYKLNYDTTIDGILV
FOLD_BLOFL       ----PISKIYIAHKKKVCKQVGF---KSFLYNLPITATKTELLQLINILNNDKNIDGILI
FOLD_BLOPB       ----PISQIYVTNKKKACEQVGL---ISFLYTLPITATENEIFQLIETLNNDNRIDGILI
FOLD_WIGBR       ----PASKIYISNKEKICKKIGL---ISYLYNFSKNISEIDLINLIIKLNKNNLIDGILV
FOLD_ECOLI       ----PASQIYVASKRKACEEVGF---VSRSYDLPETTSEAELLELIDTLNADNTIDGILV
FOLD_SHIDS       ----PASQIYVASKRKACEEVGF---VSRSYDLPETTSEAELLELIDALNADNTIDGILV
FOLD_SHIFL       ----PASQIYVASKRKACEEVGF---VSRSYDLPETTSEAELLELIDALNADNTIDGILV
FOLD_SHISS       ----PASQIYVASKRKACEEVGF---VSRSYDLPETTSEAELLELIDALNADNTIDGILV
FOLD_SHIBS       ----PASQIYVASKRKACEEVGF---VSRSYDLPETTSEAELLELIDALNADNTIDGILV
FOLD_ECO57       ----PASQIYVASKRKACEEVGF---VSRSYDLPETTSEAELLELIDALNADNTIDGILV
FOLD_ECOL5       ----PASQIYVASKRKACEEVGF---VSRSYDLPETTSEAELLELIDALNADNTIDGILV
FOLD_ECOL6       ----PASQIYVASKRKACEEVGF---VSRSYDLPETTSEAELLELIDALNADNTIDGILV
FOLD_ECOUT       ----PASQIYVASKRKACEEVGF---VSRSYDLPETTSEAELLELIDALNADNTIDGILV
FOLD_SALTY       ----PASQIYVASKRKACDEVGF---VSRSYDLPETTSEAELLALIDTLNADNTIDGILV
FOLD_SALCH       ----PASQIYVASKRKACDEVGF---VSRSYDLPETTSEAELLALIDTLNADNTIDGILV
FOLD_SALPA       ----PASQIYVASKRKACDEVGF---VSRSYDLPETTSEAELLALIDTLNADNTIDGILV
FOLD_SALTI       ----PASQIYVASKRKACDEVGF---VSHSYDLPETTSEAELLALIDTLNADNTIDGILV
FOLD_PHOLL       ----PASQIYVASKRRACEEVGF---VSRSYDLPDTTSEAELLNLIDQLNNDSDIDGILV
FOLD_YERPA       ----PASQIYVASKRKACEEVGF---VSRSYDLPMATSEAELLALIDSLNEDTEIDGILI
FOLD_YERPE       ----PASQIYVASKRKACEEVGF---VSRSYDLPMATSEAELLALIDSLNEDTEIDGILI
FOLD_YERPN       ----PASQIYVASKRKACEEVGF---VSRSYDLPMATSEAELLALIDSLNEDTEIDGILI
FOLD_YERPS       ----PASQIYVASKRKACEEVGF---VSRSYDLPMATSEAELLALIDSLNEDTEIDGILI
FOLD_PECAS       ----PASQIYVTSKRKVCEEVGF---ISRSYDLPITTTESELLALIDQLNADQAIDGILV
FOLD_SODGM       ----PASQIYVASKRKACEDVGF---ISLSYDLPNTVTEAALLALIDQLNADHRVNGILV
FOLD_BAUCH       ----SASQMYVTSKRKTCESIGF---ISLAYDLPNNVSETELLMLIDQLNTNHSVDGILI
FOLD_PHOPO       ----PASQIYVGSKRKACEEVGF---ISKSFDLPSSASEQQLLDLIDELNQDPTMDGILV
FOLD_PHOPR       ----PASQIYVSSKRKACEEVGF---ISQSFDLPANTKEIELLALINELNTNKEIDGILV
FOLD_VIBVU       ----PASQVYVGSKRRACEEVGF---VSKSFDLPASTSEEELLALIDELNNDAEIDGILV
FOLD_VIBVY       ----PASQVYVGSKRRACEEVGF---VSKSFDLPASTSEEELLALIDELNNDAEIDGILV
FOLD_VIBPA       ----PASQVYVGSKRRACEEVGF---VSKSFDLPASTSEEELLALIDELNNDNEIDGILV
FOLD_VIBCH       ----PASQVYVGSKRRACEEVGF---VSKSFDLPATASEEALLSLVEELNNDPQIDGILV
FOLD_ALIF1       ----PASQVYVGSKRRACEEVGF---VSKSYDLPTTTSESELLNLIDELNQDPEIDGILV
FOLD_PSEHT       ----PASQVYVGSKRKACEEVGF---ISKSFDLPANTTEQTLLELIDELNNDQEIDGILV
FOLD_IDILO       ----AASEVYVGNKRRACEDVGF---RSFDYDLPITTTQKELEKLIEELNDDDAVDGILV
FOLD_PSEA6       ----AASHVYVTNKRRACEEVGF---VSKSYDLPSTTSQQKLLELIDTLNADEEIDGILV
FOLD_SHEDO       ----AASKIYVGSKRRACEEVGF---ESRSFDLDINTSEADLLALIDKCNQDPSIDGILV
FOLD_SHEFN       ----AASQVYVGSKRKACEEVGF---ESQSFDLDTETTEAELLALIDECNANPSIDGILV
FOLD_SHESM       ----PASQVYVGSKRKACEEVGF---ISRSYDLDTSYTEEALLALIDELNDDPTIDGILV
FOLD_SHESR       ----PASQVYVGSKRKACEEVGF---ISRSYDLDTSYTEEALLALIDELNDDPTIDGILV
FOLD_SHEON       ----PASQVYVGSKRKACEEVGF---ISRSYDLDTSCSEAELLALIDQLNDDPSIDGILV
FOLD2_COLP3      ----PASQVYVGSKRKACEEVGF---ISRSYDLPHTTSEQELLALVSELNNDDSIDGILV
FOLD_HAEIN       ----PASQIYVGNKRKSCEEVGI---LSKSYDLPETTTQNELLAIIDQLNADKNIDGILV
FOLD_HAEI8       ----PASQIYVGNKRKSCEEVGI---LSKSYDLPETTTQNELLAIIDQLNADKNIDGILV
FOLD_HAES1       ----PASQVYVGSKRRSCEELGI---YSKSYDLPAETTEQELLTLIEQLNQDPQIDGILV
FOLD_PASMU       ----PASQVYVGSKRKSCAEIGI---QSKSYDLPETTQESELLALIDELNADTTVDGILV
FOLD_MANSM       ----PASQVYVGSKRKSCAEIGI---NSKSYDLEESTSEAALLTLIDELNNDADIDGILV
FOLD_HAEDU       ----PASQVYVNSKRKSCAEIGI---ESKYYDLPATITEVELLSIIQRLNSDEMIDGILV
FOLD_COXBU       ----PASATYVAHKERACQAVGI---RSTVYRMPNTITESELASKIDECNRDSNTHGILL
FOLD_LEGPH       ----PASVIYVSNKRKACEEVGI---TSHSYDLPAETTQEKLIELINELNQSDKIDGILI
FOLD_LEGPL       ----PASVIYVSNKRKACEEVGI---TSHSYDLPAETTQEKLIELINELNQSDKIDGILI
FOLD_LEGPA       ----PASVIYVSNKRKACEEVGI---TSHSYDLPAETTQEKLIQLINELNQSDKIDGILI
FOLD1_PSE14      ----PASQVYVSHKRKDCEEVGF---ISQAYDLPAETTQTALTDLIDRLNEDAAVDGILL
FOLD1_PSESM      ----PASQVYVSHKRKDCEEVGF---ISQAYDLPAETTQVALTNLIDRLNEDAAVDGILL
FOLD1_PSEU2      ----PASQVYVSHKRKDCEEVGF---ISQAYDLPADTTQAALTDLIDRLNEDAAVDGVLL
FOLD_PSEF5       ----PASQVYVSHKRKDCEEVGF---LSQAYDLPANTTQEDLAGLIDRLNDDPNIDGVLL
FOLD_PSEPF       ----PASQVYVSHKRKDCEEVGF---LSQAYDLPSETTQEALTDLIDRLNDDPAIDGVLL
FOLD2_PSEPK      ----PASQVYVSHKRKDCEEVGF---ISQAFDLPSETTQQALTELIDRLNDDPAVDGILL
FOLD_PSEAE       ----PASQVYVAHKRKDCEEVGF---LSQAYDLPAETSQDDLLALIDRLNDDPAIDGILV
FOLD_HAHCH       ----PASQVYVKNKTKACEEVGF---LSQKYTLEESTTEEELLKLIDTLNEDNAIDGILV
FOLD_CHRSD       ----PASEVYVRNKHRACDKAGV---HSVQHKLPADTTQADLEALIDSLNADCSIDGILV
FOLD_METFK       ----PASTIYVRNKRLACDKTGI---RSLAYDLPDTTSEAELLALIKQLNQDDAVDGILV
FOLD_NITOC       ----PASQVYVRNKRRACEEVGF---KSLAYDLPADTTQANLLALIDQLNADSTVDGILV
FOLD2_HYDCU      ----PASSVYVNNKKKACEEAGL---VSKSWNWPSKATQYELLELIKQLNEDTSIDGILV
FOLD_THIDA       ----PASAVYVRNKKRACERAGV---NSVSHDLPETTTQPELLALIDTLNSDAAIDGILV
FOLD_NEIMA       ----PASAVYVRNKKTACQKCGI---KSLSYELPESTSQEELLALVDRLNADSEVDGILV
FOLD_NEIMB       ----PASAVYVRNKKTACQKCGI---KSLSYELPESTSQEELLALVDRLNADSEVDGILV
FOLD_NEIG1       ----PAGAVYVRNKKTACQKCGI---KSLSYELPESTSQEELLALVDRLNADSEVDGILV
FOLD_CHRVO       ----PASAVYVGSKKKACEKAGI---RSVAYDLPASTSQQQLLEIIDGLNADDAVDGILV
FOLD1_HYDCU      ----PASQVYVKNKKIACEKAGF---NDVSMVLPAETSQAELLAKIDELNTRDDVHGIIV
FOLD_ALKEH       ----PASTVYVGKKRQACEQLGM---HSSAHELPAETTQDELLALVDELNGRDEIDGILV
FOLD_XANAC       ----PASSVYVRNKRRAAEKVGI---EAFDYDLPQGTSEAQLASLIDELNADPKIHGILI
FOLD_XANC5       ----PASSVYVRNKRRAAEKVGI---EAFDYDLPQGTSEAQLASLIDELNADPKIHGILI
FOLD_XANOM       ----PASSVYVRNKRRAAEKVGI---EAFDYDLPQCTSEAELAALIDELNADPKIHGILI
FOLD_XANOR       ----PASSVYVRNKRRAAEKVGI---EAFDYDLPQCTSEAELAALIDELNADPKIHGILI
FOLD_XANC8       ----PASSVYVRNKRRAAEKVGI---EAFDYDLPQGTTEAELAALIDQLNTDPKIHGILI
FOLD_XANCP       ----PASSVYVRNKRRAAEKVGI---EAFDYDLPQGTTEAELAALIDQLNTDPKIHGILI
FOLD_XYLFA       ----PASVVYVRNKRRAAEKVGI---KAYDFDLPEATTEAELAALIDRLNADPKIHGILI
FOLD_XYLFT       ----PASVVYVRNKRRAAEKVGI---KAYDFDLPEATTEAELAALIDRLNADPKIHGVLI
FOLD_ANADE       ----PASAIYVRGKRKDCEEVGI---TSVEHHLPVTTTQAELLALIARLNADPAVHGILV
FOLD2_MYXXD      ----PASKVYVNGKKKAAEEVGF---RSWELHPDEGITQAALLEVIHQLNADPAVHGILV
FOLD2_GEOMG      ----PASEVYVRMKGNACQELGM---HSVKHTLPATTTEAELLALVARLNSDPTIHGILV
FOLD2_GEOSL      ----PASEVYVRMKGDACNKLGM---HSVKITRPAETTEEELLALINELNNDPAIHGILV
FOLD_MOOTA       ----PASQVYVRNKHRACEEVGI---YSEVHRLPAATSQAELLKLIDQLNKDPKIHGILV
FOLD_AROAE       ----PASAVYVRNKVAACEKAGI---RSLRFDFAADVDAAEVMAKIAELNADSAVHGVLV
FOLD_DECAR       ----PASEVYVRNKVNGCLAIGM---HSEKITYDATIDQATVLNKIAELNADPNIHGILV
FOLD_BORBR       ----PASQVYVRNKVAACEKAGL---HSVKEQYPADLTEAQLLERIDALNRDPSIHGILV
FOLD1_BORPE      ----PASQVYVRNKVAACEKAGL---HSVKEQYPADLTEAQLLERIDALNRDPSIHGILV
FOLD1_BORPA      ----PASQVYVRNKVAACEKAGL---HSVKEQYPADLTEAQLLERIDALNRDPSIHGILV
FOLD_BORA1       ----PASQVYVRNKVAACEKAGL---HSVKEQYPADLSEADLLARIDALNRDPSIHGILV
FOLD2_BORPA      ----PASQVYVRNKVAACEQVGI---HSVTERYPSAWTENQLLDRIASLNGDPAINGILV
FOLD2_BORPE      ----PASQVYVRNKVAACEQVGI---HSVTERYPSAWTENQLLDRIASLHGDPAINGILV
FOLD_BURCA       ----PASEVYVRNKIKACEDNGF---FSLKDAYPATLSEADLLARIDELNRDPKIHGILV
FOLD_BURL3       ----PASEVYVRNKIKACEDNGF---FSLKDAYPDTLSEADLLARIDELNRDPKIHGILV
FOLD_BURP1       ----PASEVYVRNKIKACEDNGF---FSLKDRYPATLSEPELLARIDELNRDPKIHGILV
FOLD_BURPS       ----PASEVYVRNKIKACEDNGF---FSLKDRYPATLSEPELLARIDELNRDPKIHGILV
FOLD_BURMA       ----PASEVYVRNKIKACEDNGF---FSLKDRYPATLSEPELLARIDELNRDPKIHGILV
FOLD_BURTA       ----PASEVYVRNKIKACEDNGF---FSLKDRYPATLSEPELLARIGELNRDPKIHGILV
FOLD_PARXL       ----PASEVYVRNKVKACHDNGL---GSSFDRYPADLPEAELLARIDELNRDPRIHGILV
FOLD_CUPPJ       ----PASQVYVRNKVKACEDNGF---HSSLDRYPADLSEAELLARIDALNNDPKIHGILV
FOLD_CUPMC       ----PASQVYVRNKVKACEDNGF---YSSLNRYPADLSEADLLARIDELNNDPKIHGILV
FOLD_RALSO       ----PASQVYVRNKIKACEDNGF---LSIFDRYPADLTEADLLGRIDALNRDPRIHGILV
FOLD_POLSJ       ----PASQVYVRNKVKACQDNGL---HSVLEHYPAALSEAELLARVHALNNDPAIHGILV
FOLD_RHOFT       ----PASAVYVRNKVKACQDTGV---RSVFEKYEATLSEADLLARIAALNADPSIHGILV
FOLD_NITEU       ----PASCVYVRNKAKTCEELGI---RSEIFNFPGDISQKALLQQIQDLNVNPEIHGILV
FOLD_NITMU       ----PASRVYVRNKAKACGETGI---YSEVHEFPENANQDEVIGRIQELNGNPGIHGILV
FOLD_PSYA2       ----PASATYVRMKGNACQRVGM---DSIRVEMPSATTTAELMAKIDELNNNPDVHGILL
FOLD_PSYCK       ----PASATYVRMKGNACKRVGM---DSIRVEMPSVTTTAELMAKIYELNSSPDVHGILL
FOLD2_ACIAD      ----GASATYVRMKGNACRRVGM---DSLKIELSQETTTEQLLAEIEKLNANPDVHGILL
FOLD_ALCBS       ----PASATYVKMKGNACQRVGM---ESVAIELSEETTTAQLLAKIDELNNNQDVHGILL
FOLD_SACD2       ----PASATYVKMKGNACSRIGM---ESLKVEMPTSTTTEQLLAKINELNANPAVHGILL
FOLD1_COLP3      ----PSSATYVKMKSNACTRVGM---DSLKVEMSEETTTEELLAEIAKLNANPNIHGILL
FOLD_BACSK       ----PASATYVRMKGNACKRLGI---ESKKIELPKETTTKELLAVIRELNNDSSVHGILL
FOLD_LEPIC       ----PASETYVSMKVKACHSVGM---GSEMIRLREQTTTKELLDVIDKLNSDPNVDGILL
FOLD_LEPIN       ----PASETYVSMKVKACHSVGM---GSEMIRLREQTTTKELLDVIDKLNSDPNVDGILL
FOLD1_STRAW      ----PASVTYVRMKRARCAKAGI---RSRHIALPATTTTAELIDSLSGLSGDPEVHGILL
FOLD2_FRACC      ----PASAVYVGGKRRACVEAGM---ADLHQHLPADTSQEKVAALLDDLAADPAVSGILL
FOLD_SYMTH       ----PASKVYTANKERTAKELGM---HSVLYHLPATTTQQELADLVMQLNRDPAIHGILV
FOLD_DEHM1       ----PASHSYVDSKIKMCQNLGI---YSEHHPLPQSATNEDLLTLIARLNADPKISGILV
FOLD_DEHMC       ----PASHSYVDSKIKMCQNLGI---YSEHHPLPQNATNEDLLTLIAKLNADPKISGILV
FOLD_DESPS       ----PASMSYVSLKIKTALSLGF---YEVQESLSVETTEAELLALIEKYNNDDSIHGVLV
FOLD_LAWIP       ----PASLSYVTLKIKTAIELGF---HEIQDNQSETITEEELIGIIKKYNEDPLIHGILV
FOLD_SYNAS       ----PASMSYVTAKQKTACKLGF---YSLQDSQPGHVSESLLLDRIARYNKDPRIHGILV
FOLD_TREDE       ----PASQSYVKGKTNALHEVGM---NDRTFRLPETTTQDELLKLIKELNADKLINGILV
FOLD1_MYXXD      ----PASQAYVASKTRACESLGM---RGQTLTLPEDVSKEALFAVIDRLNADPSVHGILV
FOLD_TREPA       ----PASCTYVAAKQRALARAHL---RGETHRLPAHASHAQVLELIARLNEDARVHGILI
FOLD1_HALMA      ----PASETYVSMKQDDCEEVGI---EAIDIDIDSDADAAELYDTIEDLNADEDVNGILV
FOLD_NATPD       ----PASETYVNMKQRDCEEVGI---ESYHVDVDGDAPPETLYDEIAALNQNDDVHGYIV
FOLD2_HALMA      ----GASETYVSMKQRACNEIGI---EGFHHQISADESAEALFSTIDELNADPAVHGILV
FOLD_HALSA       ----QASETYVSMKQQDCEEVGI---AAEDVRIDPEASADTLFDTVAELNAREDVHGILV
FOLD_HALWD       ----PASQTYVSMKHDDCEEVGI---ATRDITIDPEAPAAELFDTVDELNADSSVHGILV
FOLD_SALRD       ----PASKAYVRGKEKDAAEVGI---ETETHHLDADTSQSELLDLVHDLNADASVDGILV
FOLD_RHOBA       ----PASQVYVRNKERACAKAGI---ASRLDRMPAATTQAELLAKVAELNADPAVSGILV
FOLD_NOSS1       ----PASAAYVRNKEKSCAKVGI---ASFGKHFPQETTQTELEDVIAALNQDEQVDGILV
FOLD_TRIV2       ----PASAAYVRNKEKSCAKVGI---ASFGKHFPQETSQKELEDVIAALNQDEQVDGILV
FOLD_TRIEI       ----PASGVYVRNKEKACTQVGI---TSLGKHFPTQTSQAQLGQVIQKLNQDPQVDGILV
FOLD_SYNY3       ----PASAVYVRNKEKACEKLGM---VSFGKHFSADTDQETLTAAIASLNEDERVDGILV
FOLD_GLOVI       ----PASAAYVRNKNKSGQAVGID--VAKSQHLKASLSETQLLALIDRLNADVTVDGILV
FOLD_SYNJA       ----PASAAYVRGKERACERVGI---ASFGRHFSAQDSPAHLLDAIAQLNQDERVDGILV
FOLD_SYNJB       ----PASAAYVRGKERACERLGI---ASFGRHFSAQDSPAHLLDTIDQLNQDERVDGILV
FOLD_THEEB       ----PASAVYVRAKEQACSRVGI---QSFGAHLPATITEAALLAKITELNQDERVDGILL
FOLD_SYNP6       ----PASAVYVRNKERACEQTGI---VSFGKHLPGDSSEAEIRALIEELNQDDRVDGILV
FOLD_SYNE7       ----PASAVYVRNKERACEQTGI---VSFGKHLPGDSSEAEIRALIEELNQDDRVDGILV
FOLD_PROM9       ----PASGVYVNNKEKACSRVGI---KSFIFHLKDNVEQKEVEQLINKLNFDKNIDGMLL
FOLD_PROMP       ----PASGVYVGNKEKACSRVGI---KSYIFHLKDTVEQKEVEQLLNKLNLDNNIDGMLL
FOLD_SYNS9       ----PASAVYVANKEKACARIGV---ASYGAHLPSSTPFAEVLSTIQQLNADPRVDGILL
FOLD_SYNSC       ----PASAVYVANKEKACARIGV---ASFGDHLPGDTPPALVLQTIERLNANPEVDGILL
FOLD_SYNPX       ----PASAVYVANKEKACARVGI---ASYGAHLAADTPADQVLSTIQSLNADPRVDGILL
FOLD_SYNS3       ----PASAVYVRNKEKACARIGV---ESFGSHLPADASQQEVLTAIRELNADDRVDGILL
FOLD_PROMM       ----PASGVYVANKQKACGRIGV---ASHLTHLPETVSVSKVLATIQALNIDERVDGILL
FOLD_PROMA       ----PASGIYVSNKEKACNRIGL---DSFLYHLGTNTSEQEILEVIKALNNDQKVDGILL
FOLD_PROMT       ----PASGVYVNYKEKACDRIGV---RSFAKHLKEDISLEELTEIIKSLNEEKNVDGILL
FOLD_DESAG       ----PASQVYVRNKERACADAGI---RSEAFRISAQTTQQELEERIAALNAREDIDGILL
FOLD_DESVH       ----PASQVYVRNKERACHDTGI---VSEAFRLAPTTTQEELERLIADLNVRPDIDGILL
FOLD_THET2       ----PASVAYVRLKDKRARALGY---RSQVEVYPEDLPEEALLERIAALNADEEVDGILV
FOLD_THET8       ----PASVAYVRLKDKRARALGY---RSQVEVYPEDLPEEALLERIAALNADEEVDGILV
FOLD2_DEIGD      ----PASVSYVRGKDRKAREVGL---KSTVYALPETTSQAELLDLIARLNADDTVNGILV
FOLD1_RUBXD      ----PASVTYVSNKRRDCAEVGI---ESRLHAFPADVPQKELLALVERLNGDPEVSGFFI
FOLD_KORVE       ----PASEIYVRNKVKACEMTGI---YSEQHTPPDTVSTADLLQLVESLNRRNDIDGILV
FOLD_COREF       ----PASHSYVKMKHRDCEQIGV---NSIRRDLPADISQEELFAVIDELNADDSCTGYIV
FOLD_CORGL       ----PASHSYVKMKHRDCEQIGV---NSIRKDLPADVTQEELFAVIDELNNDDSCTGYIV
FOLD_CORJK       ----PASHSYVRMKHKDCEQIGV---NSIRKDLPADVSQEELNAVIDELNADDACTGYIV
FOLD_CORDI       ----PASHAYVRMKHKDCEIVGV---KSIRKDLPADVTQEELLAVIDDLNADPECTGYIV
FOLD_MYCBO       ----PGSQAYVRGKHADCAKVGI---TSIRRDLPADISTATLNETIDELNANPDCTGYIV
FOLD_MYCTU       ----PGSQAYVRGKHADCAKVGI---TSIRRDLPADISTATLNETIDELNANPDCTGYIV
FOLD_MYCPA       ----PGSQAYVRGKHADCAKVGI---TSIRRDLPADISTAALNDTIDELNANPECTGYIV
FOLD_MYCLE       ----PGSHAYVRGKHADCAKVGI---TSIRRDLPVDITTAVLHDTIEELNANPDCTGYIV
FOLD_MYCFO       ----PGSQAYVRGKHADCAKVGI---NSIRRDLPADITQAQLDETIDELNANPDCTGYIV
FOLD_MYCSS       ----PGSQAYVRGKHSDCAKVGI---NSIRRDLPADISQAELDATIDELNANPECTGYIV
FOLD2_RHOJR      ----PGSAAYVRGKHNDCAKVGI---TSIRRDLPGDITQEKLDATIDELNANPDCTGYIV
FOLD2_STRAW      ----PGSQKYVAGKHRDCAQVGI---ASIQRELPATATQEEIEAAVRELNEDPACTGYIV
FOLD_STRCO       ----PGSQKYVAGKHRDCAQVGI---ASIQRELPATATQEEIEAVVRELNEDPACTGYIV
FOLD_THEFY       ----PGSHAYVRGKHRDCAEVGI---ASIRKDLPADATQADVEAAVAELNADPACTGFIV
FOLD_CUTAK       ----PASHQYVAGKHRDCAQVGI---ESIRVDLPADVTEEELAQKIRGLNANPHCTGYIV
FOLD_LEIXX       ----PGSQWYVAGKHRDCAEVGI---ASLRRDLPAEISQAELEAVVEQLNADPGCTGFIV
FOLD_BIFLO       ----PGSMKYVAGKHADCQEVGI---TSVKKELPADASFDDIAAAVRELNEDPACTGFIV
FOLD_PELCD       ----GPSVSYVNKKRETCKQVGI---ASFHNEIPASATQSDLLAAVRDFNDSPDVDAYII
FOLD_TROW8       ----PASRSYVLSKHRDCNNIGI---QSTLIELPANTSEKELISKVEILNASSDVSGIIV
FOLD_TROWT       ----PASRSYVLSKHRDCKNIGI---QSTLIELPANTSEKELISKVEILNASSDVSGIIV
FOLD_BDEBA       ----KASHVYVKNKKIACEKIGM---TSTIHTLPAETTQSELNQILSKLNNDNGVDGILV
FOLD_LACAC       ----PASKIYVRTKKRRAEKMGI---IQDIYQLPADTKQEVALNLIDKLNEDPDINGVMV
FOLD_LACDA       ----PASKVYVASKKRKAEKLGI---KQVVYQLPADESEEDVLKLIDSLNADPEVSSLMV
FOLD2_LACJO      ----PASKIYLRVKRNLAKKVGI---KEIGLHFPANTSQAELLEKIEDLNQDPSINGIMV
FOLD_METHJ       ----PASHMYVRMKHRACEQVGI---SSVNISLPEDTTTRTILERIRQLNEDPDIDGILV
FOLD_CLOD6       ----SDDLSYERGALKRCQNIGI---TTEVLELAEDITQEEYIDVLKRVNDDKNVNGILC
FOLD1_DESHY      ----PDDVYYENNIIKNCETIGI---ATKTYPLDLNISMEEFTAVMTQVNDDPSVHGIML
FOLD_CARHZ       ----PDDLYYEGGAKKTCESIGM---DYEVFEYPQDIDQESFEKAIIEIGAKKDIHGILM
FOLD_CLOAB       ----GGSLYYVNNQKKVSESLGI---EFKSIFLDESIREEELIKLIEGLNVDNKIHGIML
FOLD_CLOTE       ----KGSLFYIKNQRRICKEIGI---EFKNIVLEENIEEDKIIEVIEDLNKDENVHGIIL
FOLD_CLOP1       ----GGSVYYQNFQEKLANNLGI---DFEKIKLDESISEENLKLKIEELNKDDSVNGIML
FOLD_CLOPE       ----GGSVYYQNFQEKLANNLGI---DFEKIKLDESISEENLKLKIEELNKDDSVNGIML
FOLD_CLOPS       ----GGSVYYQNFQEKLANNLGI---DFEKIKLDESISEENLKLKIEELNKDDSVNGIML
FOLD2_SYNWW      ----PSSMAYVRGIRKFAEETGV---KVEIVNLPDAVGERELLKTIGDLNNSSEITGIML
FOLD2_DESHY      ----PASVVYAKSKQKVSDSLGI---DFELTVLPADSSEESILALIDSLNANPDVHGIMI
FOLD_CALS4       ----ESSKVYANSKVKACESVGI---EAKVYYFSE-KEEDKFFDTLEKLNEDKDTHGIMI
FOLD_METAC       ----PASKMYVRLKHRACERVGI---KAEDYLLPGDATQEELLTLIDSLNKNKDVHAILL
FOLD_METMA       ----PASKMYVRLKHRACERVGI---RAEDFLLPADSTQEELLALIDSLNNNKDVHGILL
FOLD_METBF       ----PASKMYVRLKHRACERVGI---QAEDHFLPAETSQEELISLINTLNKDQNVHGILL
FOLD_METBU       ----PASKMYVRLKHKACGRVGI---FAEDQHLPEDITQEELLEAISSLNARKDIHGILL
FOLD1_SYNWW      ----KEDLHYVGLKEKAATATGG---KSRLLHLPEDTSQQELMAKIAELNQDEQVDGILL
FOLD2_RUBXD      ----YAARAYERRVGGLAAELGC---RYVCERLPREAEEADVLAVVGKLNADPRVSGILV
FOLD3_RUBXD      ----YAARAYERRVGGLAAELGC---RYVCERLPREAEEADVLAVVGKLNADPRVSGILV
FOLD_NOCFA       ----PASAWYVNSLRKAAERLGI---ACERIDLGADATADGIRAELRERSADPAFDAIML
FOLD1_RHOJR      ----ESTAWYVRSIASAAKRTGI---LCDIVDLGAAASTEQIRSTLVELGHDPDVHGIIL
FOLD_ARTGO       ----SSTHWYVRSIERAAEAAGI---NCRIIDVGHDATEQVLIAVLKDLSAELSVNGIIL
FOLD1_FRACC      ----PAAYSYAEIIERTAGKVGV---HCVLHE--PKGEPAAILDTIDTVAADPTVHGIIV
FOLD3_ROSDO      ----PEVAVYVRNQARAASTAGL---PFDQEFWGADVTQDECKAMIQKMNDDPEVLGIIL
FOLD2_RUEPO      ----PEVAVYVRNQARAASAVGV---PFDQQLWDRSISQEVCQSLIREMNDDPDVLGIIL
FOLD_RHOCB       ----PEIEVYVRNQARAAATAGL---PFEQVVWEASATQEACKRKIAALNDDPSVLGIIL
FOLD2_RHILO      ----DAVDVYVRNQRAKAQLAGI---DFEERRFPATITSGELEAAIHGLNADPRVTGIII
FOLD_PYRAE       PVELETQRRFVTLKARDVREIGGEVEIYELYSAPPERRTKEALRLIESLNRRDDVTGVII
FOLD_THEAC       ----EAASIYARAKIRRGKKIGI---AVDLEKYDDISMKD-LLKRIDDLAKDPQINGIMI
FOLD_THEVO       ----SAATIYARAKIKRGKKIGA---DVVLEKYEDLTKQE-LVRRIEELSADKDVNGIMV
FOLD_PICTO       ----YGSVVYSKAKMRRGSKLGI---DVDLDRYDSISRED-LIKLLKRYSQSDDIHGIMI
FOLD_THEMA       ----PSALSYLKSQRKKAEKLGI---AFEIM---NVSPEE-IVSTLKKLGSDESVNGVFV
FOLD1_DEIGD      ----EASRVYVHSKARQAERLGV---RFTARDLGADAKQDELHAVLQALSADADVHGVVL
FOLD_DEIRA       ----EASQVYVQSKAKRAKKLGV---AFRVVDLGAAATQEALEQTLRELSADPAVHGIVL
FOLD_MYCPE       ----AASDKYVSIKLKKAAELGV---KTTLISEGIKTQDD-LIKQIHILNNDDSIDGYII
FOLD_BORBU       ----PASNLYVSIKSRVAKEIGL---NVEVIKFSANSVQSDILEVIDRENKNLSTDGIIV
FOLD_BORBP       ----PASKLYVSIKNRVAKEIGL---NVEVIKFSANSVQSDILEVIDRENKNLSTDGIIV
FOLD_BORAP       ----PASKLYVSIKNRVAKEIGL---NVEVIKLSANSVQSDILEVIDRENKNLSTDGIIV
FOLD_MYCMO       ----FSSNKYIKTKMDKALEIGV---VSRLIKIPESISEKDLISIIEEESK--ISHGLIV
FOLD_MYCPU       ----ASSKIYVKKKIEFAQDIGV---EAKLFHFEENVDFNLLKDAFKKIDK--EYDGIIL
FOLD_MYCS5       ----MESNRYVEQKLKKAKEIGI---EAKCFKFDENITQKRLLLAMDEINE--NWDGILI
FOLD_MYCGE       ----DSSDSFIKQKLIACNTVGA---KSELIKLSNQITQAELIEKIISLNHDVNVTGIIL
FOLD_MYCPN       ----VSSDAFIRQKMNACNTLGA---QSELIKYHESVTEKELLEKIQQLNTDPEVTGIIL
FOLD_MYCGA       ----EASRIYVRNKINYCDSLGI---QTEVYDLSKIDDTNQFIVEMNQKISLSNPNGVLV
                          :                                   .          . . 

FOLD_BACSU       QLPLPDH------ISEKA---VIERISPDKDVDGFHPLNVGKMLLGEDT-----FLPCTP
FOLD_BACLD       QLPLPDH------ISEQA---VIERISPEKDVDGFHPLNVGKMLLGEDT-----FLPCTP
FOLD_BACCZ       QLPLPKH------IEEKA---IIERISPEKDVDGFHPISVGRMMTGQDT-----FLPCTP
FOLD_BACHK       QLPLPKH------IEEKA---IIERISPEKDVDGFHPISVGRMMTGQDT-----FLPCTP
FOLD_BACAN       QLPLPKH------IEEKA---IIERISPEKDVDGFHPISVGRMMTGQDT-----FLPCTP
FOLD_BACC1       QLPLPKH------IEEKA---IIERISPEKDVDGFHPISVGRMMTGQDT-----FLPCTP
FOLD_BACCR       QLPLPKH------IEEKA---IIERISPEKDVDGFHPISVGRMMTGQDT-----FLPCTP
FOLD_GEOKA       QLPLPDH------ICEWS---VIETIAPEKDVDGFHPINVGKMMIGQRA-----FLPCTP
FOLD_BACHD       QLPLPEQ------ISEQA---VIERISPAKDVDGFHPISVGRMMIGEDT-----FLPCTP
FOLD_OCEIH       QLPLPDQ------MDEQK---IIHAISPAKDVDGFHPINVGKMMTGEDT-----FIPCTP
FOLD_LISMF       QLPLPEH------ISEEK---VIDTISYDKDVDGFHPVNVGNLFIGKDS-----FVPCTP
FOLD_LISMO       QLPLPEH------ISEEK---VIDTISFDKDVDGFHPVNVGNLFIGKDS-----FVPCTP
FOLD_LISIN       QLPLPKH------ISEEK---VIDAISFDKDVDGFHPVNVGNLFIGKDS-----FVPCTP
FOLD_STAA3       QVPLPKQ------VSEQK---ILEAINPEKDVDGFHPINIGKLYIDEQT-----FVPCTP
FOLD_STAAC       QVPLPKQ------VSEQK---ILEAINPEKDVDGFHPINIGKLYIDEQT-----FVPCTP
FOLD_STAAS       QVPLPKQ------VSEQK---ILEAINPEKDVDGFHPINIGKLYIDEQT-----FVPCTP
FOLD_STAAW       QVPLPKQ------VSEQK---ILEAINPEKDVDGFHPINIGKLYIDEQT-----FVPCTP
FOLD_STAA8       QVPLPKQ------VSEQK---ILEAINPEKDVDGFHPINIGKLYIDEQT-----FVPCTP
FOLD_STAAM       QVPLPKQ------VSEQK---ILEAINPEKDVDGFHPINIGKLYIDEQT-----FVPCTP
FOLD_STAAN       QVPLPKQ------VSEQK---ILEAINPEKDVDGFHPINIGKLYIDEQT-----FVPCTP
FOLD_STAAB       QVPLPKQ------VSEQK---ILEAINPDKDVDGFHPINIGKLYIDEQT-----FVPCTP
FOLD_STAAR       QVPLPKQ------VSEQK---ILEAINPDKDVDGFHPINIGKLYIDEQT-----FVPCTP
FOLD_STAHJ       QVPLPKQ------VSEQK---ILEAINPEKDVDGFHPSNIGKLYIDEQT-----FVPCTP
FOLD_STAEQ       QVPLPKQ------VSEQK---VLEAINPEKDVDGFHPINIGKLYIDEQT-----FVPCTP
FOLD_STAES       QVPLPKQ------VSEQK---VLEAINPEKDVDGFHPINIGKLYIDEQT-----FVPCTP
FOLD_STAS1       QVPLPDQ------VSEQK---VLESINPAKDVDGFHPENIGKLYIDQQT-----FVPCTP
FOLD_STRTR       QLPLPNH------INEMR---ILLAIDPKKDVDGFHPMNTGNLWNGRPQ-----MVPCTP
FOLD_STRT1       QLPLPNH------INEMR---ILLAIDPKKDVDGFHPMNTGNLWNGRPQ-----MVPCTP
FOLD_STRT2       QLPLPNH------ISEMR---ILLAIDPKKDVDGFHPMNTGNLWNGRPQ-----MVPCTP
FOLD_STRA1       QLPLPQH------INDKK---IILAIDPKKDVDGFHPMNTGHLWSGRPM-----MVPCTP
FOLD_STRA3       QLPLPQH------INDKK---IILAIDPKKDVDGFHPMNTGHLWSGRPM-----MVPCTP
FOLD_STRA5       QLPLPQH------INDKK---IILAIDPKKDVDGFHPMNTGHLWSGRPM-----MVPCTP
FOLD_STRMU       QLPLPAH------INDKK---IILAIDPHKDVDGFHPMNTGHLWSGRSM-----MVPCTP
FOLD_STRP8       QLPLPNH------INDKK---IILAIDPKKDVDGFHPMNTGHLWSGRPL-----MVPCTP
FOLD_STRPM       QLPLPNH------INDKK---IILAIDPKKDVDGFHPMNTGHLWSGRPL-----MVPCTP
FOLD_STRP1       QLPLPNH------INDKK---IILAIDPKKDVDGFHPMNTGHLWSGRPL-----MVPCTP
FOLD_STRP3       QLPLPNH------INDKK---IILAIDPKKDVDGFHPMNTGHLWSGRPL-----MVPCTP
FOLD_STRP6       QLPLPNH------INDKK---IILAIDPKKDVDGFHPMNTGHLWSGRPL-----MVPCTP
FOLD_STRPB       QLPLPNH------INDKK---IILAIDPKKDVDGFHPMNTGHLWSGRPL-----MVPCTP
FOLD_STRPC       QLPLPNH------INDKK---IILAIDPKKDVDGFHPMNTGHLWSGRPL-----MVPCTP
FOLD_STRPD       QLPLPNH------INDKK---IILAIDPKKDVDGFHPMNTGHLWSGRPL-----MVPCTP
FOLD_STRPF       QLPLPNH------INDKK---IILAIDPKKDVDGFHPMNTGHLWSGRPL-----MVPCTP
FOLD_STRPN       QLPLPKH------IDEEA---VLLAIDPEKDVDGFHPLNMGRLWSGHPV-----MIPSTP
FOLD_STRR6       QLPLPKH------IDEEA---VLLAIDPEKDVDGFHPLNMGRLWSGHPV-----MIPSTP
FOLD_ENTFA       QLPLPKH------IDEEK---ILLAIDPKKDVDGFHPMNLGRLFVGKPE-----MIPCTP
FOLD_LACLA       QLPLPEH------ISEEK---VLLAIDPEKDVDGFHPMNMGRLWSGNPL-----MIPSTP
FOLD_LACS1       QLPLPKH------INENK---VTHRIIPEKDVDGFHPLNIGKLFMNIPG-----PLPCTP
FOLD1_LACJO      QLPLPKH------LNQTE---LIEAIAPEKDVDGFNSKNVGKLYNNEEGH---YPVSCTS
FOLD_LACPL       QSPLPAQ------INEPL---ITMAIDPKKDVDGFHPTNVGKLITNFPGN---YPVANTP
FOLD_LACSS       QLPLPKQ------INEDH---VIQAIDAKKDVDGFSPVNIGQLWLNQPG-----LVACTP
FOLD_RICCN       QLPLPSS------IDKNK---ILSAVSPSKDIDGFHPLNVGYLH-SGIS---QGFIPCTA
FOLD_RICFE       QLPLPSS------IDKNK---ILSAVSPSKDIDGFHPLNVGYLH-SGIS---QGFIPCTA
FOLD_RICPR       QLPLPSS------IDENK---ILSAVLPSKDSDGFHPLNVGYLH-SGIN---QGFIPCTA
FOLD_RICTY       QLPLPSS------IDENK---ILSAVLPSKDSDGFHPLNVGYLH-SGIN---QGFIPCTA
FOLD_RICBR       QLPLPNS------IDKNK---ILSAISPSKDVDGFHPLNVGYLH-SGID---NGFVPCTA
FOLD_PELUB       QLPLPKH------IDKQK---VIETILPGKDVDGFHPMNVGNLS-SGYE---SS-VPCTP
FOLD_ANAMM       QLPLPRH------IDKEL---VINAISPEKDVDGFHNANAGKLATGQL----DCMIPCTP
FOLD_ANAPZ       QLPLPKH------IDKIL---IINAIDPEKDVDGFHNANAGKLLTGEM----DCMVPCTP
FOLD_EHRCJ       QLPVPKH------IDKNL---IINTIDPRKDVDGFHNDNVGRLFTGQKR---NCLIPCTP
FOLD_EHRCR       QLPVPKH------IDKNL---IINTIDPRKDVDGFHNENVGRLFTGQKK---DCLIPCTP
FOLD_EHRRG       QLPVPRH------IDKNL---IINTIDPKKDVDGFHNENVGRLFTGQKK---NCLVPCTP
FOLD_EHRRW       QLPVPRH------IDKNL---IINTIDPKKDVDGFHNENVGRLFTGQKK---NCLVPCTP
FOLD_WOLPM       QLPLPNH------ISASR---VINTVSVEKDVDGFHDENVGKLVKGEK----NCLIPCTP
FOLD_WOLTR       QLPLPNH------INASK---VINTVSVEKDVDAFHRENVGKLVKGEK----NCLVPCTP
FOLD_NEOSM       QLPLPPH------INPTR---IIESIDSKKDVDCFHPENVGRLALSKD----ALLKPCTP
FOLD2_PSE14      QLPLPSH------MEEAR---ALQAIDPGKDVDGFHSENVGGLSQGRSV-----LTPCTP
FOLD2_PSESM      QLPLPAH------INEAH---ALQAIAAAKDVDGFHSENVGGLSQGRNV-----LTPCTP
FOLD2_PSEU2      QLPLPAH------IDENR---VLQAIDPDKDVDGFHSENVGGLSQGRNV-----LTPCTP
FOLD1_ACIAD      QLPLPKQ------INETR---VLERIHPQKDVDGFHSENVGGLSQGRDV-----LTPCTP
FOLD_GLUOX       QLPLPAQ------IDPVA---VTNAIAPHKDVDGLGEVNAGRLSLGIDG-----IVPCTP
FOLD1_PSEPK      QFPLPPQ------IDVSR---VISAIHPSKDVDGFNPLNVGRLAAGLEGG----LTPCTP
FOLD_SPHCR       QLPLPAQ------IDSGK---VLDTIDPRKDVDGFHPVNVFRLSTGTGG-----LVPCTP
FOLD_METC4       QLPLPPH------IAPER---VLQRILPCKDVDGFHPVNAGLLATGQPG-----LVPCTP
FOLD1_RHIEC      QLPLPKP------LDSEP---IIQSILPEKDVDGLSVVNAGKLATGDL---KTGLVSCTP
FOLD2_RHIEC      QLPLPKP------LDSEP---IIQSILPEKDVDGLSVVNAGKLATGDL---KTGLVSCTP
FOLD_RHIL3       QLPLPKP------LDSEA---IIQSILPEKDVDGLSVVNAGKLATGDL---KTGLVSCTP
FOLD_RHILT       QLPLPKP------LDSEA---IIQSILPEKDVDGLSVVNAGKLATGDL---KTGLVSCTP
FOLD2_RHIME      QLPLPKH------LRSEP---IIQSILPEKDVDGLHVVNAGKLATGDL---EGGLVSCTP
FOLD1_RHIME      QLPLPEH------LDADA---IIQSIRPEKDVDGLHVANAGKLATGDL---ESGLISCTP
FOLD_AGRFC       QLPLPKH------FNSDE---IIQSILPEKDVDGLSVLNAGKLATGDL---ATGLISCTP
FOLD_BARHE       QLPLPDH------INTNR---ITQAIAFQKDVDGFHYINIGKLAANAL---EDAIIPCTP
FOLD_BARQU       QLPLPAH------INTNC---VTQAIAFQKDVDGFHYINIGKLSCNTL---EDAIIPCTP
FOLD_BRUA2       QLPLPGH------IDSGR---VIQTIAPEKDVDGFHFINVGKLGTGEV---ETAFVPCTP
FOLD_BRUAB       QLPLPGH------IDSGR---VIQTIAPEKDVDGFHFINVGKLGTGEV---ETAFVPCTP
FOLD_BRUME       QLPLPGH------IDSGR---VIQTIAPEKDVDGFHFINVGKLGTGEV---ETAFVPCTP
FOLD_BRUSU       QLPLPGH------IDSGR---VIQTIAPEKDVDGFHFINVGKLGTGEV---ETAFVPCTP
FOLD1_RHILO      QLPLPAH------IDAGK---IIQAIAPQKDVDGFHFINVGKLGTGEL---DTAFVPCTP
FOLD_CHESB       QLPLPKQ------IDSER---IIHTIAPEKDVDGFHILNVGMLGTGAV---TKALVPCTP
FOLD_SINFN       QLPLPRH------VDSGK---VIQAISPQKDIDGFHFINVGKLGTGAL---ETAFVPCTP
FOLD_NITHX       QLPLPKG------LDTET---IVAAIDPAKDVDGLHPHNAGRLAGGLP-----ALSPCTP
FOLD_NITWN       QLPLPKG------LDTEA---IIAAIDPAKDVDGLHPHNAGRLAGGLS-----ALSPCTP
FOLD_BRADU       QLPLPKG------LNTEA---VINAIDPAKDVDGLHPNNAGRLAGGFE-----ALSPCTP
FOLD_RHOP2       QLPLPKG------LDSNA---VIDAIDPAKDVDGLNPVNAGRLASGLF-----ALTPCTP
FOLD_RHOPS       QLPLPKG------LDSNA---VIDAIDPAKDVDGLNPVNAGRLASGLF-----ALTPCTP
FOLD_RHOPB       QLPLPKG------LDSNA---VIAAVDPAKDVDGLNPVNAGRLASGLF-----ALTPCTP
FOLD_RHOPA       QLPLPKG------LDSNA---VIDAIDPAKDVDGLNPTNAGRLASGLF-----ALTPCTP
FOLD2_ROSDO      QLPLPKH------LDEDL---IINSIDPAKDVDGFHISNVGLLGTGQK-----SMVPCTP
FOLD_RUEST       QLPLPKH------LDEDL---VINSIAPEKDVDGFHISNVGLLGTGQK-----SMVPCTP
FOLD1_ROSDO      QLPLPGH------LDEDL---VINSIAPEKDVDGFHISNVGLLGTGQK-----SMVPCTP
FOLD1_RUEPO      QLPLPGH------LDEDL---VINAIDPAKDVDGFHISNVGLLGTGQK-----SMVPCTP
FOLD_RHOS4       QLPLPAH------LNADL---VINALDPAKDVDGFHISNVGRLGTGQK-----SMVPCTP
FOLD_JANSC       QFPVPDH------LDERR---TVARISPAKDVDGLSVTNAGLLSSGGE-----ALVSCTP
FOLD_MAGSA       QLPVPKH------IDTQK---VIEAIDPAKDVDGFHPVNVGRLAAGGD-----ALVPCTP
FOLD_NOVAD       QLPLPRH------MDEQK---VIAAINPDKDVDGFHVINAGRLAVGQP-----GFVPCTP
FOLD_SPHAL       QLPLPGH------LDEQA---AVATIDPDKDVDGLTPVSAGRLALGIP-----GMVPCTP
FOLD_CAUVC       QFPVPPH------ISQMD---VVAALSPDKDVDGLTVTNAGRLASGLP-----ALAPCTP
FOLD_ZYMMO       QLPLPKH------IDTPT---ILEAIDPDKDVDGFHVVNAGRLAIGTP-----SLVPCTP
FOLD_RHORT       QLPLPAH------IDEDK---ILLAIDPDKDVDGFHPVNVGRLSIGQSN-GEHGMVPCTP
FOLD_HYPNA       QLPLPKG------LDADA---AIEKINPDKDVDGLTEVSAGRLSLGKP-----GLRPCTP
FOLD_MARMM       QMPLPGH------IDTNR---VIGRIDPDKDVDGLTEVSAGRLVLGKP-----GLRPCTP
FOLD_CHLTR       QLPLPKH------LDAQA---ILSTITPDKDVDGLHPVNVGKLLLGET----DGFIPCTP
FOLD_CHLTA       QLPLPKH------LDAQA---ILSTITPDKDVDGLHPVNVGKLLLGET----DGFIPCTP
FOLD_CHLMU       QLPLPKH------LDTQT---ILSSISPNKDVDGLHPVNMGKLLLGET----DGFIPCTP
FOLD_CHLAB       QIPLPKH------LDSHA---IIQAISPEKDVDGLHPVNMGKLLLGQL----GGFAPCTP
FOLD_CHLCV       QIPLPKH------LDANA---VIQAISPEKDVDGLHPINMGKLLLGQL----GGFAPCTP
FOLD_CHLFF       QIPLPKH------LDSNV---IIQAISPEKDVDGLHPVNMGKLLLGQL----GGFSPCTP
FOLD_CHLPN       QLPLPKH------LDSEV---ILQAISPDKDVDGLHPVNMGKLLLGNF----DGLLPCTP
FOLD_PARUW       QLPLPPH------INSNR---VNYHIDPQKDVDGFHPLNVGKMLIGEL----DGFLPCTP
FOLD_BACFN       QLPLPKH------ISEQK---VIETIDYRKDVDGFHPINVGRMSIGL-----PCYVSATP
FOLD_BACFR       QLPLPKH------ISEQK---VIETIDYRKDVDGFHPINVGRMSIGL-----PCYVSATP
FOLD_BACTN       QLPLPKH------ISEQK---VIETIDYRKDVDGFHPINVGRMSIGL-----PCYVSATP
FOLD_PORGI       QLPLPKH------IDEQK---IIEAVDPRKDVDGFHPINVGRLSIGL-----PGFVSATP
FOLD_CYTH3       QLPLPKH------IDEQK---VTEAISPDKDVDGFHPTSLGRMVLNL-----PTYLPATP
FOLD1_GEOMG      QLPLPRH------INQQH---IINAIAPEKDIDGFHPTNFGRMTLGQ-----KAFRPATA
FOLD1_GEOSL      QLPLPKH------INQQH---VINAIAPEKDIDGFHPANFGRMTLGQ-----KAFRPATA
FOLD_CHLCH       QQPMPKQ------IDEFT---ITLAIDPAKDVDGFHPENLGRLVMGHLD---KCFVSCTP
FOLD_PELLD       QQPLPKQ------IDEFA---VTLAIDPAKDVDGFHPENLGRLVMGHLD---KCFVSCTP
FOLD_HELPY       QLPLPRH------IDTKM---ILEAIDPNKDVDGFHPLNIGKLCTQKE----S-FLPATP
FOLD_HELPH       QLPLPRH------IDSKM---VLEAIDPSKDVDGFHPLNIGKLCTQKE----S-FLPATP
FOLD_HELPJ       QLPLPRS------IDTKM---ILEAIDPNKDVDGFHPLNIGKLCTQKE----S-FLPATP
FOLD_HELHP       QLPLPAH------IQTSK---VLEAINPKKDVDGFHPFNIGRLSVNVD----T-FVPATP
FOLD_SULDN       QLPLPTQ------IDTTK---ILELVEPSKDVDGFHPYNVGRLTTGLD----G-FVPCTP
FOLD_WOLSU       QLPLPKH------INTAK---VLEAIAPHKDVDGFHPQNVGRLTSNLG----G-FAPATP
FOLD_CAMJE       QLPLPDH------ICKDL---ILESIISSKDVDGFHPINVGYLNLGLE----SGFLPCTP
FOLD_CAMJR       QLPLPDH------ICKDL---ILESIISSKDVDGFHPINVGYLNLGLE----SGFLPCTP
FOLD_AQUAE       QLPLPKH------IDQTR---VILSISPEKDVDGFHPENMGKLVAQIE----DGFIPCTP
FOLD_FUSNN       NLPLPPQ------INATK---VLNSIKLIKDVDGFKAENLGLLFQNNE----GFTSPSTP
FOLD_FRAT1       QLPLPAH------INKNN---VIYSIKPEKDVDGFHPTNVGRLQLRDK----KCLESCTP
FOLD_FRATT       QLPLPAH------INKNN---VIYSIKPEKDVDGFHPTNVGRLQLRDK----KCLESCTP
FOLD_FRATH       QLPLPAH------INKNN---VIYSIKPEKDVDGFHPTNVGRLQLRDK----KCLESCTP
FOLD_FRATO       QLPLPAH------INKNN---VIYSIKPEKDVDGFHPTNVGRLQLRDK----KCLESCTP
FOLD_MYCCT       QLPLPKH------LNEQM---FLQAITPLKDVDGFHYINQGKMLEGYD----T-IYPCTP
FOLD_MYCMS       QLPLPKH------LDEQE---FLQAIDPLKDVDGFHYINQGKMLEGYD----T-IYPCTP
FOLD_MESFL       QLPLPID------FIEED---YLQAITPSKDVDGFHYINQGKMLQGYD----T-VYPCTP
FOLD_SPICI       QLPLPSH------INSEK---VINTIITKKDVDGFTPKILGNLMLGHY----N-LLPSTP
FOLD_BUCAI       QLPLPPQ------INHMK---ILSSIVPDKDVDGFHPYNTGSLCQR-----TPKLRACTP
FOLD_BUCAP       QLPIPKQ------INYYK---IFSSIRPDKDVDGFHPYNTGSLCQR-----NPTLRACTP
FOLD_BUCBP       QLPIPPN------INNQK---LFSSIIPTKDVDGFHPYNIGSLCQK-----SPYLRPCTP
FOLD_BLOFL       QLPLPDK------LNDIK---ILEHIIPDKDVDGFHPYNVGRLCQR-----SPMLRPCTS
FOLD_BLOPB       QLPLPNK------LNKIN---VLEHIAPDKDVDGFHPYNVGRLCQR-----SPTLRPCTS
FOLD_WIGBR       QLPLPKE------INKLN---VLEKIIPKKDVDGFHPYNIGRLCQR-----KPTIVPCTP
FOLD_ECOLI       QLPLPAG------IDNVK---VLERIHPDKDVDGFHPYNVGRLCQR-----APRLRPCTP
FOLD_SHIDS       QLPLPAG------IDNVK---VLERIHPDKDVDGFHPYNVGRLCQR-----APRLRPCTP
FOLD_SHIFL       QLPLPAG------IDNVK---VLERIHPDKDVDGFHPYNVGRLCQR-----APRLRPCTP
FOLD_SHISS       QLPLPAG------IDNVK---VLERIHPDKDVDGFHPYNVGRLCQR-----APRLRPCTP
FOLD_SHIBS       QLPLPAG------IDNVK---VLERIHPDKDVDGFHPYNVGRLCQR-----APRLRPCTP
FOLD_ECO57       QLPLPAG------IDNVK---VLERIHPDKDVDGFHPYNVGRLCQR-----APRLRPCTP
FOLD_ECOL5       QLPLPAG------IDNVK---VLERIHPDKDVDGFHPYNVGRLCQR-----APRLRPCTP
FOLD_ECOL6       QLPLPAG------IDNVK---VLERIHPDKDVDGFHPYNVGRLCQR-----APRLRPCTP
FOLD_ECOUT       QLPLPAG------IDNVK---VLERIHPDKDVDGFHPYNVGRLCQR-----APRLRPCTP
FOLD_SALTY       QLPLPAG------IDNVK---VLERIAPDKDVDGFHPYNVGRLCQR-----APRLRPCTP
FOLD_SALCH       QLPLPAG------IDNVK---VLERIAPDKDVDGFHPYNVGRLCQR-----APRLRPCTP
FOLD_SALPA       QLPLPAG------IDNVK---VLERIAPDKDVDGFHPYNVGRLCQR-----APRLRPCTP
FOLD_SALTI       QLPLPAG------IDNVK---VLERIAPDKDVDGFHPYNVGRLCQR-----APRLRPCTP
FOLD_PHOLL       QLPLPAG------IDNVK---VLERIQPDKDVDGFHPYNIGRLCQR-----APKLRPCTP
FOLD_YERPA       QLPLPNG------IDNVK---VLERIHPDKDVDGFHPYNVGRLCQR-----APKLRACTP
FOLD_YERPE       QLPLPNG------IDNVK---VLERIHPDKDVDGFHPYNVGRLCQR-----APKLRACTP
FOLD_YERPN       QLPLPNG------IDNVK---VLERIHPDKDVDGFHPYNVGRLCQR-----APKLRACTP
FOLD_YERPS       QLPLPNG------IDNVK---VLERIHPDKDVDGFHPYNVGRLCQR-----APKLRACTP
FOLD_PECAS       QLPLPEG------IDNTK---VIERIAPDKDVDGFHPYNVGRLCQR-----APLLRACTP
FOLD_SODGM       QLPLPAG------IDNIS---VLERIAPDKDVDGFHPYNVGRLCQR-----APLLRPCTP
FOLD_BAUCH       QLPLPVG------IDNIR---VLEQIAPHKDVDGFHPYNLGRLCQR-----APLLRPCTP
FOLD_PHOPO       QLPLPAG------MDCTR---ILERIDPEKDVDGFHPYNVGRLSQR-----IPKLRSCTP
FOLD_PHOPR       QLPLPAG------IDTTN---ILEHIDPEKDVDGFHPYNVGRLSQR-----IPKLRSCTP
FOLD_VIBVU       QLPLPAG------IDSTH---VLESIHPEKDVDGFHPYNVGRLAQR-----IPKLRSCTP
FOLD_VIBVY       QLPLPAG------IDSTH---VLESIHPEKDVDGFHPYNVGRLAQR-----IPKLRSCTP
FOLD_VIBPA       QLPLPAG------IDTTH---VLERIHPEKDVDGFHPYNVGRLAQR-----IPKLRSCTP
FOLD_VIBCH       QLPLPAG------MDTTK---VLESIHPEKDVDGFHPYNVGRLAQR-----IPKLRSCTP
FOLD_ALIF1       QLPLPAG------MDSTK---ILEHIDPEKDVDGFHPYNVGRLSQR-----IPKLRSCTP
FOLD_PSEHT       QLPLPEG------LDVEK---ILERITPHKDVDGFHPYNIGRLAQR-----MPALRPCTP
FOLD_IDILO       QLPLPAG------LDATP---ILERIRPDKDVDGFHPFNIGRLSQR-----IPALRPCTP
FOLD_PSEA6       QLPLPAG------LDKEQ---VLERILPHKDVDGFHPYNIGRLAQR-----IPALRPCTP
FOLD_SHEDO       QLPLPEH------IDDSK---VIERIRPDKDVDGFHPYNVGRLAQR-----IPVLRPCTP
FOLD_SHEFN       QLPLPAH------IDDSK---VIERIRPDKDVDGFHPYNVGRLAQR-----IPVLRSCTP
FOLD_SHESM       QLPLPAH------IEDSK---VIERIRPDKDVDGFHPYNVGRLAQR-----IPVLRSCTP
FOLD_SHESR       QLPLPAH------IEDSK---VIERIRPDKDVDGFHPYNVGRLAQR-----IPVLRSCTP
FOLD_SHEON       QLPLPAH------IEDSK---VIERIRPDKDVDGFHPYNVGRLAQR-----IPVLRSCTP
FOLD2_COLP3      QLPLPKN------LNADL---IIEHINPLKDVDGFHPSNVGKLVLR-----QPGLRPCTP
FOLD_HAEIN       QLPLPKQ------INAEA---IIERIDPKKDVDGFHPYNVGRLCQR-----IPTLRACTP
FOLD_HAEI8       QLPLPKQ------INAEA---IIERIDPKKDVDGFHPYNVGRLCQR-----IPTLRACTP
FOLD_HAES1       QLPLPKK------INSTK---VIEHISPTKDIDGFHPYNVGRLCQR-----IPTLRACTP
FOLD_PASMU       QLPLPKH------IDSTK---VIERITPEKDVDGFHPYNVGRLCQR-----IPTLRACTP
FOLD_MANSM       QLPLPKH------IDSTK---VIERIAPHKDVDGFHPYNVGRLCQR-----IPTLRACTP
FOLD_HAEDU       QLPLPEH------INPIH---ITEAISSDKDVDGFHPYNVGRLCQK-----IPTLRSCTS
FOLD_COXBU       QLPLPAH------IDPAN---LLERIRPDKDVDGFHPYNLGRLVQR-----RPALRPCTP
FOLD_LEGPH       QLPLPKH------INERT---IIEYIKPEKDVDGFHPYNLGRLAQR-----NPFLRPCTP
FOLD_LEGPL       QLPLPKH------INERT---IIEHIKPEKDVDGFHPYNLGRLAQR-----NPFLRPCTP
FOLD_LEGPA       QLPLPKH------INERT---IIEHIKPEKDVDGFHPYNLGRLAQR-----NPFLRPCTP
FOLD1_PSE14      QLPLPAH------LDASL---LLERIRPDKDVDGFHPYNVGRLAQR-----IPLLRPCTP
FOLD1_PSESM      QLPLPAH------LDASL---LLERIRPDKDVDGFHPYNVGRLAQR-----IPLLRPCTP
FOLD1_PSEU2      QLPLPAH------LDASL---LLERIRPDKDVDGFHPYNVGRLAQR-----IPLLRPCTP
FOLD_PSEF5       QLPLPEH------LDASL---LLERIRPDKDVDGFHPYNVGRLAQR-----IPLLRPCTP
FOLD_PSEPF       QLPLPEH------LDASK---LLERIRPDKDVDGFHPYNVGRLAQR-----IPLLRPCTP
FOLD2_PSEPK      QLPLPAH------LDASL---LLERIRPDKDVDGFHPYNIGRLAQR-----IPLLRPCTP
FOLD_PSEAE       QLPLPAH------LDASL---LLERIHPDKDVDGFHPYNIGRLAQR-----MPLLRPCTP
FOLD_HAHCH       QLPLPTH------MDADN---ILERIKPDKDVDGFHPYNLGRLAQR-----MPVLRPCTP
FOLD_CHRSD       QLPLPDH------LDARP---ILERIRPDKDVDGFHPYNLGRLAQR-----LPVLRPCTP
FOLD_METFK       QSPLPAH------IEEKK---IIETISATKDVDGFHPYNIGRLAVR-----QPTLRSCTP
FOLD_NITOC       QLPLGGH------IDAEQ---VIEQIRPDKDVDGFHPYNIGRLTLR-----LPLLRPCTP
FOLD2_HYDCU      QLPLPDH------IDAET---IIEAIHPDKDVDGFHPYNIGRLTVR-----MPTLRPCTP
FOLD_THIDA       QLPLPVH------IDAET---VIERIRPDKDVDGFHPYNIGRLAVK-----MPTLRPSTP
FOLD_NEIMA       QLPLPKH------LDSQA---VLERISPDKDVDGFHPYNVGRLAVK-----MPLMRPCTP
FOLD_NEIMB       QLPLPKH------LDSQA---VLERISPDKDVDGFHPYNVGRLAVK-----MPLMRPCTP
FOLD_NEIG1       QLPLPKH------LDSQA---ILERISPDKDVDGFHPYNVGRLAVK-----MPLMRPCTP
FOLD_CHRVO       QLPLPEQ------IDPQA---VIERIDPKKDVDGFHPYNVGRLAIK-----MPLMRPCTP
FOLD1_HYDCU      QLPVPDH------IDPEE---IIERIDPKKDVDGFHPYNMGRLATR-----LPELAPCTP
FOLD_ALKEH       QLPLPDH------IDEQT---VIDRIHPDKDVDGFHPVNMGRLTLR-----LPGLRPCTP
FOLD_XANAC       QLPLPGI------PDANR---LIQRIDPRKDVDGFHPQNVGHLALR-----EFGLRPCTP
FOLD_XANC5       QLPLPGI------PDANR---LIQRIDPRKDVDGFHPQNVGHLALR-----EFGLRPCTP
FOLD_XANOM       QLPLPGI------PDANR---LIQRIDPRKDVDGFHPQNVGHLALR-----EFGLRPCTP
FOLD_XANOR       QLPLPGI------PDANR---LIQRIDPRKDVDGFHPQNVGHLALR-----EFGLRPCTP
FOLD_XANC8       QLPLPGI------PDANR---LIQRIDPRKDVDGFHPQNVGHLALR-----EFGLRPCTP
FOLD_XANCP       QLPLPGI------PDANR---LIQRIDPRKDVDGFHPQNVGHLALR-----EFGLRPCTP
FOLD_XYLFA       QLPLPGI------PDAHR---LIQRVDPRKDVDGFHPQNVGHLALR-----EFGLRPCTP
FOLD_XYLFT       QLPLPGI------PDAHR---LIQRIDPRKDVDGFHPQNVGHLALR-----EFGLRPCTP
FOLD_ANADE       QLPLPKH------VDERA---VLDAISPAKDADGFHPFNVGALSIGI----AGVPRPCTP
FOLD2_MYXXD      QLPLPRH------IDPDV---IISAVKPEKDVDGFHPLNAGNLLLG-----RSTTRACTP
FOLD2_GEOMG      QLPLPKQ------INSDT---ILEAISPVKDVDGFHPYNVGRLMVG-----KPTFQPCTP
FOLD2_GEOSL      QLPLPPQ------INADR---VLEAISPAKDVDGFHPYNVGRLVTG-----KPTFQPCTP
FOLD_MOOTA       QLPLPDH------IDEKK---VIDAIALEKDVDGFSPANVGNLVIG-----DKCFYPCTP
FOLD_AROAE       QLPLPKQ------FNEAE---VLEAIRVEKDVDGFHAENVGRLSQG-----QEAFLPCTP
FOLD_DECAR       QLPLPKH------FDEEA---VLEAISAEKDVDGFHAENVGALAQG-----NPRFIPCTP
FOLD_BORBR       QLPLPRH------MDAHK---VIEAIAAEKDVDGFHISNAGLLMTG-----QPLFRPCTP
FOLD1_BORPE      QLPLPRH------MDAHK---VIEAIAAEKDVDGFHISNAGLLMTG-----QPLFRPCTP
FOLD1_BORPA      QLPLPRH------MDAHK---VIEAIAAEKDVDGFHISNAGLLMTG-----QPLFRPCTP
FOLD_BORA1       QLPLPAH------LDSHK---VIEAIAPEKDVDGFHISNAGLLMTG-----QPLFRPCTP
FOLD2_BORPA      QLPLPPH------MSAHR---VIEAISPLKDVDGFHISNAGLLMTG-----KPQFQPCTP
FOLD2_BORPE      QLPLPPH------MSAHR---VIEAISPLKDVDGFHISNAGLLMTG-----KPQFQPCTP
FOLD_BURCA       QLPLPAH------IDSHK---VIEAIAPEKDVDGFHVANAGALMTG-----KPLFRPCTP
FOLD_BURL3       QLPLPKH------IDSHK---VIEAIAPEKDVDGFHIANAGALMTG-----KPLFRPCTP
FOLD_BURP1       QLPLPAH------IDSHK---VIEAIAPEKDVDGFHVANAGALLTG-----KPLFRPCTP
FOLD_BURPS       QLPLPAH------IDSHK---VIEAIAPEKDVDGFHVANAGALLTG-----KPLFRPCTP
FOLD_BURMA       QLPLPAH------IDSHK---VIEAIAPEKDVDGFHVANAGALLTG-----KPLFRPCTP
FOLD_BURTA       QLPLPAH------IDSHK---VIEAIAPEKDVDGFHVANAGALLTG-----KPLFRPCTP
FOLD_PARXL       QLPLPPH------IDSHK---VIEAIAPEKDVDGFHVANAGALMTG-----QPLFRPCTP
FOLD_CUPPJ       QLPLPKH------IDSHK---VLEAIAPEKDVDGFHVANAGALMTG-----APLFRPCTP
FOLD_CUPMC       QLPLPKH------IDSHK---VLEAIAPEKDVDGFHVANAGALMTG-----APLFRPCTP
FOLD_RALSO       QLPLPKH------IDSHK---VLEAIAPEKDVDGFHVANAGALMTG-----APLFRPCTP
FOLD_POLSJ       QLPLPAH------IDAHK---VIEAIAPGKDVDGFHVASAGALMVG-----QPGFWPCTP
FOLD_RHOFT       QMPIPKH------INPHK---VIEAISVTKDVDGYATLSAGELMTG-----APGFRPCTP
FOLD_NITEU       QLPLPGH------IRIDE---VIAAIAIGKDVDGFHPCNVGALVTG-----HALFHPCTP
FOLD_NITMU       QLPLPRH------FDSSR---VTESVAVEKDVDGFHLYNVGALVTG-----SSIFPPCTP
FOLD_PSYA2       QHPVPAH------IDERA---CFEQIDLAKDVDGVTCLGFGRMAMQ-----QSAYGSCTP
FOLD_PSYCK       QHPVPAH------IDERA---CFEKIDLAKDVDGVTCLGFGRMAMQ-----QSAYGSCTP
FOLD2_ACIAD      QHPVPAQ------IDERA---CFDAISLAKDVDGVTCLGYGRMAMG-----EAAYGSATP
FOLD_ALCBS       QHPVPAQ------IDERA---CFDAISLEKDVDGVTCLGFGRMSMG-----EAAYGCATP
FOLD_SACD2       QHPVPEQ------IDERA---CFDAIALEKDVDGVTCLGFGRMAMG-----EEAYGCATP
FOLD1_COLP3      QHPVPPQ------INERQ---CFDSIDLSKDVDGVTCWGFGRMAMN-----ETSYGSATP
FOLD_BACSK       QHPVPSQ------IDERA---AFDEIAIEKDVDGVTTLGFAQNAFG-----FAHYPSCTP
FOLD_LEPIC       QHPTPSG------IDERA---AFDRIALHKDVDGVTTLSFGKLSMG-----VETYLPCTP
FOLD_LEPIN       QHPTPSG------IDERA---AFDRIALHKDVDGVTTLSFGKLSMG-----VETYLPCTP
FOLD1_STRAW      QHPCGPH------IDERA---AFEAIAPAKDVDGVTMHSFAAMSFG-----LPGFVSCTP
FOLD2_FRACC      QLPVPEG------LDGAA---LVGRIPPGKDVDGLTTASVGLLARG-----LPGLRPCTP
FOLD_SYMTH       QSPLPEG------LDMDA---VIRLIDPRKDVDGFHPENVGRLWIG-----QDGLVPCTP
FOLD_DEHM1       QVPLPVQ------ISENL---VLNAINPDKDVDGFHPVNVGRMCLG-----EPCFLPCTP
FOLD_DEHMC       QVPLPAQ------ISESL---VLNAINPDKDVDGFHPVNVGRMCLG-----EPCFLPCTP
FOLD_DESPS       QLPLPKH------INEQN---IITAIDPDKDVDAFHPVNIGRLMIGG---DDVKFLPCTP
FOLD_LAWIP       QLPLPSH------INEGK---VLHAIDPNKDVDGFHPMNLGRLVIGG---NAITFLPCTP
FOLD_SYNAS       QLPLPPH------IDEQK---ILYAIDPGKDVDGFHPYNVGKLMIG-----QADFLPCTP
FOLD_TREDE       QLPLPKQ------IDPDA---VIEAINPEKDVDGFHPVNVGKLLLG-----HDTFIPCTP
FOLD1_MYXXD      QLPLPAH------LPYKA---VLEHIHPAKDVDGFHPVNAGLAFVG----DPRAFVPCTP
FOLD_TREPA       QLPLPAH------LDAAR---VCRAVAPEKDVDGFHPLNCGALFLA----QP-GFVPCTP
FOLD1_HALMA      QMPVPDH------VEDRS---VLRAIDPMKDVDGFHPENVGRLVAG-----DARYKPCTP
FOLD_NATPD       QAPVPDH------VDYRE---VIRRVDPQKDVDGFHPENVGRLVAG-----DARFRPCTP
FOLD2_HALMA      QMPVPDH------VPKRD---VLERIDPMKDVDGFHPENVGRLVAG-----NARYKPCTP
FOLD_HALSA       QDPTPDH------VPDER---VLSAVDPAKDVDGFHPENVGKLVGG-----TPRFKPCTP
FOLD_HALWD       QMPLPDH------VDERE---VLRRIDPKKDVDGFHPENVGRLVAG-----QPRYKPCTP
FOLD_SALRD       QLPLPDH------VDERT---VIDAVDPSKDVDGFHPENLGRLMRG-----TPRYIPATP
FOLD_RHOBA       QLPLPSKANGGTGIDERA---VLDAIDPIKDVDAFSPVNVGLLMQG-----RPRFLPCTP
FOLD_NOSS1       QLPLPEH------LDAVK---LLHQIEPDKDADGLHPVNLGRLVRG-----EKGLRSCTP
FOLD_TRIV2       QLPLPEH------LDAVK---LLHQIEPDKDADGLHPVNLGRLVRG-----EKGLRSCTP
FOLD_TRIEI       QLPLPKH------LDSTS---LLYQIDPSKDVDGLHPMNLGQLLRG-----EKGLRSCTP
FOLD_SYNY3       QLPLPDH------LDAVK---LLHTIDPSKDADGLHPVNLGHLVRG-----EEGLRSCTP
FOLD_GLOVI       QLPLPEH------IDSGR---VLNRIAPEKDVDGLHPVNLGRLVRG-----EPGLRSCTP
FOLD_SYNJA       QLPLPPG------WDPIP---PLLAIDPAKDVDGLHPLNLGRLVRG-----EPGLRSCTP
FOLD_SYNJB       QLPLPPG------WDPIP---PLLAINPDKDVDGLHPLNLGRLLRG-----EPGLRSCTP
FOLD_THEEB       QLPLPPH------LDPRP---LLYAIHPDKDVDGLHPENLGRLVRD-----EPGLRSCTP
FOLD_SYNP6       QLPLPSH------LDAVP---LLLAIDPEKDADGLHPLNLGRLLRG-----EEGLRSCTP
FOLD_SYNE7       QLPLPSH------LDAVP---LLLAIDPEKDADGLHPLNLGRLLRG-----EEGLRSCTP
FOLD_PROM9       QLPIPKK------FDEQR---LISYINPSKDVDGLNEINIGKLVKN-----EPAMRSCTP
FOLD_PROMP       QLPISKK------FDEQR---LISFINPEKDVDGLNEQNIGKLVKN-----EQAMRSCTP
FOLD_SYNS9       QLPLPEG------LDEGP---LLMAIDPEKDADGLHTLNLGRLLKG-----EQGPRSCTP
FOLD_SYNSC       QLPLPAG------LDEGP---LLMAIDPEKDADGLHTLNLGRLLKG-----EPGPRSCTP
FOLD_SYNPX       QLPLPKG------LDERP---LLEAIDPEKDADGLHTLNLGRLLKG-----EPGPRSCTP
FOLD_SYNS3       QLPLPEG------LDETP---LLAEIDPNKDADGLHTLNLGRLLKG-----EQGPRSCTP
FOLD_PROMM       QLPLPKG------LDEGP---LLAAIDPEKDADGLHTLNLGRLLKG-----EPGPRSCTP
FOLD_PROMA       QLPLPKG------LDAEP---LLKAIDPEKDVDGLHTLNLGRLLKG-----EKGPRSCTP
FOLD_PROMT       QLPLPSH------LDETA---LLRSIDPDKDADGLHPLNLGRLIKG-----EKGPRSCTP
FOLD_DESAG       QLPLPAG------LDSQR---CLELIDPAKDVDGFHPVNMGKLTLG-----LPGFRPCTP
FOLD_DESVH       QLPLPRG------LDAQR---CLEAIDPAKDVDGFHPQNMGRLALG-----LPGFRPCTP
FOLD_THET2       QLPLPPH------IRTQR---VLEAIHPLKDVDGFHPLNVGRLWSGG-----KGLFPCTP
FOLD_THET8       QLPLPPH------IRTQR---VLEAIHPLKDVDGFHPLNVGRLWSGG-----KGLFPCTP
FOLD2_DEIGD      QLPLPLH------IQEQA---VLHAIDPRKDVDGFHPLNVGELWAGR-----PALRPCTP
FOLD1_RUBXD      QLPLPGG------VDPLP---LLSAIDPSKDVDGLSPQSAGRLAVGL-----PSLLPCTP
FOLD_KORVE       QLPLPKQ------VDSKK---ILLAVSPEKDVDGFHPMNVGYLSTVR-----PGLVPCTP
FOLD_COREF       QLPLPKH------LDENA---VLERIDPAKDADGLHPVNLGKLVLNE-----PAPLPCTP
FOLD_CORGL       QLPLPKH------LDENA---VLERIDPAKDADGLHPVNLGKLVLNE-----PAPLPCTP
FOLD_CORJK       QLPLPKH------LDENA---VLERIDPDKDADGLHPVNLGKLVLNE-----PAPLPCTP
FOLD_CORDI       QLPLPKH------LDENA---VLERIDPAKDADGLHPVNLGKLVLNE-----PAPLPCTP
FOLD_MYCBO       QLPLPKH------LDENA---ALERVDPAKDADGLHPTNLGRLVLGT-----PAPLPCTP
FOLD_MYCTU       QLPLPKH------LDENA---ALERVDPAKDADGLHPTNLGRLVLGT-----PAPLPCTP
FOLD_MYCPA       QLPLPKQ------LDENA---ALERVDPDKDADGLHPTNLGRLVLNN-----PAPLPCTP
FOLD_MYCLE       QLPLPKY------LDENT---ALERVDPAKDADGLHPTNLGRLVLST-----PAPLPCTA
FOLD_MYCFO       QLPLPKH------LDENA---ALERIDPAKDADGLHPTNLGRLVLGK-----DAPLPCTP
FOLD_MYCSS       QLPLPKH------LDENA---ALERIDPGKDADGLHPTNLGRLVLNE-----PAPLPCTP
FOLD2_RHOJR      QLPLPKQ------LDENA---ALERIDPDKDADGLHPVNLGRLVLGK-----KAPLPCTP
FOLD2_STRAW      QLPLPKG------IDENR---ILELMDPDKDADGLHPMNLGRLVLNE-----PAPLPCTP
FOLD_STRCO       QLPLPRG------IDENR---ILELMDPDKDADGLHPMNLGRLVLNE-----PAPLPCTP
FOLD_THEFY       QLPLPRG------LDENR---VLEKIDPAKDADGLHPSNLGKLVLME-----EAPLPCTP
FOLD_CUTAK       QLPLPRH------IDTNW---ALNLIDPNKDADGLTPASLGRLVLNE-----PAPLPCTP
FOLD_LEIXX       QLPLPSH------LDTDA---VLELVDPAKDADGLHPTNLGRLVLNVNR-PITTPLPCTP
FOLD_BIFLO       QLPLPKG------INENA---IIDMIDPAKDADGMHPYNLGELVLHVRG-DISTPLPCTP
FOLD_PELCD       QYPLPKG------FDFNE---ALNLMLPEKDADGLHPVNLGRLVLQE-----PGPVPCTP
FOLD_TROW8       QLPLPES------IDQNK---VIEAINPDKDADGLHPLNLGYLVTGK-----QGIVPCTP
FOLD_TROWT       QLPLPES------IDQNK---VIEAINPDKDADGLHPLNLGYLVTGK-----QGIVPCTP
FOLD_BDEBA       QFPLPKH------LSSDE---VLKLVSAEKDADGLTYESLGYFFAG-----KPLVSPCTP
FOLD_LACAC       QLPAPEQ------IDADE---LLERIDPNKDVDGLTPSNIGRIWMEN-----HFIEPATA
FOLD_LACDA       QLPVPPQ------INADR---VIERIDPEKDVDCLTPANIGRLWQGK-----HFVEPATA
FOLD2_LACJO      QLPVPPQ------IDPRA---IFETIAPEKDADGFSPLNLGRLWEGQ-----SDVIPATV
FOLD_METHJ       QLPLPKS------IDTEA---VLAAILPEKDVDGFHPLNMGRLVTGL-----PGPRPCTP
FOLD_CLOD6       FRPLPKH------LNEE---VIKYVIAPEKDVDCFSPINSAKVMEGDKSG----FPPCTP
FOLD1_DESHY      FRPLPPQ------LDEE---VIKHLISADKDIDCMSPLNLEKVFEGDMSG----LLPCTP
FOLD_CARHZ       FSPLPKH------LNER---KIRSLIPVEKDVDSLTLGSAGKVFADDPTG----FPPCTP
FOLD_CLOAB       QLPLPNH------IDAK---LVTSKIDANKDIDSLTDINTGKFYKGEKS-----FIPCTP
FOLD_CLOTE       QMPLPKT------LDEE---KIVNKICPSKDIDGLTDINAGRFYKGEKC-----FIPCTA
FOLD_CLOP1       LLPLPKH------IDER---AVTNLIDADKDLDCLSEVSVGRFYKGEKC-----FMPCTP
FOLD_CLOPE       LLPLPKH------IDER---AVTNLIDADKDLDCLSEVSVGRFYKGEKC-----FMPCTP
FOLD_CLOPS       LLPLPKH------IDER---VVTNLIDADKDLDCLSEVSVGRFYKGEKC-----FMPCTP
FOLD2_SYNWW      QTPLPAS------LNAS---HLVNAIDFDKDVEGIHNYNLGKLISKEEG-----VRPCTP
FOLD2_DESHY      ELPLPKH------ISKE---RVMAAVRPDKDVDGVHPINRGYILSGEEG-----LFPATP
FOLD_CALS4       EMPLPKG------FDVD---KVYDTINPYKDVDCISNYNMGRLFAGKPL-----FVPCTP
FOLD_METAC       QLPLPKH------FSPQETQEAMEAISPTKDADGFHPYNMGKLMIGDED-----LVPCTP
FOLD_METMA       QLPLPEH------FSPQ---EAMEAISPAKDADGFHPYNMGKLMIGDEG-----LVPCTP
FOLD_METBF       QLPLPKH------LFPQ---EAMEAIAPEKDADGFHPYNMGKLMIGDEG-----LVPCTP
FOLD_METBU       QLPLPKH------LNEQ---EAMNAIDPAKDADGFHPFNMGQLLIGVEE-----LVPCTP
FOLD1_SYNWW      QLPLPAA------LEEQTD-EILAAIRPDKDVDGFSLVNRGRMSGDR-----PGFISCAA
FOLD2_RUBXD      LRPLPGH------ISEPA---VFSALDPLKDIEAVHPVNAGLLALGRPR-----YVPSTP
FOLD3_RUBXD      LRPLPGH------ISEPA---VFSALDPLKDIEAVHPVNAGLLALGRPR-----YVPSTP
FOLD_NOCFA       QTPLPAS------VALDD---VSSAIAADKDVDGVSPLSLGLLAAGLA-----GFVPATA
FOLD1_RHOJR      QTPLPDG------TDLDA---LREAINPAKDVDGANPVSLGRLVARLP-----AFAPATA
FOLD_ARTGO       QTPLPPG------VRTQE---LVKYIAPEKDIDGANPLSLGLLAVGER-----AFAPATA
FOLD1_FRACC      QTPLPGG------LTSRE---VGEHIPTAKDVDGMNPSSLGRLALGLP-----SFAPATA
FOLD3_ROSDO      QRPVPDH------INVRS---LQSAIHPLKDVEGMNPASIGNIVYNDV-----AMAPCTA
FOLD2_RUEPO      QRPVPDH------INVRA---LQAAIHPLKDVEGMNPASIGNIVYNDV-----AMAPCTA
FOLD_RHOCB       QRPVPAH------IHVRS---LQSAIHPLKDVEGMNPASIGNIVYNDI-----ALAPCTA
FOLD2_RHILO      QRPVPAH------ISVKT---LQAAVHPLKDVEGMHPASIGNIVYNQL-----DLAPCTA
FOLD_PYRAE       QKPLPPF------VDEKA---LFSALSPEKDVDALTPENKKRLLTDFDL--DRDVLPCTP
FOLD_THEAC       ENPLPKGFDYY---------EIVRNIPYYKDVDALSPYNQGLIALNRE-----FLVPATP
FOLD_THEVO       ENPLPKTIDYY---------DIVKSIPYYKDVDALSPYNQGSIAINRE-----FLVPATA
FOLD_PICTO       ETPVP-GINYY---------DVVNEIPFYKDVDGMTSYNLGNLYLKNE-----FIAPATA
FOLD_THEMA       ARPFPLGLDEK---------EILSSVPVEKDVEGVNPANLGLLLYDEE-----IFPPCTA
FOLD1_DEIGD      ELPLAPGLDAD---------AALRHIAPCKDVEGLTPANLALIAAGREA---EALLPPTP
FOLD_DEIRA       ELPLAAGLDAD---------AALLHIAARKDIEGLSPANLALIAAGREP---EALLPPTP
FOLD_MYCPE       QLPLPKGFDSN---------VICEHIDVNKDIDGLSSFAISRNLANSNL---FHPKPCTA
FOLD_BORBU       QLPLLKG------MDLNS---ILNSIVYSKDVDGLSFVNLGKMILGDKK----GFIPCTA
FOLD_BORBP       QLPLLRH------MDSNS---ILNSIVYSKDVDGLSFVNLGKMILGDKK----GFIPCTA
FOLD_BORAP       QLPLLKG------MDLNS---ILNGIVSSKDVDGLSFVNLGKMILGDKK----GFVPCTA
FOLD_MYCMO       QLPLPLQFDQ------SK---ILNSVPITKDIDGLSEKNSKNLYSGKS-----CIQPATA
FOLD_MYCPU       QLPV-LHFDV------NE---LLLMIDKNKDLDGLNPENEKAFYENRE-----CIIPATA
FOLD_MYCS5       QLPLPKHLPK------EV---ILDAVPYEKDIDGLSHRNEFILYNEKNS-DDKFFVPAAA
FOLD_MYCGE       QLPVYPH------LDKNS---LLEAINPLKDVDGLTTNHL------------AEIKPCIV
FOLD_MYCPN       QLPVYPH------LKQNK---LLKAIDPYKDVDYLTGNCP------------LPIRSCVV
FOLD_MYCGA       QLPIKER------LDTNK---IIENIPIRLDVDAFLYHRFDQDQKEK-------VIPCVL
                   *                      :    * :                           

FOLD_BACSU       HGIVELLKK-TNIDLSGKE-------VVVVGRSNIVGKPVGQLLLN---------ENATV
FOLD_BACLD       AGIVELLKK-TEIDLSGKE-------VVVVGRSNIVGKPVGQLLLN---------ENATV
FOLD_BACCZ       HGIVELVKE-TNLDISGKH-------VVVIGRSNIVGKPVGQLFLN---------ENATV
FOLD_BACHK       HGIVELVKE-TNLDISGKH-------VVVIGRSNIVGKPVGQLFLN---------ENATV
FOLD_BACAN       HGIVELVKE-TNLDISGKH-------VVVIGRSNIVGKPVGQLFLN---------ENATV
FOLD_BACC1       HGIVELVKE-TNLDISGKH-------VVVIGRSNIVGKPVGQLFLN---------ENATV
FOLD_BACCR       HGIVELVKE-TNLDISGKH-------VVVIGRSNIVGKPVGQLFLN---------ENATV
FOLD_GEOKA       HGILVMVQS-AGIDIAGKH-------VVVVGRSNIVGKPVGQLFLR---------EHATV
FOLD_BACHD       FGVLVMLQE-ANVEIAGKH-------VVVVGRSNIVGKPVGQLMLN---------EHATV
FOLD_OCEIH       YGILTMLRS-KDISLEGKH-------AVIIGRSNIVGKPIGLLLLQ---------ENATV
FOLD_LISMF       AGIIELIKS-TGTQIEGKR-------AVVIGRSNIVGKPVAQLLLI---------ENATV
FOLD_LISMO       AGIIELIKS-TGTQIEGKR-------AVVIGRSNIVGKPVAQLLLN---------ENATV
FOLD_LISIN       AGIIELIKS-TGTQIEGKR-------AVVIGRSNIVGKPVAQLLLN---------ENATV
FOLD_STAA3       LGIMEILKH-ADIDLEGKN-------AVVIGRSHIVGQPVSKLLLQ---------KNASV
FOLD_STAAC       LGIMEILKH-ADIDLEGKN-------AVVIGRSHIVGQPVSKLLLQ---------KNASV
FOLD_STAAS       LGIMEILKH-ADIDLEGKN-------AVVIGRSHIVGQPVSKLLLQ---------KNASV
FOLD_STAAW       LGIMEILKH-ADIDLEGKN-------AVVIGRSHIVGQPVSKLLLQ---------KNASV
FOLD_STAA8       LGIMEILKH-ADIDLEGKN-------AVVIGRSHIVGQPVSKLLLQ---------KNASV
FOLD_STAAM       LGIMEILKH-ADIDLEAKN-------AVVIGRSHIVGQPVSKLLLQ---------KNASV
FOLD_STAAN       LGIMEILKH-ADIDLEAKN-------AVVIGRSHIVGQPVSKLLLQ---------KNASV
FOLD_STAAB       LGIMEILKH-ADIDLEGKN-------AVVIGRSHIVGQPVSKLLLQ---------KNASV
FOLD_STAAR       LGIMEILKH-ADIDLEGKN-------AVVIGRSHIVGQPVSKLLLQ---------KNASV
FOLD_STAHJ       LGIMEILKH-ADIDLEGKN-------AVVIGRSHIVGQPVSKLLLQ---------ANATV
FOLD_STAEQ       LGIMEILKH-ADINLEGKN-------AVVIGRSHIVGQPVSKLLLQ---------ANATV
FOLD_STAES       LGIMEILKH-ADINLEGKN-------AVVIGRSHIVGQPVSKLLLQ---------ANATV
FOLD_STAS1       LGIMELLNH-ADIDLEGKD-------AVVIGRSHIVGQPVSKLLLQ---------KNASV
FOLD_STRTR       AGIMEILRE-YNVELEGKT-------AVIIGRSNIVGKPMAQLLLE---------KNATV
FOLD_STRT1       AGIMEILRE-YNVELEGKT-------AVIIGRSNIVGKPMAQLLLE---------KNATV
FOLD_STRT2       AGIMEILRE-YNVELEGKT-------AVIIGRSNIVGKPMAQLLLE---------KNATV
FOLD_STRA1       AGIMEMFRE-YHVDLEGKH-------AVIIGRSNIVGKPMAQLLLD---------KNATV
FOLD_STRA3       AGIMEMFRE-YHVDLEGKH-------AVIIGRSNIVGKPMAQLLLD---------KNATV
FOLD_STRA5       AGIMEMFRE-YHVDLEGKH-------AVIIGRSNIVGKPMAQLLLD---------KNATV
FOLD_STRMU       AGIMEMLSA-YHVDLEGKH-------AVIIGRSNIVGKPMAQLLLE---------KNATV
FOLD_STRP8       SGIMELLRE-YNVNLEGKH-------AVIIGRSNIVGKPMAQLLLD---------KNATV
FOLD_STRPM       SGIMELLRE-YNVNLEGKH-------AVIIGRSNIVGKPMAQLLLD---------KNATV
FOLD_STRP1       SGIMELLRE-YNVNLEGKH-------AVIIGRSNIVGKPMAQLLLD---------KNATV
FOLD_STRP3       SGIMELLRE-YNVNLEGKH-------AVIIGRSNIVGKPMAQLLLD---------KNATV
FOLD_STRP6       SGIMELLRE-YNVNLEGKH-------AVIIGRSNIVGKPMAQLLLD---------KNATV
FOLD_STRPB       SGIMELLRE-YNVNLEGKH-------AVIIGRSNIVGKPMAQLLLD---------KNATV
FOLD_STRPC       SGIMELLRE-YNVNLEGKH-------AVIIGRSNIVGKPMAQLLLD---------KNATV
FOLD_STRPD       SGIMELLRE-YNVNLEGKH-------AVIIGRSNIVGKPMAQLLLD---------KNATV
FOLD_STRPF       SGIMELLRE-YNVNLEGKH-------AVIIGRSNIVGKPMAQLLLD---------KNATV
FOLD_STRPN       AGIMEMFHE-YGIDLEGKN-------AVVIGRSNIVGKPMAQLLLA---------KNATV
FOLD_STRR6       AGIMEMFHE-YGIDLEGKN-------AVVIGRSNIVGKPMAQLLLA---------KNATV
FOLD_ENTFA       YGIMKMFEA-YDIDLTGKR-------AVVIGRSNIVGKPMAQLLLM---------KNATV
FOLD_LACLA       AGIMEMFRE-YDVELSGKR-------AVVIGRSNIVGKPMAQLLMM---------ADATV
FOLD_LACS1       RGIMEFFKE-YDIPVSGKR-------VVIVGRSNIVGRPMAALLVN---------SDATV
FOLD1_LACJO      RGIMTLLHT-YLDKIEGLN-------VTIVGRSILVSRPLQSLLIN---------ENATV
FOLD_LACPL       RGIMTMLAD-YGVDPAGKT-------AVVIGRSTIVGKPMAALLTN---------ANATV
FOLD_LACSS       NGIMRLLAA-HKIDVAGKN-------VVIVGRSNIVGRPLAALMLN---------ANATV
FOLD_RICCN       LGCLAAIKK-YEPNLTGKN-------VVIIGRSNIVGKPLSALLLK---------ENCSV
FOLD_RICFE       LGCLAVIKK-YEPNLTGKN-------VVIIGRSNIVGKPLSALLLK---------EDCSV
FOLD_RICPR       LGCLAVIKK-YAPNLNGKD-------AVIVGRSNIVGKPLSALLLQ---------ENCSV
FOLD_RICTY       LGCLAVIKK-YAPNLNGKD-------AVIVGRSNIVGKPLSALLLK---------ENCSV
FOLD_RICBR       LGCLEVIKK-HEPNLSGKN-------AIIVGRSNIVGKPLSALLLK---------ENCSV
FOLD_PELUB       LGCYLMIKK-IEPNLSGKK-------AVMIGRSNLNGKPMAQLLLK---------ENCTV
FOLD_ANAMM       QGCIHLIKT-VKQDLAGSN-------AVVVGRSNIVGKPVALLLLY---------ENCTV
FOLD_ANAPZ       QGCIYLIKK-VMPVLSSKR-------AVVIGRSNIVGKPVALLLMY---------ENCTV
FOLD_EHRCJ       RGCLYLIKT-VTHNLSGSD-------AVVIGRSNIVGKPMACLLLG---------ENCTV
FOLD_EHRCR       RGCLYLIKT-VTRNLSGSD-------AVVIGRSNIVGKPMACLLLG---------ENCTV
FOLD_EHRRG       QGCLYLIKT-ITRNLSGSD-------AVVIGRSNIVGKPMACLLLG---------ENCTV
FOLD_EHRRW       QGCLYLIKT-ITRNLSGSD-------AVVIGRSNIVGKPMACLLLG---------ENCTV
FOLD_WOLPM       KGSLHLIKS-IEENLSGKN-------AVVIGRSNIVGKPMFYLLLQ---------ENCTV
FOLD_WOLTR       KGALHLIKL-VETNLSGKN-------AVVIGRSNIVGKPMFHLLLQ---------ENCTV
FOLD_NEOSM       AGSLYLIKSALGDNLSGMD-------AVVIGRSNIVGKPMAMLLLH---------ENCTI
FOLD2_PSE14      SGCMHLLEETCGD-LSGKH-------AVVIGRSNIVGKPMAALLLQ---------AHCSV
FOLD2_PSESM      SGCMHLLKETCGD-LTGKH-------AVVIGRSNIVGKPMAALLLQ---------AHCSV
FOLD2_PSEU2      SGCLHLLEETCGD-LSGKH-------AVVIGRSNIVGKPMAALLLQ---------AHCSV
FOLD1_ACIAD      TGCIRLLKDSLGDDLSGLH-------AVVIGRSNIVGKPMAALLLK---------ESCTV
FOLD_GLUOX       LGCLMLLQSVHKD-MTGMH-------AVVIGASNLVGKPMAQLLLK---------ENCTV
FOLD1_PSEPK      LGVMRLIRSVHPD-IAGMG-------ALVVGASNVVGRPLARLLLQ---------ADCTV
FOLD_SPHCR       MGCMILLRSVLPD-LKGKQ-------AVVIGKSNIVGKPVAMLLLE---------QGCTV
FOLD_METC4       LGCLRLVQSVAAE-LVGQN-------VVVVGRSTIVGRPAAQVFLN---------ADCSV
FOLD1_RHIEC      AGAMVFVRRTHGEDLSGLN-------AVVIGRSNLFGKPMAQLLLN---------ANATV
FOLD2_RHIEC      AGAMVFVRRTHGEDLSGLN-------AVVIGRSNLFGKPMAQLLLN---------ANATV
FOLD_RHIL3       AGAMVFVRRTHGEDLSGLN-------AVVIGRSNLFGKPMAQLLLN---------ANATV
FOLD_RHILT       AGAMVFVRRTHGEDLSGLN-------AVVIGRSNLFGKPMAQLLLN---------ANATV
FOLD2_RHIME      AGAMVFVRRTYGDDLSGLN-------AVVIGRSNLFGKPMSALLLA---------ANATV
FOLD1_RHIME      AGAMVFVRRVHGRDLSGLN-------ALVIGRSNLFGKPMAQLLLN---------ANATV
FOLD_AGRFC       AGAMLLVRGIHGDDLSGLN-------AVVIGRSNLFGKPMGQLLLN---------ANATV
FOLD_BARHE       AGAMMMIEQQCGQDLSGLD-------AVVVGRSNIVGKPMAALLTA---------ANATV
FOLD_BARQU       AGAMIMIEQQCGRDLSGLD-------AVVVGRSNIVGKPMAALLTA---------ANATV
FOLD_BRUA2       AGAMIMIERVHGRDLSGLN-------AVVIGRSNIVGKPMFNLLLA---------ANATV
FOLD_BRUAB       AGAMIMIERVHGRDLSGLN-------AVVIGRSNIVGKPMFNLLLA---------ANATV
FOLD_BRUME       AGAMIMIERVHGRDLSGLN-------AVVIGRSNIVGKPMFNLLLA---------ANATV
FOLD_BRUSU       AGAMIMIERVHGRDLSGLN-------AVVIGRSNIVGKPMFNLLLA---------ANATV
FOLD1_RHILO      AGSMLLIQRVRGKDLSGLN-------AVVVGRSNIVGKPMANLLLA---------ANCTV
FOLD_CHESB       AGAMLLIEGVRGKDLSGLS-------AVVIGRSNIVGKPMANLLLA---------ANATV
FOLD_SINFN       AGCMILVERIHGKDLSGLS-------AVVVGRSNIVGKPMANLLLA---------ANATV
FOLD_NITHX       LGCIILTKSVHS-SLEGMD-------AIVIGRSNLVGRPLVQLLLN---------ENATV
FOLD_NITWN       LGCIILTKSVHA-SLEGLD-------AIVIGRSNLVGRPLVQLLLN---------ENATV
FOLD_BRADU       LGSIILTKSVHP-SLEGLN-------AIVIGRSNLVGRPLVQLLLN---------ENATV
FOLD_RHOP2       LGCIIMAKQVHA-SLEGMN-------AIVIGRSNLVGKPLVQLLLN---------ENATV
FOLD_RHOPS       LGCIIMAKQVHA-SLEGMN-------AIVIGRSNLVGKPLVQLLLN---------ENATV
FOLD_RHOPB       LGCIVMAKQVHA-SLEGMN-------AIVIGRSNLVGKPLVQLLLN---------ENATV
FOLD_RHOPA       LGSIIMAKTVHA-SLEGMN-------ALVIGRSNLVGKPLVQLLLN---------ENATV
FOLD2_ROSDO      LGCLMMLREHHG-SLSGMN-------AVVIGRSNIVGKPMAQLLLN---------DSCTV
FOLD_RUEST       LGCLMMLRDYHG-SLSGLD-------AVVIGRSNIVGKPMAQLLLG---------DSCTV
FOLD1_ROSDO      LGCLMMLRDYHG-SLLGMD-------AVVVGRSNIVGKPMAQLLLG---------DSCTV
FOLD1_RUEPO      LGCLMMLRDHHG-SLSGMD-------AVVIGRSNIVGKPMAQLLLG---------DSCTV
FOLD_RHOS4       LGCLMMLRDHLG-ALSGLN-------AVVVGRSNIVGKPMAQLLLG---------ESCTV
FOLD_JANSC       LGCLMLLRAEFD-SLSGKD-------AVVIGRSNLFGKPMAQLLLG---------DNCTV
FOLD_MAGSA       LGSLLLLKDTLG-KLGGLD-------AVVIGRSNIVGKPMAQLLIK---------ESCTV
FOLD_NOVAD       LGCLMLLKDRLG-DLSGLD-------AVVIGRSNIVGKPMAQLLIA---------ESCTV
FOLD_SPHAL       YGCLLLLQDRLG-DLSGKD-------AIVIGRSILVGKPMGQLLLG---------ANCTV
FOLD_CAUVC       TGCMMLIRDAIG-DLKGKT-------AVVIGRSNLMGKPMAQMLLA---------ADCTV
FOLD_ZYMMO       AGCMMLLEHSLG-SLKGKN-------ALVIGRSTIVGRPMAQLLLA---------ADCTV
FOLD_RHORT       KGCLMLLKGVLG-DLTGKT-------ALVIGRSNIVGKPMAQLLLS---------ANCTV
FOLD_HYPNA       VGSVILAKRALGPDLSGKN-------VVVIGRSILVGKPAALLFLA---------ENCTV
FOLD_MARMM       AGCVLLAERALG-DLSGKS-------VVVIGRSILVGKPAALLFLE---------KNATV
FOLD_CHLTR       AGIVELCKY-YEIPLHGKH-------VVILGRSNIVGKPLAALLMQRHAD-----TNASV
FOLD_CHLTA       AGIVELCKY-YEIPLHGKH-------VVILGRSNIVGKPLAALLMQRHAD-----TNASV
FOLD_CHLMU       SGIVELFKY-YEIPLYGKH-------VVILGRSNIVGKPLSALLMQKHAD-----TNASV
FOLD_CHLAB       AGIIELLHY-YEIPLLGRH-------VAVVGRSNIVGKPLAAMLMQKHPS-----TNATV
FOLD_CHLCV       AGIIELLHY-YEIPLHGRH-------VAVVGRSNIVGKPLAAMLMQKHPS-----TNATV
FOLD_CHLFF       AAVIELLNY-YDIPLQGRH-------VAVVGRSNIVGKPLAAMLMQKHPT-----TNATV
FOLD_CHLPN       AGIIELLNY-YEIPLRGRH-------AAIVGRSNIVGKPLAALMMQKHPQ-----TNCTV
FOLD_PARUW       FGIKTLLER-TGIEVCGKH-------ALIIGRSNIVGKPMAALLMQSYPG-----GNATV
FOLD_BACFN       NGILELLKR-YRIETSGKK-------CVVLGRSNIVGKPMAALMMQKAYP-----GDATV
FOLD_BACFR       NGILELLKR-YRIETSGKK-------CVVLGRSNIVGKPMAALMMQKAYP-----GDATV
FOLD_BACTN       NGILELLKR-YEIETSGKK-------CVVLGRSNIVGKPMASLMMQKAYP-----GDATV
FOLD_PORGI       KGIVELLRR-YNIPTRGKH-------CVVLGRSNIVGKPVSQLLLQKGEP-----GDCTI
FOLD_CYTH3       YGIMQLLER-NGIETSGKH-------CVVMGRSHIVGSPMSILMARNTNP-----GNATV
FOLD1_GEOMG      YGICKLLQF-YEIPVWGKH-------CVVIGRSNIVGKPISIMLSNDFDI-----GNATV
FOLD1_GEOSL      YGICKLLQF-YEVPVKAKH-------CVVIGRSNIVGKPISIMLSNDFDI-----GNATV
FOLD_CHLCH       YGILELLGR-YNIETKGKH-------CVVVGRSNIVGKPMANLMLQKLKE-----SNCTV
FOLD_PELLD       YGILELIGR-YGIETSGKH-------CVVIGRSNIVGKPMANLMMQKLKE-----SNCTV
FOLD_HELPY       MGVMRLLEH-YHIEIKGKD-------VAIIGASNIIGKPLSMLMLN---------AGASV
FOLD_HELPH       MGVMRLLKH-YHIEIKGKD-------VAIIGASNIIGKPLSMLMLN---------AGASV
FOLD_HELPJ       MGVMRLLEH-YHIEIKGKD-------VAIIGASNIIGKPLSMLMLN---------AGASV
FOLD_HELHP       LGVMKLLES-YHIDVRGKD-------VVIIGMSNIVGKPLMSLMLN---------AGASV
FOLD_SULDN       LGVMELLKE-YKIDVKGKN-------CVVVGASNIVGKPMAALLLN---------ANATV
FOLD_WOLSU       MGVMRLLQK-YGIDPQGKN-------AVIVGASNIVGKPMASLLLN---------ANATT
FOLD_CAMJE       LGVMKLLKA-YEIDLEGKD-------AVIIGASNIVGRPMATMLLN---------AGATV
FOLD_CAMJR       LGVMKLLKA-YEIDLEGKD-------AVIIGASNIVGRPMATMLLN---------AGATV
FOLD_AQUAE       LGIDILLKH-YGIDVKGKD-------VTIVGAGFIVGRPLSLLMLW---------RNATV
FOLD_FUSNN       AGIMALIEK-YNIDLEGKD-------VVVVGSSNIVGKPIAALILN---------SRGTV
FOLD_FRAT1       KGIMTMLRE-YGIKTEGAY-------AVVVGASNVVGKPVSQLLLN---------AKATV
FOLD_FRATT       KGIMTMLRE-YGIKTEGAY-------AVVVGASNVVGKPVSQLLLN---------AKATV
FOLD_FRATH       KGIMTMLRE-YGIKTEGAY-------VVVVGASNVVGKPVSQLLLN---------AKATV
FOLD_FRATO       KGIMTMLRE-YGIKTEGAY-------VVVVGASNVVGKPVSQLLLN---------AKATV
FOLD_MYCCT       IGIINLLKA-YNVDVKSKD-------ITIIGTSNIVGKPLAIMLSN---------MGATV
FOLD_MYCMS       IGIINLLKA-YNIDVRSKD-------ITIIGTSNIVGKPLAIMLSN---------MGATI
FOLD_MESFL       LGIINLLEE-YNISVKNKD-------ITLIGTSNIVGKPLGMMLLN---------NQATI
FOLD_SPICI       KGIIALLKH-YQIQLAGQH-------VVIIGRSNIVGKPLANLLIN---------ASATV
FOLD_BUCAI       KGIITMLKY-NKIKTHGLH-------AVMVGASNIVGRPMSLELLLA---------GCTT
FOLD_BUCAP       KGIITMLNY-TKIKTHGLN-------AVMVGASNIVGRPMSMELLLA---------GCTT
FOLD_BUCBP       FGIITMLKH-YKIKIRGLH-------AVVIGASNIVGRPMSMELLLA---------GCTT
FOLD_BLOFL       RGIMTLLKW-YNINTFVLN-------AVIIGASNIVGRPMLMELLLA---------GCTV
FOLD_BLOPB       RGIITLLEW-YNIDMFVLH-------AVVVGASNIVGRPMTMELLLA---------GCTV
FOLD_WIGBR       KGIIRLLKY-YKINLLGLN-------AVVVGASNIVGRPMSLELLLE---------GCTV
FOLD_ECOLI       RGIVTLLER-YNIDTFGLN-------AVVIGASNIVGRPMSMELLLA---------GCTT
FOLD_SHIDS       RGIVTLLER-YNIDTFGLN-------AVVIGASNIVGRPMSMELLLA---------GCTT
FOLD_SHIFL       RGIVTLLER-YNIDTFGLN-------AVVIGASNIVGRPMSMELLLA---------GCTT
FOLD_SHISS       RGIVTLLER-YNIDTFGLN-------AVVIGASNIVGRPMSMELLLA---------GCTT
FOLD_SHIBS       RGIVTLLER-YNIDTFGLN-------AVVIGASNIVGRPMSMELLLA---------GCTT
FOLD_ECO57       RGIVTLLER-YNIDTFGLN-------AVVIGASNIVGRPMSMELLLA---------GCTT
FOLD_ECOL5       RGIVTLLER-YNIDTFGLN-------AVVIGASNIVGRPMSMELLLA---------GCTT
FOLD_ECOL6       RGIVTLLER-YNIDTFGLN-------AVVIGASNIVGRPMSMELLLA---------GCTT
FOLD_ECOUT       RGIVTLLER-YNIDTFGLN-------AVVIGASNIVGRPMSMELLLA---------GCTT
FOLD_SALTY       RGIVTLLER-YNIDTYGLN-------AVVIGASNIVGRPMSMELLLA---------GCTT
FOLD_SALCH       RGIVTLLER-YNIDTYGLN-------AVVIGASNIVGRPMSMELLLA---------GCTT
FOLD_SALPA       RGIVTLLER-YNIDTYGLN-------AVVIGASNIVGRPMSMELLLA---------GCTT
FOLD_SALTI       RGIVTLLER-YNIDTYGLN-------AVVIGASNIVGRPMSMELLLA---------GCTT
FOLD_PHOLL       RGIATLLER-CGINTYGLN-------AVIIGASNIVGRPMSLELLLA---------GCTT
FOLD_YERPA       RGIMTLLER-YDIPTYGLN-------AVVVGASNIVGRPMSLELLLA---------GCTT
FOLD_YERPE       RGIMTLLER-YDIPTYGLN-------AVVVGASNIVGRPMSLELLLA---------GCTT
FOLD_YERPN       RGIMTLLER-YDIPTYGLN-------AVVVGASNIVGRPMSLELLLA---------GCTT
FOLD_YERPS       RGIMTLLER-YDIPTYGLN-------AVVVGASNIVGRPMSLELLLA---------GCTT
FOLD_PECAS       RGIITLLER-YNIDTFGLN-------AVVVGASNIVGRPMSLELLLA---------GCTT
FOLD_SODGM       RGIVTLLER-YHIDTFGLN-------AVVVGASNIVGRPMSLELLLA---------GCTV
FOLD_BAUCH       RGVITLLER-YNINIVGLN-------AVVVGASNIVGRPMGMELLLA---------GCTV
FOLD_PHOPO       KGIITLLER-YNIEVRGKH-------AVIVGASNIVGRPMTLELLLA---------GATT
FOLD_PHOPR       KGIITLLER-YNIPVRGKH-------AVIVGASNIVGRPMTLEMLLA---------GATT
FOLD_VIBVU       KGIITLLER-YNIALRGKH-------AVIVGASNIVGRPMTLELLLA---------GCTT
FOLD_VIBVY       KGIITLLER-YNIALRGKH-------AVIVGASNIVGRPMTLELLLA---------GCTT
FOLD_VIBPA       KGIITLLDR-YNIELRGKH-------AVVVGASNIVGRPMTLELLLA---------GCTT
FOLD_VIBCH       KGIITLLER-YNIPLRGKH-------AVIVGASNIVGRPMTLELLLA---------GCTT
FOLD_ALIF1       KGIITLLDR-YNIQVRGMH-------AVVVGASNIVGRPMTLELLLA---------GCTT
FOLD_PSEHT       KGIITLLDS-TGVRYKGLH-------AVVVGASNIVGRPMALELLLA---------GCTT
FOLD_IDILO       KGIMTLLEH-THVDLHGLN-------AVVVGASNIVGRPMSLELLLA---------GATT
FOLD_PSEA6       KGIMTLIES-TKRPIKGLD-------AVIVGASNIVGRPMFMELLLA---------GCTV
FOLD_SHEDO       LGIMTLIKS-TGVDTYGLD-------ATIVGASNIVGRPMTLELLLA---------GCTT
FOLD_SHEFN       MGIMTLIKS-TGIDTYGLD-------ATVVGASNIVGRPMTLELLLA---------GCTT
FOLD_SHESM       MGIMTLIKS-TGVDTYGLD-------AVVVGASNIVGRPMTLELLLA---------GCTT
FOLD_SHESR       MGIMTLIKS-TGVDTYGLD-------AVVVGASNIVGRPMTLELLLA---------GCTT
FOLD_SHEON       MGIMTLIKS-TGVDTYGLD-------AVVVGASNIVGRPMTLELLLA---------GCTT
FOLD2_COLP3      KGIVTLIES-TGIDPKGLD-------ALVIGASNIVGRPMGLELLLA---------KCTV
FOLD_HAEIN       YGVMKLLET-TGIDLHGKH-------AVIVGASNIVGRPMSLELLLA---------GATV
FOLD_HAEI8       YGVMKLLET-TGIDLHGKH-------AVIVGASNIVGRPMSLELLLA---------GATV
FOLD_HAES1       LGIMKLLET-TGVDLYGQH-------AVIVGASNIVGRPMALELLLA---------GCTV
FOLD_PASMU       YGVMKLLET-TGIDLHGKH-------AVIVGASNIVGRPMALELLLA---------GCTV
FOLD_MANSM       YGIMKLLET-TELNLKGRH-------AVIVGASNIVGRPMAMELLLA---------GCTV
FOLD_HAEDU       YGVMKLLES-THIDLSGLH-------AVIVGASNIVGRPMAMELLLA---------GCTV
FOLD_COXBU       YGVMTLLTE-THENLEGKH-------AVIVGASNIVGRPMALELLLA---------KCTV
FOLD_LEGPH       LGIMNLLHH-YELNVKRKH-------AVVIGASNIVGRPMSLELLLA---------GATV
FOLD_LEGPL       LGIMNLLHH-YELNVKRKH-------AVVIGASNIVGRPMSLELLLA---------GATV
FOLD_LEGPA       LGIMNLLHH-YELNVKRKH-------AVVIGASNIVGRPMSLELLLA---------GATV
FOLD1_PSE14      KGIITLLES-TGVDLYGLD-------AVVVGASNIVGRPMAMELLLA---------GCTV
FOLD1_PSESM      KGIIALLES-TGVDLYGLD-------AVVVGASNIVGRPMAMELLLA---------GCTV
FOLD1_PSEU2      KGIMTLLES-TGVDLYGLD-------AVVVGASNIVGRPMAMELLLA---------GCTV
FOLD_PSEF5       KGIMTLLES-TGADLYGMD-------AVVVGASNIVGRPMAMELLLA---------GCTV
FOLD_PSEPF       KGIMTLLES-TGADLYGMD-------AVVVGASNIVGRPMAMELLLA---------GCTV
FOLD2_PSEPK      KGIMTLLES-TGQDLYGMN-------AVIVGASNIVGRPMAMELLLA---------GCTV
FOLD_PSEAE       KGIMTLLAS-TGADLYGMD-------AVVVGASNIVGRPMALELLLG---------GCTV
FOLD_HAHCH       KGIMTLLAR-TGVELRGKD-------ALVVGASNIVGRPMGLELLLA---------GCTV
FOLD_CHRSD       KGIMTLLQE-SGIHARGLD-------AVIVGASNIVGRPMALELMLA---------GSTT
FOLD_METFK       YGVIKLLQS-TGVRLLGLD-------AVVVGVSNHVGRPMALELLLA---------GCTV
FOLD_NITOC       HGVITLLRT-TGQDLRGLE-------AVVVGASNIVGRPMMLELLLA---------GCTV
FOLD2_HYDCU      YGCMNLLNH-YDLSVKGKH-------AVIVGASNIVGRPMSLELLLA---------GATT
FOLD_THIDA       RGIMTLLRA-TNEELRGKN-------AVMVGASNIVGRPMSLELLLA---------GCTI
FOLD_NEIMA       KGVMTLLEA-YGIDPKGKK-------AVVVGASNIVGRPQALELLLA---------RATV
FOLD_NEIMB       KGVMTLLEA-YGIDPKGKK-------AVVVGASNIVGRPQALELLLA---------RATV
FOLD_NEIG1       KGVMTLLEA-YGIDPKGKK-------AVVVGASNIVGRPQALELLLA---------RATV
FOLD_CHRVO       RGVMTLLEE-YGIDPKGKK-------AVIVGASNIVGRPQALEMLLA---------RATV
FOLD1_HYDCU      HGVMTMLAK-TGIPLRGLN-------AVVVGASNIVGVPMALELLNE---------RATV
FOLD_ALKEH       NGVMTMLAH-AGIELEGKD-------AVIIGQSNIVGRPMAMELLNA---------RCTI
FOLD_XANAC       RGIVTLLGH-TDQPVRGRN-------ATIVGVSNHVGRPMGLELLIA---------GCTV
FOLD_XANC5       RGIVTLLGH-TDQPVRGRN-------ATIVGVSNHVGRPMGLELLIA---------GCTV
FOLD_XANOM       RGIVTLLSH-TDQPVRGRN-------ATIVGVSNHVGRPMGLELLIA---------GCTV
FOLD_XANOR       RGIVTLLSH-TDQPVRGRN-------ATIVGVSNHVGRPMGLELLIA---------GCTV
FOLD_XANC8       RGIVTLLAH-TDQPVRGRN-------ATIVGVSNHVGRPMGLELLIA---------GCTV
FOLD_XANCP       RGIVTLLAH-TDQPVRGRN-------ATIVGVSNHVGRPMGLELLIA---------GCTV
FOLD_XYLFA       RGIVTLLGH-TDRPVRGRN-------ATIVGVSNHVGRPMGLELLMA---------GCTV
FOLD_XYLFT       RGIVTLLGH-TDRPVRGRN-------ATIVGVSNHVGRPMGLELLMA---------GCTV
FOLD_ANADE       AGVMRMLDE-ARVDPKGKR-------ALVVGRSNIVGKPMAMMLLER---------HATV
FOLD2_MYXXD      YGVMRLLEE-IGCDPAGKR-------AVVVGRSNIVGKPMALMLLQK---------NATV
FOLD2_GEOMG      YGVMVMLRE-AGVDLAGKE-------VVVVGRSNIVGKPVALMCLQQ---------HATV
FOLD2_GEOSL      YGVMVMLQE-AGVDLAGKE-------VVVVGRSNIVGKPVALMCLQR---------NATV
FOLD_MOOTA       HGCMVLLEK-AGIDPKGKK-------AVVVGRSNIVGKPVAMMLLAR---------HATV
FOLD_AROAE       HGVMKMLEA-GGVPVQGAE-------AVVIGRSNIVGKPMAMLLTNA---------GATV
FOLD_DECAR       YGVMKMFEK-GNVDLTGKE-------AVVIGRSNIVGKPMALLLINA---------GATV
FOLD_BORBR       YGVMKMLES-EGVALRGAE-------AVIVGASNIVGKPMAMLLLQA---------GATI
FOLD1_BORPE      YGVMKMLES-EGVALRGAE-------AVIVGASNIVGKPMAMLLLQA---------GATI
FOLD1_BORPA      YGVMKMLES-EGVALRGAE-------AVIVGASNIVGKPMAMLLLQA---------GATI
FOLD_BORA1       YGVMKMLES-EGVTLRGAE-------AVVVGASNIVGKPMAMLLLAA---------GATV
FOLD2_BORPA      YGVMKLLES-EGVSLRGAE-------AVIVGASNIVGKPMAMLLLAA---------GATV
FOLD2_BORPE      YGVMKLLES-EGVSLRGAE-------AVIVGASNIVGKPMAMLLLAA---------GATV
FOLD_BURCA       YGVMKMFEA-HGIALQGAN-------AVVIGRSNIVGKPMAMMLLDA---------GATV
FOLD_BURL3       YGVMKMFEA-HDIPLQGAN-------AVVIGRSNIVGKPMAMMLLDA---------GATV
FOLD_BURP1       YGVMKMFEA-YKIPLQGAN-------AVVIGRSNIVGKPMALLLLEA---------GATV
FOLD_BURPS       YGVMKMFEA-YKIPLQGAN-------AVVIGRSNIVGKPMALLLLEA---------GATV
FOLD_BURMA       YGVMKMFEA-YKIPLQGAN-------AVVIGRSNIVGKPMALLLLEA---------GATV
FOLD_BURTA       YGVMKMFEA-YKIPLQGAN-------AVVIGRSNIVGKPMALLLLEA---------GATV
FOLD_PARXL       YGVMKMLAA-YEIPLQGAN-------AVVIGRSNIVGKPMALLLLEA---------GATV
FOLD_CUPPJ       YGCMKMLES-ISYPLRGAR-------AVVVGASNIVGKPMAMLLLQA---------GATV
FOLD_CUPMC       YGCMKMLES-IQYPLRGAR-------AVVVGASNIVGKPMAMMLLQA---------GATV
FOLD_RALSO       YGCMKMLES-IDYPVRGAR-------AVVVGASNIVGKPMAMLLLQA---------GATV
FOLD_POLSJ       YGCMKMLES-IGYDLRGKH-------AVVIGRSNIVGKPMAMMLLQK---------NATV
FOLD_RHOFT       YGCMKLIET-TGIDLRGKH-------AVVIGRSNTVGKPMALLLLQA---------NATV
FOLD_NITEU       FGVMKMLAE-YDIPLQGQH-------AVIIGRSNIVGKPMALMLLEK---------GATV
FOLD_NITMU       NGVMKMLEK-YDIPIEGQH-------AVIVGRSNIVGKPMALMLLQK---------GATV
FOLD_PSYA2       QGIMHLLEH-HNIELAGLE-------AVVVGRSAILGKPMAMMLLNA---------NCTV
FOLD_PSYCK       QGIMHLLEQ-HNIELAGLE-------AVVVGRSAILGKPMAMMLLNA---------NCTV
FOLD2_ACIAD      AGIMTILKE-NNIEIAGKH-------AVVVGRSAILGKPMAAMLLEA---------NATV
FOLD_ALCBS       KGIMRLLEH-YQVELEGKH-------AVVVGRSAILGKPMAMMMLEA---------NATV
FOLD_SACD2       KGIMRLLEA-YNIELNGKH-------AVVVGRSPILGKPMAAMLLNA---------NATV
FOLD1_COLP3      KGIIRILEA-YDIQLEGKH-------AVVVGRSPILGKPMAMMLLNK---------NCTV
FOLD_BACSK       AAILAILDH-YQLPIEGKH-------AVVVGRSPILGKPVSQMLLNR---------NATV
FOLD_LEPIC       YGMVLLLKE-YGIDVAGKN-------AVVVGRSPILGKPMAMLLTEM---------NATV
FOLD_LEPIN       YGMVLLLKE-YGIDVAGKN-------AVVVGRSPILGKPMAMLLTEM---------NATV
FOLD1_STRAW      GGIMRLLEA-YDVDLAGKH-------AVVVGRSAILGKPVGMLLLAK---------DATV
FOLD2_FRACC      SGIIELLDS-YDVELSGTP-------TVVVGRSELVGRPVAALLVGR---------NATL
FOLD_SYMTH       AGVMRLLDA-YGVDPKGKH-------AVVVGRSNIVGKPMAALLLQR---------HATV
FOLD_DEHM1       HGVQELLIR-SGIKIEGTH-------VVIVGRSNLVGKPLANILLQKAPG-----ANATV
FOLD_DEHMC       HGVQELLIR-SGIKIEGTH-------VVIVGRSNLVGKPLANILLQKAPG-----ANATV
FOLD_DESPS       AGIQEMLVR-SGVETAGAE-------VVVVGRSNIVGKPIAMMMAQKGIG-----ANATV
FOLD_LAWIP       AGIQELLIR-SSVETLGAE-------VVVIGRSNIVGRPISIMLTQKGVG-----GDATV
FOLD_SYNAS       AGIQQLLIR-SGIQTDGAE-------VVVVGRSNIVGKPIANMLLQKQKG-----ANATV
FOLD_TREDE       HGVIHLLKR-TGVETKGAK-------VVIVGRSNIVGKPLSVLMMNKDV-------NATV
FOLD1_MYXXD      AGIMEMLRR-EDIPTRGKH-------VVIVGRSLIVSKPLASLLMAPGP-------DATV
FOLD_TREPA       AGIVHLLRR-AQVPLAGAR-------VVIVGRSAIVGRPLAVLLASPGC-------DATV
FOLD1_HALMA      HGIQKLIES-AGVDTEGKD-------AVVVGRSDIVGKPMANLLIQKAPG-----GNATT
FOLD_NATPD       HGVQKLLEA-ADIDTEGKD-------VTIVGRSDIVGKPLANLLIQKADD-----GNATV
FOLD2_HALMA      HGIQKMLAE-TGVVTEGKD-------VVVVGRSDIVGKPMANLLIQYGPG-----GNATT
FOLD_HALSA       HGVQKLLAH-QGVDPDGAE-------VVVVGRSNIVGKPLANLLAQKAAG-----GNATV
FOLD_HALWD       HGIQKLLIA-ADIETEGAN-------AVVIGRSNIVGKPMANLLIQKADA-----GNATV
FOLD_SALRD       YGIMEMLSR-SDIDPESMD-------AVIVGRSNIVGKPLANLLLRRTA-------NATV
FOLD_RHOBA       HGIVQLLHR-TGIETSGKH-------VVVVGRSDIVGKPMAMMLAQKDSTCGPAVANATV
FOLD_NOSS1       AGVMRLLAE-YEISLRGKQ-------AVVVGRSILVGKPMALMLLE---------ADATV
FOLD_TRIV2       AGVMRLLAE-YEISLRGKQ-------AVVVGRSILVGKPMALMLLE---------ADATV
FOLD_TRIEI       AGVMRLLQE-YKIELQGKH-------AVILGRSILVGKPMALMLLE---------ANSTV
FOLD_SYNY3       AGVMALLAE-YNLDLTGKN-------AVVLGRSILVGKPLALMLLE---------KNCTV
FOLD_GLOVI       AGVMRILSE-AGVPLAGKT-------AVVIGRSILVGKPVALMLLE---------KDATV
FOLD_SYNJA       LGVMRLLQA-EGIPIAGRK-------AVVVGRSLLVGKPLSLMLLA---------ADATV
FOLD_SYNJB       LGVMRLLQA-EGIPIAGRK-------AVVVGRSILVGKPLSLMLLA---------ADATV
FOLD_THEEB       AGVMQLLAA-YGIDVVGRS-------AVVVGRSILVGKPLALMLLS---------ANATV
FOLD_SYNP6       AGVMELLAA-NQIDPAGKK-------AVVIGRSILVGKPLAMMLLE---------ANATV
FOLD_SYNE7       AGVMELLAA-NQIDPAGKK-------AVVIGRSILVGKPLAMMLLE---------ANATV
FOLD_PROM9       AGIINLLRS-QNITIEGKK-------IVVIGRSLLVGKPLSLMLLN---------LNGTV
FOLD_PROMP       AGIVNLLKS-QNIKIEGKK-------IVVIGRSLLVGKPLSLMMLN---------LNATV
FOLD_SYNS9       AGVMAMLRS-QGIDPAGQR-------AVVIGRSILVGQPMALMLQA---------ANATV
FOLD_SYNSC       AGVMAMLRS-NGIDPAGKR-------AVVIGRSILVGQPMALMLQA---------ANATV
FOLD_SYNPX       AGVMALLRS-NGIDPAGQR-------AVVIGRSILVGQPMALMLQA---------ANATV
FOLD_SYNS3       AGVMVMLRD-QGIDPAGKR-------AVVVGRSILVGQPMALMLQA---------ANATV
FOLD_PROMM       AGVMALLAR-HQISLERKR-------AVVIGRSILVGQPMALMLQA---------ANATV
FOLD_PROMA       AGIMVLLRR-NNISLVGKK-------VVVIGRSILVGKPMALMLQA---------ANATV
FOLD_PROMT       AGVMSLLER-NQIKIEGKR-------AVVVGRSILVGKPMALMLEA---------ANATV
FOLD_DESAG       AGVMTLLER-YNLSPAGKK-------AVVLGRSNIVGKPLALMLGASGPF-----ANATV
FOLD_DESVH       AGVMTLLER-YDLSPSGRK-------AVVVGRSNIVGKPLALMLGAPGKY-----ANATV
FOLD_THET2       LGVVRLLKH-YGVDLRGKE-------VVVVGRSNIVGKPLAGLLLRED---------ATV
FOLD_THET8       LGVVRLLKH-YGVDLRGKE-------VVVVGRSNIVGKPLAGLLLRED---------ATV
FOLD2_DEIGD      AGILYLLDH-YGIPVAGQR-------AVVVGRSSIVGRPLAGLLLHRD---------ATV
FOLD1_RUBXD      HGVIQLLRR-SGVGLEGRE-------AVVVGRSNLVGKPLALLLLREN---------ATV
FOLD_KORVE       AGCMEILRR-SNVPVEGAD-------AVVVGRSDIVGKPIAMLLTNAN---------ATV
FOLD_COREF       NGSISLLRR-FGIELNGAK-------VVVIGRGVTVGRPIGLMLTRRS-------ENSTV
FOLD_CORGL       NGSISLLRR-FGVELDGAK-------VVVIGRGVTVGRPIGLMLTRRS-------ENSTV
FOLD_CORJK       NGAIHLLRR-FDVELNGAK-------VVVIGRGVTVGRPIGLMLTRRS-------ENSTV
FOLD_CORDI       NGAIHLLRR-FGVELDGKK-------VVVIGRGVTVGRPIGLMLTRRS-------ENSTV
FOLD_MYCBO       RGIVHLLRR-YDISIAGAH-------VVVIGRGVTVGRPLGLLLTRRS-------ENATV
FOLD_MYCTU       RGIVHLLRR-YDISIAGAH-------VVVIGRGVTVGRPLGLLLTRRS-------ENATV
FOLD_MYCPA       RGIVHLLRR-YDAEIAGAH-------VVVIGRGVTVGRPLGLLLTRRS-------ENATV
FOLD_MYCLE       RGILHLLRR-YGVEIAGTH-------VVIIGRGVTVGRPLGLLLTRRS-------ENATV
FOLD_MYCFO       RGIVHLLRR-FDVPIAGAH-------VVVIGRGVTVGRPMGLLLTRRS-------ENATV
FOLD_MYCSS       RGIVHLLRR-YEVEIAGAH-------VVVIGRGVTVGRPLGLLLTRRS-------ENATV
FOLD2_RHOJR      RGILHLLRR-YEVPIEGAH-------VVVVGRGVTVGRPIGLLFTRRS-------ENATV
FOLD2_STRAW      NGVLTLLRR-YGVEIKGAE-------VVVVGRGVTIGRPMPLLLTRRS-------ENATV
FOLD_STRCO       NGILTLLRR-YGVEIKGAE-------VVVVGRGVTIGRPMPLLLTRRS-------ENATV
FOLD_THEFY       RGIVELLNR-YGVSLRGAE-------VVVVGRGVTVGRPLGLLLTRRS-------ENATV
FOLD_CUTAK       RGIVELLTR-HGIELPGAN-------VCVVGRGTTVGRPLGLLLTRRS-------ENCTV
FOLD_LEIXX       RGVIELMLR-HGIDLAGKD-------VVVVGRGVTVGRSIGALLTRRE-------VNATV
FOLD_BIFLO       RGVLELLDA-YDIDLNGKE-------VCVLGRGITIGRTIGLMLTRNA-------VNATV
FOLD_PELCD       AGIRAMLQH-YDIAIEGKE-------VVVIGRGPTLGRPLSLLLTLKQPY-----ANAAV
FOLD_TROW8       AGIVKLLEA-HRITLEGKT-------IAVIGRGTTVGRPLGILLSGKG-------VNATV
FOLD_TROWT       AGIVKLLEA-HRITLEGKT-------IAVIGRGTTVGRPLGILLSGKG-------VNATV
FOLD_BDEBA       AGVMEILKH-YRIPVEGKK-------AVVVGRSNIVGKPMALLLTEA---------NATV
FOLD_LACAC       EGIIALLKY-YKILLKGKN-------VVVIGRSNIVGKPVAALMLEQ---------NATV
FOLD_LACDA       AGIIALLDH-YQIDLTGKN-------AVIVGRSNIVGKPLAALMLER---------NASV
FOLD2_LACJO      RSILTLIDY-YGIEMAGKN-------TVIIGRSVIVGKPLAAVLVER---------DATV
FOLD_METHJ       NGIMTLLHE-NKISIAGKR-------AVVVGRSVDVGRPIALLLLHA---------DATV
FOLD_CLOD6       TAVVEILKH-YNVDLKGSK-------VTVLGRSMVVGKPVSMLLLSE---------HATV
FOLD1_DESHY      AAVMAILRH-YEIELKGAN-------AVVMGRSLVVGKPLSMMLLQD---------NATV
FOLD_CARHZ       TAVMEILKY-YNIPLEGKR-------AVVLGRSLVVGKPAAILLLRE---------NATV
FOLD_CLOAB       RSIINLIKS-LNVDICGKN-------AVVIGRSNIVGKPTAQLLLNE---------NATV
FOLD_CLOTE       QGIIEIIKS-TKESISGKK-------AVVLGRSVIVGKPVAQLLVNE---------DATV
FOLD_CLOP1       NSVITLLKA-YNIEIEGKE-------VVIIGRSNIVGKPLFQMFLNE---------NATV
FOLD_CLOPE       NSVITLLKA-YNIEIEGKE-------VVIIGRSNIVGKPLFQMFLNE---------NATV
FOLD_CLOPS       NSVITLLKA-YNIEIEGKE-------VVIIGRSNIVGKPLFQMFLNE---------NATV
FOLD2_SYNWW      KAVISMLKA-HDILIEGQK-------VTIIGRSMTVGSPLALMMTAE---------NATV
FOLD2_DESHY      ESCIEIMLR-SGVEIAGKH-------VVIVGRGETVGKPLVFLILKH---------NATV
FOLD_CALS4       KAIIHILEN-TGVDLEGKH-------AVVIGRSNILGKPVAKLLLDK---------NCTV
FOLD_METAC       HGVIRALEE-YGVSVQGKN-------AVIVGHSNVVGKPMAAMLLNR---------NATV
FOLD_METMA       HGVIRALEE-YNVPVKGKN-------AVIVGHSNVVGKPMAAMLLNR---------NASV
FOLD_METBF       HGVIRALEE-YNVPVKGKN-------VVIVGHSNVVGKPLAAMFLNR---------NATV
FOLD_METBU       KGIIRALEE-YGVEIQGKH-------AVIVGHSNVVGKPMAAMLVNR---------NATV
FOLD1_SYNWW      LACLEVIER-FFPSLAGKK-------AVLVGDSFDLIIPLATIMIKR---------ACQL
FOLD2_RUBXD      AACFYLLDRYLERSGRPPEEFYPRSTVVVVGRSNNVGKPAVSLGFAR--------GAAVI
FOLD3_RUBXD      AACFYLLDRYLERSGRPPEEFYPRSTVVVVGRSNNVGKPAVSLGFAR--------GAAVI
FOLD_NOCFA       QAVVELLKH-HEIALSGRH-------VAVVGRSNVVGKPLAQLLLAE---------NATV
FOLD1_RHOJR      QAVIALLDH-HGISPHART-------ATVVGRSTVVGSPVAHLLVQR---------NATV
FOLD_ARTGO       RAVVEILDH-FEIPVAGRN-------VVVVGRSTVVGKPLSLLLLQK---------DATT
FOLD1_FRACC      AAVVEILTR-ARIPMSGAR-------VCVIGRGPVVGKPVSLLLLAE---------DATV
FOLD3_ROSDO      AAAVELIRE-TGLKLEGLE-------VVMVGHSEIVGKPAAMMLMAE---------GATV
FOLD2_RUEPO      AAAIELIRE-TGLSMAGLE-------VVMVGHSEIVGKPVAMMLMAE---------GATV
FOLD_RHOCB       AAAVEMVRA-TGLPLPGLE-------VVMIGHSEIVGKPVAFLLMAE---------GATV
FOLD2_RHILO      AASVELLKE-TGLDLKGLE-------VVVVGHSEIVGKPIAFLLMSE---------GATV
FOLD_PYRAE       AGILELFKL-YGIDVRGKD-------VVVVGKGELVGKPLAVMLMQL---------DATV
FOLD_THEAC       RAVIDIMDYYGYHENT----------VTIVNRSPVVGRPLSMMLLN---------RNYTV
FOLD_THEVO       MAVVDILKYYGYEKTT----------ATIINRSPVVGRPLSMMMLN---------RDYTV
FOLD_PICTO       RAVVDILDYINIKSGN----------VAIINRSPVVGRPLSMMLLN---------RDFTV
FOLD_THEMA       EAAVRILERETNLSGKR---------VTVVGRSVTVGKPLALMLLKKG-------RDATV
FOLD1_DEIGD      RSVRFLLREVLGDDLRGRR-------VAVIGPGRTVGRPLTFMLNN---------RGVTV
FOLD_DEIRA       RSVRFLLRHALGDDLRGLR-------VAVIGPGRTVGRPLLFMLNN---------KGATV
FOLD_MYCPE       NGIIEILKQSNY-SIEGKH-------AVIINRSMIVGKPLIGLFLE---------NNATV
FOLD_BORBU       LAVLKILRD-EGIKTLGKT-------VVVVGRSPLVGRPISILLSSKP-------YDATV
FOLD_BORBP       LAVLKILLD-EGIRTSGKT-------VVVVGRSPLVGKPISILLSSKP-------YDATV
FOLD_BORAP       LAVLKILRD-EGIKTSGKT-------VVVVGRSPLVGRPISILLSSKP-------HDATV
FOLD_MYCMO       RGIIDLIKE-YNFTIKDKK-------VYVIGESNLVGKPIKELFKQA---------GAIV
FOLD_MYCPU       RAIWTFLKF-HKISVENKK-------VFVVGQSRLVGKPISQFLKNN---------NAIV
FOLD_MYCS5       RAVLELIEH-HEINYKKKK-------VAVVGRSHLVGKPVAHILKRR---------GASV
FOLD_MYCGE       EAIITLKEL-FNLEFNNQK-------IVVVGLGITGGKPIYEFLKTS---------GYKV
FOLD_MYCPN       EAVLILKEH-FHHDFTNKQ-------IVVVGLGVTGGGPIFHYLKET---------GHQV
FOLD_MYCGA       NAVLELFKE-YQLSFLDKK-------ILLIGNGITSNQPIVNYLNEH---------QIKF
                  .                          ::. .     .                     

FOLD_BACSU       TYCHSRTEN--ITEHTKKADILVVAVGRAN--------FISADQIKEGAVVIDVGVNRLE
FOLD_BACLD       TYCHSRTAD--ITAHTKKADILIVAVGKAN--------FIKADQIKEGAVVIDVGVNRLD
FOLD_BACCZ       TYCHSKTQN--MKELTKLADILIVAVGRPK--------MVTADYIKEGAVVIDVGVNRLE
FOLD_BACHK       TYCHSKTQN--MKELTKLADILIVAVGRPK--------MVTADYIKEGAVVIDVGVNRLE
FOLD_BACAN       TYCHSKTQN--MKELTKLADILIVAVGRPK--------MVTADYIKEGAVVIDVGVNRLE
FOLD_BACC1       TYCHSKTQN--MKELTKLADILIVAVGRPK--------MVTADYLKEGAVVIDVGVNRLE
FOLD_BACCR       TYCHSKTQN--MKELSKLADILIVAVGRPK--------MITADYIKEGAVVIDVGVNRLE
FOLD_GEOKA       TYTHSKTPD--LAAITRQADILIVAVGKAR--------LIGPEHIKPGAVVIDVGVNRLE
FOLD_BACHD       TYCHSRTKN--LTEITKQADILIVAVGRAR--------FIDASHVKEGAVVIDVGINRVD
FOLD_OCEIH       TYTHSRTKN--LQEITKQADILIVAIGRAH--------AINADYIKEDAVVIDVGINRKD
FOLD_LISMF       TIAHSRTKD--LPQVAKEADILVVATGLAK--------FVKKDYIKPGAVVIDVGMDRDE
FOLD_LISMO       TIAHSRTKD--LPQVAKEADILVVATGLAK--------FVKKDYIKPGAIVIDVGMDRDE
FOLD_LISIN       TIAHSRTKD--LPQVAKEADILVVATGLAK--------FVKKEYIKPGAIVIDVGMDRDE
FOLD_STAA3       TILHSRSKD--MASYLKDADVIVSAVGKPG--------LVTKDVVKEGAVIIDVGNTPDE
FOLD_STAAC       TILHSRSKD--MASYLKDADVIVSAVGKPG--------LVTKDVVKEGAVIIDVGNTPDE
FOLD_STAAS       TILHSRSKD--MASYLKDADVIVSAVGKPG--------LVTKDVVKEGAVIIDVGNTPDE
FOLD_STAAW       TILHSRSKD--MASYLKDADVIVSAVGKPG--------LVTKDVVKEGAVIIDVGNTPDE
FOLD_STAA8       TILHSRSKD--MASYLKDADVIVSAVGKPG--------LVTKDVVKEGAVIIDVGNTPDE
FOLD_STAAM       TILHSRSKD--MASYLKDADVIVSAVGKPS--------LVTKDVVKEGAVIIDVGNTPDE
FOLD_STAAN       TILHSRSKD--MASYLKDADVIVSAVGKPS--------LVTKDVVKEGAVIIDVGNTPDE
FOLD_STAAB       TILHSRSKD--MASYLKDADVIVSAVGKPG--------LVTKDVVKEGAVIIDVGNTPDE
FOLD_STAAR       TILHSRSKD--MASYLKDADVIVSAVGKPG--------LVTKDVVKEGAVIIDVGNTPDE
FOLD_STAHJ       TILHSRTKD--MHSHLKDADVIVSAVGQPG--------LVTKDDVKEGAVIVDVGNTPDE
FOLD_STAEQ       TILHSRTKN--MNAHLKQADVIVSAVGQPG--------LVTKENVKKGAVIIDVGNTPDE
FOLD_STAES       TILHSRTKN--MNAHLKQADVIVSAVGQPG--------LVTKENVKKGAVIIDVGNTPDE
FOLD_STAS1       TILHSRTKD--MKRYLKNADIIVSAVGRPG--------LVTKEDVKEGAVVIDVGNTPDE
FOLD_STRTR       TLTHSRTPH--LAKVCNKADVLIVAIGRAK--------FVTEEFVKEGAVVIDVGINRDE
FOLD_STRT1       TLTHSRTPH--LAKVCNKADVLIVAIGRAK--------FVTEEFVKEGAVVIDVGINRDE
FOLD_STRT2       TLTHSRTPH--LAKVCNKADVLIVAIGRAK--------FVTEEFVKEGAVVIDVGINRDE
FOLD_STRA1       TLTHSRTRN--LSEVTKEADILIVAIGQGH--------FVTKDFVKEGAVVIDVGMNRDE
FOLD_STRA3       TLTHSRTRN--LSEVTKEADILIVAIGQGH--------FVTKDFVKEGAVVIDVGMNRDE
FOLD_STRA5       TLTHSRTRN--LSEVTKEADILIVAIGQGH--------FVTKDFVKEGAVVIDVGMNRDE
FOLD_STRMU       TLTHSRTKH--LSEVTRCADVLIVAIGQGN--------FVTEEFVKEGAVVIDVGMNRDK
FOLD_STRP8       TLTHSRTRQ--LEEVCRCADVLIVAIGQGH--------FITKQYIKDGAIVIDVGMNRDD
FOLD_STRPM       TLTHSRTRQ--LEEVCRCADVLIVAIGQGH--------FITKQYIKDGAIVIDVGMNRDD
FOLD_STRP1       TLTHSRTRQ--LEEVCRCADVLIVAIGQGH--------FITKQYIKDGAIVIDVGMNRDD
FOLD_STRP3       TLTHSRTRQ--LEEVCRCADVLIVAIGQGH--------FITKQYIKEGAIVIDVGMNRDD
FOLD_STRP6       TLTHSRTRQ--LEEVCRCADVLIVAIGQGH--------FITKQYIKEGAIVIDVGMNRDD
FOLD_STRPB       TLTHSRTRQ--LEEVCRCADVLIVAIGQGH--------FITKQYIKEGAIVIDVGMNRDD
FOLD_STRPC       TLTHSRTRQ--LEEVCRCADVLIVAIGQGH--------FITKQYIKEGAIVIDVGMNRDD
FOLD_STRPD       TLTHSRTRQ--LEEVCRCADVLIVAIGQGH--------FITKQYIKEGAIVIDVGMNRDD
FOLD_STRPF       TLTHSRTRQ--LEEVCRCADVLIVAIGQGH--------FITKQYIKEGAIVIDVGMNRDD
FOLD_STRPN       TLTHSRTHN--LSKVAAKADILVVAIGRAK--------FVTADFVKPGAVVIDVGMNRDE
FOLD_STRR6       TLTHSRTHN--LAKVAAKADILVVAIGRAK--------FVTADFVKPGAVVIDVGMNRDE
FOLD_ENTFA       TIAHSKTEH--LAEVAKEADILVVAIGRGH--------FVTKEFVKPGAVVIDVGMNRNQ
FOLD_LACLA       TIAHSKTEN--LRELTKEADVLVVAIGRDR--------MIKAEDVKEGAVVIDVGMNRDE
FOLD_LACS1       TIAHSKTKN--LAEVTKQADILIVAIGKGE--------FIDENYVKKGAVVIDVGMNRNN
FOLD1_LACJO      TMVSLHTDN--IDYYTKHADILVVAAGKPN--------LIKKDQVKPGATVIDVGINRMA
FOLD_LACPL       TIAHSKTAD--LKAVARTADILVVATGIAH--------LITGADIKPGATVIDVGMDRDE
FOLD_LACSS       TIAHSRTAN--LKALTKTADILVAAIGKPH--------FFGIDAVKEGAVVIDVGINRLE
FOLD_RICCN       TICHSKTHN--LRSITSKADIVVAAIGSPL--------KLTAEYFNPKSIVIDVGINRIS
FOLD_RICFE       TICHSKSQN--LSSITSKADIVVAAIGSPL--------KFTTEYFDPESIVIDVGINRIS
FOLD_RICPR       TICHSKTCN--LSSITSKADIVVVAIGSPL--------KLTAEYFNPEAIVIDVGINRIS
FOLD_RICTY       TICHSKTCN--LSSITSKADIVVVAIGSPL--------KLTAEYFNPESIVIDVGINRIS
FOLD_RICBR       TICHSKSQN--LSSITSKADIVVAAIGSPL--------KLTSGYFKPDAIVIDVGINRIG
FOLD_PELUB       TITHSKTKD--LKAECLEADIIVAAVGIPE--------LVKADWVKKDAIVIDVGINKTE
FOLD_ANAMM       TVLHSASRN--LEEHCLRADIIVAAVGKAR--------FIRASWIKPGAIVVDVGINLVE
FOLD_ANAPZ       SILHSATAN--IEEHCRDAEIIIAAVGKAR--------MVKSEWVSPGAVVIDVGINLIT
FOLD_EHRCJ       TTVHSATRN--LSDYCSKADILVAAVGIPN--------FVKSSWIKPGAIVIDVGINSVE
FOLD_EHRCR       TTVHSATRN--LPDYCSKADVLVAAVGIPH--------FVKSSWIKPGAIVIDVGINAIE
FOLD_EHRRG       TTVHSATRD--LPDYCRRADILVAAVGIPR--------FVKYSWVKHGAIVIDVGINSIE
FOLD_EHRRW       TTVHSATRD--LPDYCRRADILVAAVGIPR--------FVKYSWVKHGAIVIDVGINSIE
FOLD_WOLPM       TILHSQSKD--LAEYCSKADIVVAAVGKPN--------FVQADWIKKGAIVIDVGINSVN
FOLD_WOLTR       TILHSQSKD--LAEYCSKADVVVTAVGKPN--------FVQEGWIKEGAIVIDVGINSVS
FOLD_NEOSM       TLTHSKTRN--IQEKTRQADIVISAVGIPH--------FVKKDFIKPGATVIDVGMNKVD
FOLD2_PSE14      TVVHSRSTD--AKALCQLADIVVAAVGRPR--------MIDASWLKPGAVVIDVGINRIE
FOLD2_PSESM      TVVHSRSTD--AKALCQLADIVVAAVGRPR--------MIDAGWLKPGAVVIDVGINRID
FOLD2_PSEU2      TVVHSRSTD--ARALCQLADIVVAAVGRPR--------LIDASWLKRGAVVIDVGINRIE
FOLD1_ACIAD      TVVHSKTRN--IEQVCQQADIVVAAVGKAN--------MINASYLKADAVVIDVGINRIM
FOLD_GLUOX       TVAHIHTRN--TKELAREADILVVATGKSE--------LVRGDWIKPGATVIDVGITRVP
FOLD1_PSEPK      SIAHIRTTD--LARRCREADILVVATGVPG--------LIRGDYIKPGATVIDVGISRVR
FOLD_SPHCR       TVCGRHTRN--LAEVCRNADIIVAAAGTPH--------LVKGYWVKAGAVVIDVGINRIA
FOLD_METC4       TILHKESRD--VPGHCRSADILVVAAGSPG--------LVRRDWVKPGAVVIDVGINRIP
FOLD1_RHIEC      TIAHSRTKN--LAEVCRNADILVAAVGRPE--------MVKADWVKPGATVIDVGINRVP
FOLD2_RHIEC      TIAHSRTKN--LAEVCRNADILVAAVGRPE--------MVKADWVKPGATVIDVGINRVP
FOLD_RHIL3       TIAHSRTKN--LAEVCRNADILVAAVGRPE--------MVRADWVKPGATVIDVGINRVA
FOLD_RHILT       TIAHSRTKN--LAEVCRNADILVAAVGRPE--------MVRADWVKPGATVIDVGINRVA
FOLD2_RHIME      TTAHSRTKD--LAAVCRNADILVAAVGRPE--------MVKADWVKPGAMVVDVGINRVP
FOLD1_RHIME      TIAHSRTSD--LASICRNADIVIAAVGRPE--------MVKANWLKTGATVIDVGINRVP
FOLD_AGRFC       TMAHSRTKD--LVTVCKTADILVAAVGRAA--------MVKGDWVKPGATVIDVGINRIA
FOLD_BARHE       TIAHSRTRD--LDDVCRSADILVTAIGRPQ--------MIKKDWVKNGAIIIDVGINRIA
FOLD_BARQU       TIAHSRTRD--LDDVCRSADILVAAVGRPQ--------IIKKDWVKNGAIVIDVGINRIA
FOLD_BRUA2       TVAHSRTKD--LPAIARNADILVAAVGRPQ--------MVKGDWVKPGATVIDVGINRIP
FOLD_BRUAB       TVAHSRTKD--LPAIARNADILVAAVGRPQ--------MVKGDWVKPGATVIDVGINRIP
FOLD_BRUME       TVAHSRTKD--LPAIARNADILVAAVGRPQ--------MVKGDWVKPGATVIDVGINRIP
FOLD_BRUSU       TVAHSRTKD--LPAIARNADILVAAVGRPQ--------MVKGDWVKPGATVIDVGINRIP
FOLD1_RHILO      TIAHSRTKD--LPALARTADILVAAVGRPE--------MIKGDWVKPGATVIDVGINRIP
FOLD_CHESB       TIAHSRTAD--LPAACRGADILVAAVGRPE--------MVKGDWIKPGATVIDVGVSRIP
FOLD_SINFN       TIAHSRTAN--LEVLCRQADILIAAVGRPE--------MIRSDWIKPGATVIDVGINRIA
FOLD_NITHX       TIAHSRSRN--LPELCRRADLVYAAVGKAE--------MVRGDWLKPGATVIDVGITRRP
FOLD_NITWN       TIAHSRSRN--LPELCRRADLVYAAVGRAE--------MVRGDWLKPGATVIDVGITRVP
FOLD_BRADU       TIAHSRSRD--LPGLVKRADLVYAAVGKPE--------MVRGDWLKPGATVIDIGISRIP
FOLD_RHOP2       TIAHSRSRD--LPALCRQADLVFAAVGRPE--------MVKGDWIKPGATVIDVGINRTP
FOLD_RHOPS       TIAHSRSRD--LPALCRQADLVFAAVGKAE--------MVKGDWIKPGATVIDVGINRTP
FOLD_RHOPB       TIAHSRSRD--LPALCRQADLVFAAVGKPE--------MVRGNWIKPGATVIDVGINRTP
FOLD_RHOPA       TIAHSRTRD--LPALCRQADLVFAAVGKAE--------MVKGDWIKPGATVIDVGINRTP
FOLD2_ROSDO      TIAHSRTKD--LPDVVRGADIVVAAVGRPE--------MVPGDWIKPGATVIDVGINRID
FOLD_RUEST       TIAHSRTKD--LPEVVRRADIVVAAVGRPE--------MVPGDWIKEGATVIDVGINRID
FOLD1_ROSDO      TIAHSRTKD--LADVVRRADIVVAAVGRPE--------MVPGDWIKPGATVIDVGINRLD
FOLD1_RUEPO      TIAHSRTKD--LADVVRRADIVVAAVGRPE--------MVPGDWIKPGATVIDVGINRIE
FOLD_RHOS4       TIAHSRTRD--LAAVCRGADILVAAVGRPE--------MITGDFVKPGATVIDVGINRIE
FOLD_JANSC       TIAHSRTKD--LADVCRRADILVAAVGRAE--------MVRGDWIKPGATVIDVGISRVP
FOLD_MAGSA       TVAHSQTKD--LPGVVRRADIVIAAVGRPE--------MIKGDWIKPGATVIDVGINRIE
FOLD_NOVAD       TVAHSRTKN--LPEVVRRADIVVAAVGRPE--------MVKGDWIKPGATVIDVGINRVP
FOLD_SPHAL       TMAHSRTKD--LPALVRRADIVVAAVGRAE--------MVKGDWIKPGAIVIDVGINRLP
FOLD_CAUVC       TIAHSRSQD--LPSIVRQADIVVAAVGRAE--------MVKADWVKPGAVVIDVGITRFP
FOLD_ZYMMO       TVAHRHTKN--LEELCRQADIVVAAVGIPH--------FVKASWLKPGAVVIDVGINRVP
FOLD_RHORT       TLAHSRSRD--LPDLCRRMDIVVAAVGRPE--------MVKGDWLKPGAVVIDVGMNRLP
FOLD_HYPNA       TIAHSKTAD--LANVCRSADILVPAVGRPE--------MVRGDWVKPGAAVIDVGINRIP
FOLD_MARMM       TIAHSRTAD--LPSLCRTADILVPAVGRPE--------MVRGDWVKPGACVLDVGINRID
FOLD_CHLTR       TLLHSQSEH--LTEITRTADILISAIGVPL--------FVNKEMIAEKTVIMDVGTSRIP
FOLD_CHLTA       TLLHSQSEH--LTEITRTADILISAIGVPL--------FVNKEMIAEKTVIMDVGTSRIP
FOLD_CHLMU       TVLHSQSEH--LKEITKTADILVSAIGVPL--------FVTKEMISEKCIVIDVGTSRVP
FOLD_CHLAB       TLLHSQSQN--LKEILKTADIIIAAVGVPL--------FIKESMVSSHAVIIDVGTSRVA
FOLD_CHLCV       TLLHSQSEN--LTEILKTADIIIAAVGVPL--------FIKETMISSHAIVVDVGTSRVA
FOLD_CHLFF       TLLHSQSQN--FTEILKTADIIVAAVGVPL--------FIQENMISPNAVIVDVGISRVA
FOLD_CHLPN       TVLHSQSEN--LPEILKTADIIIAALGAPL--------FIKETMVAPHAVIVDVGTTRVP
FOLD_PARUW       TVAHRYTKN--LKELCLQADLIIVAIGQPK--------LITADMVKEGVIIVDVGINKIH
FOLD_BACFN       TVCHSRSKD--LVKECREADIIIAALGQPN--------FVKAEMVKEGAVVIDVGTTRVP
FOLD_BACFR       TVCHSRSKD--LVKECREADIIIAALGQPN--------FVKAEMVKEGAVVIDVGTTRVP
FOLD_BACTN       TVCHSRSKD--LVKECQEADIIIAALGQPN--------FVKEEMVKEGAVVIDVGTTRVP
FOLD_PORGI       TICHSRTPN--IKEVCLTADIIIAALGQPE--------FLTADMVKPGAVVVDVGTTLVP
FOLD_CYTH3       TMVHSRTKN--LKELTLQADILIVAIGKPE--------FVTADMVKEGAVVVDVGIHRID
FOLD1_GEOMG      TLTHIETPRELLLDETRRADIVIVAVGIPG--------FVTEDMVKEGVVVIDVGINRLE
FOLD1_GEOSL      TLTHIETPRELLLDETRRADIVIVAVGIPG--------FVTADMVKDGVVLIDVGINRLE
FOLD_CHLCH       TICHSATPN--ITEFTKQADILIAAIGKAN--------FITADMVKAGAVVIDVGINRVD
FOLD_PELLD       TVCHSATKD--IASYTRQADILIAAIGRAK--------FVTADMVKQGAVVIDVGINRIE
FOLD_HELPY       SVCHILTKD--ISFYTQNADIVCVGVGKPD--------LIKASMLKKGAVVVDIGI----
FOLD_HELPH       SVCHILTKD--ISFYTQNADIVCVGVGKPD--------LIKASMLKKGAVVVDIGI----
FOLD_HELPJ       SVCHILTKD--ISFYTKNADIVCVGVGKPD--------LIKASMLKKGAVVVDIGI----
FOLD_HELHP       SCCHILTRD--VKQYTKNADIVCVAVGKVG--------LLSADMIKEGAVVVDVGI----
FOLD_SULDN       EICHIFTDD--LKKHTLAADMIFVGAGVIN--------LIKEDMVKGGAIIVDIGI----
FOLD_WOLSU       TLCHIYTKD--LASHTQNADILCVGVGKPN--------LITESMVKKGAVVIDIGI----
FOLD_CAMJE       SVCHIKTKD--LSLYTRQADLIIVAAGCVN--------LLRSDMVKEGVIVVDVGI----
FOLD_CAMJR       SVCHIKTKD--LSLYTRQADLIIVAAGCVN--------LLRSDMVKEGVIVIDVGI----
FOLD_AQUAE       SVCHIHTKD--VKKFTKEADILISATGVPH--------LIKEDMIKEGAVVVDVGI----
FOLD_FUSNN       TICNIYTKN--LAEKTKNADILISAVGKAK--------LITEDMVKEGAVVIDVGI----
FOLD_FRAT1       TTCHRFTTD--LKSHTTKADILIVAVGKPN--------FITADMVKEGAVVIDVGI----
FOLD_FRATT       TTCHRFTTD--LKSHTTKADILIVAVGKPN--------FITADMVKEGAVVIDVGI----
FOLD_FRATH       TTCHRFTTD--LKSHTTKADILIVAVGKPN--------FITADMVKEGAVVIDVGI----
FOLD_FRATO       TTCHRFTTD--LKSHTTKADILIVAVGKPN--------FITADMVKEGAVVIDVGI----
FOLD_MYCCT       SMCNKNTKS--LKKYTKISDIVISATGKQF--------IITKDMIKKNAIVIDVGII---
FOLD_MYCMS       SMCNKNTKS--LKKYTKRSDIVISTTGKQA--------LIKKDMIKKNAIVIDVGII---
FOLD_MESFL       TMCNKNTKN--IKNHTINADIIISATGKQF--------IITEDMIKKDAVIIDVGII---
FOLD_SPICI       TVCHSQTKN--LSDFTNQADILISAVGKAK--------FVTAEMIKENVIVIDVGIN---
FOLD_BUCAI       TVTHRFTKN--LKDHVQNADLLIVAVGKAN--------FLKGSWIKTGSIVIDVGINRLK
FOLD_BUCAP       TVTHRFTKN--LRHHIKNADLLVVAIGKPN--------FLHGDWIKEGAIVIDVGINKLK
FOLD_BUCBP       TITHRFTKN--LKHYVKQADLIVIAIGHAH--------FLKGTWIKKGAIVIDVGINRLK
FOLD_BLOFL       SITHRFTQN--LQVYVKNADLLIVAVGKAN--------FLPSSWIKPGAIVIDVGINRLK
FOLD_BLOPB       SVTHRFTQN--LKIYIENADLLIVAVGQAN--------FIPGSWIKQGAIVIDVGINRLN
FOLD_WIGBR       TITHRFTIN--LKKYIENAELLIVAIGKAE--------FIPGSWIKPGAIVIDVGINRLK
FOLD_ECOLI       TVTHRFTKN--LRHHVENADLLIVAVGKPG--------FIPGDWIKEGAIVIDVGINRLE
FOLD_SHIDS       TVTHRFTKN--LRHHVENADLLIVAVGKPG--------FIPGDWIKEGAIVIDVGINRLE
FOLD_SHIFL       TVTHRFTKN--LRHHVENADLLIVAVGKPG--------FIPGDWIKEGAIVIDVGINRLE
FOLD_SHISS       TVTHRFTKN--LRHHVENADLLIVAVGKPG--------FIPGDWIKEGAIVIDVGINRLE
FOLD_SHIBS       TVTHRFTKN--LRHHVENADLLIVAVGKPG--------FIPGDWIKEGAIVIDVGINRLE
FOLD_ECO57       TVTHRFTKN--LRHHVENADLLIVAVGKPG--------FIPGDWIKEGAIVIDVGINRLE
FOLD_ECOL5       TVTHRFTKN--LRHHVENADLLIVAVGKPG--------FIPGDWIKEGAIVIDVGINRLE
FOLD_ECOL6       TVTHRFTKN--LRHHVENADLLIVAVGKPG--------FIPGDWIKEGAIVIDVGINRLE
FOLD_ECOUT       TVTHRFTKN--LRHHVENADLLIVAVGKPG--------FIPGDWIKEGAIVIDVGINRLE
FOLD_SALTY       TVTHRFTKD--LRHHVEHADLLIVAVGKPG--------FIPGEWIKEGAIVIDVGINRLE
FOLD_SALCH       TVTHRFTKD--LRHHVEHADLLIVAVGKPG--------FIPGEWIKEGAIVIDVGINRLE
FOLD_SALPA       TVTHRFTKD--LRHHVEHADLLIVAVGKPG--------FIPGEWIKEGAIVIDVGINRLE
FOLD_SALTI       TVTHRFTKD--LRHHVEHADLLIVAVGKPG--------FIPGEWIKEGAIVIDVGINRLE
FOLD_PHOLL       TVTHRFTKD--LRHHVEQADLLIVAVGKPN--------FIPGEWIKPGAIVIDVGINRLE
FOLD_YERPA       TVTHRFTKN--LRHHIENADLLVVAVGKPG--------FIPGEWIKPGAIVIDVGINRLE
FOLD_YERPE       TVTHRFTKN--LRHHIENADLLVVAVGKPG--------FIPGEWIKPGAIVIDVGINRLE
FOLD_YERPN       TVTHRFTKN--LRHHIENADLLVVAVGKPG--------FIPGEWIKPGAIVIDVGINRLE
FOLD_YERPS       TVTHRFTKN--LRHHIENADLLVVAVGKPG--------FIPGEWIKPGAIVIDVGINRLE
FOLD_PECAS       TVTHRFTKN--LRHHIENADLLVVAVGKPG--------FIPGEWIKPGAIVLDVGINRLE
FOLD_SODGM       TVTHRFTRD--LRRHIENADLLVVAVGKAS--------FIPGEWIKPGAVVMDVGINRLE
FOLD_BAUCH       TITHRFTRN--LQQHVQNADLLVVAVGKAG--------FIPGSWIKSGAIVIDIGINCLD
FOLD_PHOPO       TTCHRFTQD--LEGHIRQADILVVAVGKPN--------FIPGGWIKEGATVIDVGINRLE
FOLD_PHOPR       TTCHRFTQD--LEHHIRQADILVVAVGKPH--------FIPGDWIKEGATVIDVGINRLD
FOLD_VIBVU       TTCHRFTKD--LEGHVRQADVLVVAVGKPN--------FIPGEWVKEGAIVVDVGINRLE
FOLD_VIBVY       TTCHRFTKD--LEGHVRQADVLVVAVGKPN--------FIPGEWVKEGAIVVDVGINRLE
FOLD_VIBPA       TTCHRFTKD--LESHVRQADVVVVAVGKPN--------FIPGEWIKKGAVVVDVGINRLD
FOLD_VIBCH       TTCHRFTQD--LEGHIRQADILVVAVGKPN--------FIPGAWIKEGAVVVDVGINRLD
FOLD_ALIF1       TTCHRFTKD--LESHIRQADLVVVAVGKPN--------FIPGEWIKEGAVVVDVGINRLD
FOLD_PSEHT       TVCHKFTQD--LETHVRRADLLVVAVGKPE--------FIPGDWVKEGAIVIDVGINRLD
FOLD_IDILO       TVCHRFTKD--LSDHVKRADIVVVAVGKAE--------FIPGEWIKPGAIVIDVGMNRLP
FOLD_PSEA6       TSCHKFTKD--LQSHVERADLIVVAVGISA--------FIPGEWIKPGAIVIDVGINRQT
FOLD_SHEDO       TTCHRFTKN--LEQKVRQADLLVVAVGKPG--------FILGEWIKPGAIVIDVGINRLE
FOLD_SHEFN       TTCHRFTKN--LEQKVRQADLLVVAVGKPG--------FIPGDWIKPGAIVIDVGINRLE
FOLD_SHESM       TTCHRFTKN--LEQKIRQADLVVVAVGKPG--------FIPGEWIKPGAIVIDVGINRLE
FOLD_SHESR       TTCHRFTKN--LEQKIRQADLVVVAVGKPG--------FIPGEWIKPGAIVIDVGINRLE
FOLD_SHEON       TTCHRFTKN--LEQKIRQADLVVVAVGKPG--------FIPGEWIKPGAIVIDVGINRLE
FOLD2_COLP3      TTTHRFTKD--LEGKVRNADLLVVAVGKPG--------FIPGEWIKEGAIVIDVGINRLD
FOLD_HAEIN       TVTHRFTKN--LENHVRQADILVVAVGKPN--------LISGDWIKESAVVIDVGINRV-
FOLD_HAEI8       TVTHRFTKN--LENHVRQADILVVAVGKPN--------LISGDWIKESAVVIDVGINRV-
FOLD_HAES1       TVTHRFTKD--LKSHVHQADILVVAVGKPH--------IIPGEWIKEGAIVIDVGINRV-
FOLD_PASMU       TVTHRFTKD--LAHHVRQADILVVAVGKPK--------FIPGDWIKAGAIVIDVGINRQ-
FOLD_MANSM       TVTHRFTTN--LEGYVRQADILVVAVGKAE--------FIPGNWVKEGAVVIDVGINRCE
FOLD_HAEDU       TITHSRTKN--LVDHLSSADIVIVGIGHPN--------FVKGEWLKQGAIVIDVGINRDT
FOLD_COXBU       TVCHRFTRD--LAEHVKSAELLIVAIGKPG--------IIQSEWIKPGAIVIDVGFSRLS
FOLD_LEGPH       TICHKFTQQ--LQKFVEIADFLIVATGKMD--------VIATDWLREHQVVIDVGMHRLP
FOLD_LEGPL       TICHKFTQQ--LQKFVEIADFLIVATGKMD--------VIATDWLREHQVVIDVGMHRLP
FOLD_LEGPA       TICHKFTQQ--LQKFVEIADFLIVATGKMD--------VIATDWLREHQVVIDVGMHRLP
FOLD1_PSE14      TVTHRFTKD--LAGHVGRADLVVVAAGKPG--------LIKGEWIKPGAIVIDVGINRQD
FOLD1_PSESM      TVTHRFTKD--LAGHVSRADLVVVAAGKPG--------LVKGEWIKPGAIVIDVGINRQD
FOLD1_PSEU2      TVTHRFTRD--LAGHVGRADLVVVAAGKPG--------LVKGEWIKPGAIVIDVGINRQE
FOLD_PSEF5       TVTHRFTKD--LAGHVGRADLVVVAAGKPG--------LVKGEWIKEGAIVIDVGINRQD
FOLD_PSEPF       TVTHRFTKD--LAGHVGRADLVVVAAGKPG--------LVKGEWIKEGAIVIDVGINRQE
FOLD2_PSEPK      TVCHRFTKD--LAGHVGRADLVVVAAGKPG--------LVKGEWVKEGAIVIDVGINRQE
FOLD_PSEAE       TVTHRFTRD--LADHVSRADLVVVAAGKPG--------LVKGEWIKEGAIVIDVGINRQA
FOLD_HAHCH       TITHRFTVN--LPAKVSQADIVVVAVGRPG--------IVKGEWIKPGAIVIDVGINRRD
FOLD_CHRSD       TVCHRFTRD--LESHVRRADLLVVAVGRPG--------LVKGEWVKEGAVVIDVGINRQD
FOLD_METFK       TSCHRHTKD--LQASIARADIVVAAVGKPH--------LIKGEWIKPGAIVIDIGINRLA
FOLD_NITOC       TICHRWTRD--LHKPISEADIVVAAVGKPH--------LIQGKWIKPGATVIDVGFTRQP
FOLD2_HYDCU      TVCHRFTAD--LQTHVSMADILVTAVGKPN--------FIPADWIKPGAIVVDVGINRLP
FOLD_THIDA       TVCHSATRD--LESFVRSAEVLVVGVGRPR--------MIPGDWVREGAIVIDVGINRLA
FOLD_NEIMA       TVCHSATEN--LTDEVAGADILVVGVGIPN--------FVKGEWIKPGAVVIDVGINRLD
FOLD_NEIMB       TVCHSATEN--LTDEVAGADILVVGVGIPN--------FVKGEWIKPGAVVIDVGINRLD
FOLD_NEIG1       TVCHSATEN--LADEVAAADILVVGVGIPN--------FVKGGWIKPGAVVIDVGINRLD
FOLD_CHRVO       TVCHSATRN--LAEEVAAADILVVGVGIPN--------FVKGEWVKPGAVVIDVGINRLD
FOLD1_HYDCU      TVCHSATKD--LPQKVAEADLVVVGVGIPN--------MVKGDWIKDGAIVIDVGINRLD
FOLD_ALKEH       TICHSRTRN--LADRVRAADIVVAAVGRPG--------FVPGDWIKPGAVVIDVGINRLE
FOLD_XANAC       TSCHKFTPPDVLEASVRNADILVVAVGRPG--------LIPGEWVKPGAVVIDVGINRLD
FOLD_XANC5       TSCHKFTPPDVLEASVRNADILVVAVGRPG--------LIPGEWVKPGAVVIDVGINRLD
FOLD_XANOM       TSCHKFTPPDVLEASVRNADILVVAVGRPG--------LIPGEWVKPGAVVIDVGINRLD
FOLD_XANOR       TSCHKFTPPDVLEASVRNADILVVAVGRPG--------LIPGEWVKPGAVVIDVGINRLD
FOLD_XANC8       TSCHKFTPPDVLEASVRNADILVVAVGRPG--------LIPGEWVKPGAVVIDVGINRLD
FOLD_XANCP       TSCHKFTPPDVLEASVRNADILVVAVGRPG--------LIPGEWVKPGAVVIDVGINRLD
FOLD_XYLFA       TSCHKFTPPQMLEAAVRQADILIVAVGRPG--------VIPGEWVKPGAVVIDVGINRLD
FOLD_XYLFT       TSCHKFTPPQMLEAAVRQADILIVAVGRPG--------VIPGEWVKPGAVVIDVGINRLD
FOLD_ANADE       TIAH--SRTADLAGEVGRADILVAAIGKAE--------LVKGAWVKEGAVVIDVGMNRLA
FOLD2_MYXXD      TICH--SKS-DLRREVEGADILVVAVGAAE--------LVKGAWIKPGAVVIDVGMNRKP
FOLD2_GEOMG      TICH--SKTRDLPSKVKEADVVIAAVGVPE--------MIKGEWIKEGAVVIDVGVNRVG
FOLD2_GEOSL      TICH--SKTRDLPGRVRAADVVIAAVGVPE--------MIKGDWIKEGAVVIDVGVNRVG
FOLD_MOOTA       TICH--SRTRDLAAECRQADILIAAVGKPE--------LITGDMIKEGAVVIDVGINRVG
FOLD_AROAE       TVTH--SKTRDLAFHTRRADILVAAIGKPR--------FVTGDMIKPGAVVIDVGINRLT
FOLD_DECAR       TVCN--SRTKDLKFHTSRADILVAAVGKPK--------FVTGDMVKPGAVVIDVGINRLP
FOLD_BORBR       TICN--SKTRDLGAQTRRADVLVVATGKPG--------MIDGSMIKPGAVVIDVGINRGA
FOLD1_BORPE      TICN--SKTRDLGAQTRRADVLVVATGKPG--------MIDGSMIKPGAVVIDVGINRGA
FOLD1_BORPA      TICN--SKTRDLGAQTRRADVLVVATGKPG--------MIDGSMIKPGAVVIDVGINRGA
FOLD_BORA1       TICN--SKTRDLAAQTRRADVLVVATGRPR--------MITGDMIKPGAVVIDVGINRGD
FOLD2_BORPA      TICN--SKTRDLAGQARRADVLIVAAGRAG--------IVDGSMIKPGAVVIDVGINRGP
FOLD2_BORPE      TICN--SKTRDLAGQARRADVLIVAAGRAG--------IVDGSMIKPGAVVIDVGINRSP
FOLD_BURCA       TICH--SKTRDLAAHTREADIVVAAVGKRN--------ILTADMVKPGATVIDVGMNRDD
FOLD_BURL3       TICH--SKTRDLAAHTRQADIVVAAVGKRN--------ILTADMVKPGATVIDVGMNRDD
FOLD_BURP1       TICH--SKTRELAAHTRAADIVVAAVGKRN--------VLTADMVKPGATVIDVGMNRND
FOLD_BURPS       TICH--SKTRELAAHTRAADIVVAAVGKRN--------VLTADMVKPGATVIDVGMNRND
FOLD_BURMA       TICH--SKTCELAAHTRAADIVVAAVGKRN--------VLTADMVKPGATVIDVGMNRND
FOLD_BURTA       TICH--SKTRDLAAHTREADIVVAAVGKRN--------VLTADMVKPGATVIDVGMNRND
FOLD_PARXL       TICH--SKTRDLAAHTRNADVVVAATGLRN--------ILTADMVKPGAAVIDVGMNRDE
FOLD_CUPPJ       TICN--SKTRDIGAHTRDADVIVAAVGKRN--------LITADMVKPGAVVIDVGMNRDD
FOLD_CUPMC       TICN--SKTRDLAAHTRDADVIVAAVGRRN--------IITADIVKPGAVVIDVGMNRDD
FOLD_RALSO       TICN--SKTRDLAAHTREADIVVAAVGRRN--------IITADMVKPGAVVIDVGMNRDD
FOLD_POLSJ       TICH--SATKDLKAMTLQADVIVAAVGKRN--------VLTADMVKPGAVVIDVGMNRND
FOLD_RHOFT       TVCH--SATRDIGYHTRQADVIVAAVGKRN--------VLTADMVKPGAVVIDVGMNRND
FOLD_NITEU       TVCT--SRTRDLASHTRNADIVVMAAGKAN--------LLTSDMIRTGATVIDVGINRLA
FOLD_NITMU       TICT--SRTRNLAEHTSRADILIVAAGKPR--------LITAMMVKPGATVIDVGINRLS
FOLD_PSYA2       TICHSRTQD--LESHIKRADIVVGAVGVPE--------LIKANWIKAGAVVIDAGFHPTD
FOLD_PSYCK       TICHSRTQD--LESHIKRADIIVGAVGVPE--------LIKADWIKAGAVVIDAGFHPTD
FOLD2_ACIAD      TICHSRTQN--LAEFVKQADIIVGAVGKAE--------LIQKDWIKPGAVVVDAGFHPRD
FOLD_ALCBS       TICHSRTQN--LPELVKQADIVVGAVGKPE--------FIKADWIKDGAVVVDAGFHP--
FOLD_SACD2       TICHSRTQN--LEAHIKQADIVVGAVGKPE--------FIKAEWIKDGAVVVDAGYHP--
FOLD1_COLP3      TICHSKTVG--LDKIIKTADIVVGAVGKPE--------FIKADWIKDDAVVIDAGYHE--
FOLD_BACSK       TICHSRTEN--VSDFVEKADIVVAAVGKPN--------FIQGEWIKSGAVVLDAGYNK--
FOLD_LEPIC       TLCHSKTQN--LPDIVRNADIIIGAVGKPE--------FIKADWISNGAILLDAGYNP--
FOLD_LEPIN       TLCHSKTQN--LPDIVRNADIIIGAVGKPE--------FIKADWISNGAILLDAGYNP--
FOLD1_STRAW      TYCHSRTAD--LSAMVREADVVVAAVGRPR--------LIRGEDIKPGAVVIDAGYNP--
FOLD2_FRACC      TICHSRTRD--LAAVCRGADVLVVAAGKQA--------IIGADAVKPGATVIDVGMHRTP
FOLD_SYMTH       TICHSRTPD--LAETCRRADILVAAVGRLQ--------MITAEHVKPGAVVIDVGINPVP
FOLD_DEHM1       TICHSGTKN--LPLITSQADILVSAMGKPK--------FITADMVRQGAVVIDVGTTCIG
FOLD_DEHMC       TICHSGTKN--LPEITRQADILVAAMGKPK--------FITADMVREGAVVIDVGTTCIG
FOLD_DESPS       TIVHTGSRD--LATHCRRADILIVAAGVPN--------LVKPEWIKPGATVIDVGVNRVG
FOLD_LAWIP       TLVHTKSKN--IVRHCQQADIVIAAVGVPN--------FVKAEWIKPGATVIDVGVNRIG
FOLD_SYNAS       TVCHTGTRD--VGVHTRRADILIVAAGKPK--------AITADMVKEGAVVIDVGVNRVG
FOLD_TREDE       TVCHSGTKN--LTEVTKEADILVAAMGKPR--------FIKADMIKKGAVVIDVGVNRID
FOLD1_MYXXD      TITHRHTPD--LASFTRQADILIVAVGKQN--------LITADMVKPGVVVIDVGQNRVS
FOLD_TREPA       TLCHSHTRG--LADICVQADILVAALGKAR--------FIGAPFVRTGAVVIDVGIHHVP
FOLD1_HALMA      TVCHSRTEN--LAERTRNADILVAAAGVPE--------MIDGKMIQEGATVIDVGINRVD
FOLD_NATPD       TVCHSRTEN--LAAKTRRADIVVAAAGAPE--------LVDGSMIGEGSVVIDVGVNRVD
FOLD2_HALMA      TVCHSRTDD--LADKTRNADIVIAAAGVPE--------MIDGSMLSAGTTVIDVGINRVD
FOLD_HALSA       TICHSHTDD--LAAHTRRADVVVAACGVPE--------LIDGDMLSGDPVVIDVGINRVD
FOLD_HALWD       TTCHSRTNN--LASKTRDADIIIAAAGVPE--------MIDGDMISTGTVVIDVGINRVE
FOLD_SALRD       TVCHSRTKD--LAAHTRRADLLVAAAGQAA--------FIDADMVKEDAVVIDVGINRVD
FOLD_RHOBA       TIAHSRTSN--LAEICRQADILIAAVGRPE--------MITAEMIQPGAVVIDVGINRVG
FOLD_NOSS1       TIAHSRSQD--LKSITQNADILIAAAGLPG--------LITADMVKPGAVVVDVGINRVS
FOLD_TRIV2       TIAHSRSQD--LKSITQNADILVAAAGLPG--------LITADMVKPGAVVVDVGINRVT
FOLD_TRIEI       TIAHSRSKN--LEAITKKADILITAVGRPK--------MISAEMVKPGAVVIDVGINRVI
FOLD_SYNY3       TIAHSRTQN--LADITRQADILVAAIGKPE--------FVTADMVKPGAIVVDVGINRLD
FOLD_GLOVI       ITTHSRTAD--LAAITQMADVLVVAAGRPE--------LVTAAMVRPGAVVIDVGINRVT
FOLD_SYNJA       TVAHSRTPN--LAEVTRSADIVVMAVGRPR--------LLTADMVKPGAVVVDVGINRIQ
FOLD_SYNJB       TLAHSRTPD--LAEVTRAADIVVMAVGRPR--------LLRADMVKPGAVVIDVGINRIE
FOLD_THEEB       TIAHSRSRE--LASITRSAEILVTAMGQPR--------RITADMIRPGAVVIDVGINRIQ
FOLD_SYNP6       TIAHSRTPN--LPEVCRQADIVVAAVGRPE--------LVGADWIKPGAVVVDVGINRLE
FOLD_SYNE7       TIAHSRTPN--LPEVCRQADIVVAAVGRPE--------LVGADWIKPGAVVVDVGINRLE
FOLD_PROM9       TMTHSKTLD--LNKVCKEADILIAAAGKPN--------LIDSSFVKEGAVIIDVGIHRLK
FOLD_PROMP       TITHSKTIN--LNKICKEADILIAAAGKPN--------LINSSFVKEGAVIIDVGIHRLT
FOLD_SYNS9       TVVHSRTKD--LVAHTREADIVVVAAGRPG--------MVGAEHIKPGAAVVDVGIHRKP
FOLD_SYNSC       TIAHSRTAD--LAAHTREADILVVAAGRPE--------FIGAEHVRPGAAVVDVGIHRKP
FOLD_SYNPX       TVAHSRTAD--LAAHTREADIVVVAAGRPG--------MVGAEHVRPGAAVVDVGIHRKP
FOLD_SYNS3       TVAHSRTQH--LESITRQAEILVVAAGRPE--------MIGADHITPGCVVVDVGIHRRP
FOLD_PROMM       SVAHSHTGD--LASLTQQADVLVVAAGRAR--------MIGAEHVKPGAVVVDVGIHRLP
FOLD_PROMA       TVAHSKTIN--LPEITNQAEVLIVAAGIPQ--------LIGLEHVRSNAVVVDVGIHRIP
FOLD_PROMT       TIAHSKTKD--LPSLTKEADLLVVAAGKPY--------LIGENHVSENCVVIDVGIHRLP
FOLD_DESAG       TVCHSRTPD--LAQQCREADFLFVAIGRAN--------FVTADMVKPGAVVVDVGINRTE
FOLD_DESVH       TVCHSGTPD--LAAECRTADFLFLAIGRPR--------FVTADMVREGAVVVDVGINRTE
FOLD_THET2       TLAHSKTQD--LPQVTRRAQVLVVAVGRPH--------LVRKEWVREGAIVVDVGVNRVE
FOLD_THET8       TLAHSKTQD--LPEVTRRAQVLVVAVGRPH--------LVRKEWVREGAIVVDVGVNRVE
FOLD2_DEIGD      TVAHSRTPD--LGAVTREADLLCVAVGRPH--------LITPDMVRPGATVVDVGINRVL
FOLD1_RUBXD      TVCHSRTRD--LAGVTRRAEVLVVAAGRRG--------MVGAEHVREGAVVVDVGIHRAE
FOLD_KORVE       TICHSKTHD--LPAVCRRADILVAAIGRPG--------MITPDFVKPGATVLDVGINKIT
FOLD_COREF       TLCHTGTKD--LAAETRAADVIVAAAGQPH--------MLTADMVKPGAAVLDVGVSR-K
FOLD_CORGL       TLCHTGTKD--LAAETRAADVIIAAAGQPH--------MLTADMVKPGAAVLDVGVSR-K
FOLD_CORJK       TLCHTGTKD--LAAETKAADVIVAAAGVPH--------MITADMVKPGAAILDVGVSRGE
FOLD_CORDI       TLCHTGTRD--LAAETREADVIVAAAGKAH--------MLTADMVKQGAAILDVGVSR-V
FOLD_MYCBO       TLCHTGTRD--LPALTRQADIVVAAVGVAH--------LLTADMVRPGAAVIDVGVSRTD
FOLD_MYCTU       TLCHTGTRD--LPALTRQADIVVAAVGVAH--------LLTADMVRPGAAVIDVGVSRTD
FOLD_MYCPA       TLCHTGTRD--LPALTRQADIIVAAVGVPH--------LLTADMVRPGAAVLDVGVSRVD
FOLD_MYCLE       TLCHTGTRN--LAALTKQADIIVAAVGVPH--------LLTADMVRPGAVVVDVGVSRVE
FOLD_MYCFO       TLCHTGTRD--LPALTRQADIIIAAVGVPH--------MVTADMVKPGAAVVDVGVSRVD
FOLD_MYCSS       TLCHTATRH--LPQFTREADIIVAAAGVPH--------MVTAEMVRPGAAVIDVGVSRDD
FOLD2_RHOJR      TLCHTRTRD--LGAEVRRADIVIAAAGVPG--------LITADMVKPGAAVLDVGVSRTA
FOLD2_STRAW      TQCHTGTRD--LSSHLKRADIIVAAAGSAH--------LIRPEDVKPGAAVLDVGVSRSA
FOLD_STRCO       TQCHTGTRD--LAAHLKRADIVIAAAGSPH--------LVRPEDVKPGAAVLDVGVSRNA
FOLD_THEFY       TLCHTGTRD--LAAHTRRADIVVAAAGVPG--------LITKDMVSPGAVVLDVGVTRTE
FOLD_CUTAK       TLCHTGTRN--LAEHTRQADIIIGAAGSPG--------LINADMIREGAVLVDVGVSRTP
FOLD_LEIXX       TLTHTGTKS--LDEHLRSADVIVAAAGVPG--------LVSAENVKPGAIVLDVGVSRVE
FOLD_BIFLO       TLCHTGTRD--VADHMRRADVIVAAMGSAG--------FVTPDKIKDGAVLVDVGVSRVY
FOLD_PELCD       TVVHSGIKD--LGAYTRRADIVIAAAGCPG--------IVQPDMIRPGAVVISGGISWEG
FOLD_TROW8       INIHSRSRN--ISGLSRIADVVVACAGVKH--------IVEPSWIKPGAVVVDVGINQSG
FOLD_TROWT       INIHSRSRN--ISGLSRIADVVVACAGVKH--------IVEPSWIKPGAVVVDVGINQSG
FOLD_BDEBA       TLCHSKTSN--MSELTKQADLVVVAAGKAR--------LLGKEDFKKDAIVIDVGMHGSG
FOLD_LACAC       TIAHSETEN--LAELTRNADIIVSATGQAF--------LVTEDMVKDGVVVVDVGMNHVN
FOLD_LACDA       SILHSRSRN--LADLTKQADILVCAVGKAE--------MIKADMVKEGAVVIDVGINRVD
FOLD2_LACJO      TIAHSKTKN--LSELTKNADVIISDVGKAH--------LVTEDMVKEGAVIIDVGMNREN
FOLD_METHJ       TMCHSKTEN--LKEITKQADILVSAAGKAG--------IITADMVKPGATVVDVGTNQVN
FOLD_CLOD6       TICHSKTKN--LSGVAAEADVLIAAIGRAK--------MVDESFVKDGAVVIDVGINVDE
FOLD1_DESHY      TICHSRTRN--LPEVAKNADIVIAAMGRAR--------MIDDNYVAENSIVIDVGINDAG
FOLD_CARHZ       TICHSRTKN--LPDVCREADILVAAVGRAK--------MVKEDYVKPGMVVIDVGINEDP
FOLD_CLOAB       TICHSRTQN--LKDICKKADIIVSAIGRPG--------FITDEFVNEKSIVIDVGTTVVD
FOLD_CLOTE       TICHSKTKD--IKSLCKEADIIVSAMGIPK--------FVKEDFIKDGAIVIDVGFSVLD
FOLD_CLOP1       TVCHSRTKN--LKEVCKRADILVVAIGRAN--------FIDSSYVREGAVVIDVGTSEVN
FOLD_CLOPE       TVCHSRTKN--LKEVCKRADILVVAIGRAN--------FIDSSYVREGAVVIDVGTSEVN
FOLD_CLOPS       TVCHSKTKN--LKEVCKRADILVVAIGRAN--------FIDSSYVREGAVVIDVGTSEVN
FOLD2_SYNWW      TVCHTRTRN--LKEEALRADILVAAVGKRE--------FVTADMVHKDMVVIDVGINFDE
FOLD2_DESHY      TICHSRTPD--LGAFTRQADIIVAAVGKAK--------LVKKDMVKPGAIVVDAGINEIP
FOLD_CALS4       TVCHSKTKD--LAYHTKQADVLVVAAGKMN--------LVRGDMVKEGVVLIDAGINVHE
FOLD_METAC       SVCHIFTDD--LKKYTLGADIIVVATGVKH--------LIKADMVKEGTVIFDAGITKEE
FOLD_METMA       SVCHIFTDD--LKKYTLGADILVVAAGVKH--------LIKADMVKEGAVIFDVGITKEE
FOLD_METBF       SVCHVFTDD--LKKYTLDADILVVATGVKH--------LIKADMVKEGAVIFDVGITKEK
FOLD_METBU       SICHVFTKD--VTKFTRDADILVVATGVKH--------LIKEDMVKEGSVIFDVGITEEN
FOLD1_SYNWW      SVLPSYEPG-----LASGADILVVEKGRAG--------IVQAEGLAPGVLIIDAGFYWGA
FOLD2_RUBXD      SCDANAYRAGRLREHTLKADALIVAAGVAG--------LIDESYVREGVIAVDVGINPVA
FOLD3_RUBXD      SCDANAYRAGRLREHTLKADALIVAAGVAG--------LIDESYVREGVIAVDVGINPVA
FOLD_NOCFA       TVCHSRTTD--LAAITSTADVVVAAVGRAG--------LVTGDHVRAGAVVVDVGTNEA-
FOLD1_RHOJR      TVCHRHTTD--LAAGTRDADILVVAVGIPG--------LITADHVADGAVVIDVGTTAT-
FOLD_ARTGO       TVCHSKSGA--LGTYTKTADVVVVAAGRTG--------LLTGADVSEHSVVIDVGTNVL-
FOLD1_FRACC      TICHSRTKG--LVSIAHEADIIVSATGHPR--------LVGAGFVRPGAAVIDVGTVVT-
FOLD3_ROSDO      TVCHHLTRS--VAMHSRRADVIVVAVGKAH--------LIGADMVKPGAAVIDIGINQIT
FOLD2_RUEPO      TVCHHMTRS--DAMHSRRADVVVVAVGKAH--------LIGPDMIKPGAVVIDIGINHVP
FOLD_RHOCB       TVCHHMTRS--VAMHSRRADVVIVAVGKAH--------LIGPEMIKPGAAVIDIGINQVT
FOLD2_RHILO      TVCHHLTRS--VAAHARRADALFVAVGKPR--------LIKADMVKPGAAVIDIGINSEI
FOLD_PYRAE       TVLHALSKE--REPYVKRADIVISAVGRPPELYKDNPWRLTGDMIKEGAVVVGVGGKVDP
FOLD_THEAC       SVCHSKTKD--IGSMTRSSKIVVVAVGRPG--------FLNREMVTPGSVVIDVGINYV-
FOLD_THEVO       SICHSKTPD--IRSIAKASKIIVVAVGRPG--------FLDDTYVTESSVVIDVGINYV-
FOLD_PICTO       TVCHSRTVN--INEITRSSDIVVVAVGKPN--------FLDRSYVSDKNIIIDVGINYL-
FOLD_THEMA       TVCHSRTVN--LEEITKNSDIVVVAVGRAH--------FLKKNMVKEGAIVIDVGINYV-
FOLD1_DEIGD      TLCNECTRD--LRDVLAPQDAVVVAVGHAG--------LLRPEQVQPHHVVIDAGINVT-
FOLD_DEIRA       TLCNEHTRD--LAAVLAAQDAVVVAVGKAG--------LLRPEQVQPEHVVIDAGINVQE
FOLD_MYCPE       TVCHTKTQN--LKEMTKTADIVVVAIGKPD--------FLTKDMVNPNAFVIDAGISVV-
FOLD_BORBU       IVCHSKSIY--LDVYLRQADIVISAVGKPR--------LIDKSMLCGKPYVIDIGISEIE
FOLD_BORBP       IVCHSKSIY--LDVYLRQADIVISAVGKPK--------LIDKSMLCGEPYVIDIGISEIE
FOLD_BORAP       IACHSKSIY--LDVYLRQADIIISAVGKPK--------LIDKSMLCGKPYVIDIGISEIE
FOLD_MYCMO       KSFNINTGIK----GSEEADILIVAAGHPN--------LVKPENVKNNSIVIDVGINSIG
FOLD_MYCPU       RVFDKSTGLK----GTEEADILIVATGVAQ--------LIKAENIKENSILIDVGFSKIN
FOLD_MYCS5       STFDENTPIK----LVASADIVIVAIGVPK--------YIKAENIKQGAIIIDVGTNYDQ
FOLD_MYCGE       QACDKDTPN--TFELIKSADIVFTAIGKSH--------FFQAKNFKKGVILFDIGVSRNK
FOLD_MYCPN       VGCDKHTPN--TMELIKTADVVITAIGKPH--------FFKTTNFKPGVILYDVGVSRNV
FOLD_MYCGA       DLITKENSQ-LLEEKTKVADLVISAVGKAK--------FLANYQFKRGVIFIDIGIDKYF
                                    . :    *            .    .       . *     

FOLD_BACSU       N----------GKLCGDVEF----------------EGAKEKASFITPVPGGVGPMTITM
FOLD_BACLD       N----------GKLAGDVDF----------------EEAKEKASYITPVPGGVGPMTITM
FOLD_BACCZ       T----------GKLCGDVDF----------------DNVLDVAGYITPVPKGVGPMTITM
FOLD_BACHK       T----------GKLCGDVDF----------------DNVLDVAGYITPVPKGVGPMTITM
FOLD_BACAN       T----------GKLCGDVDF----------------DNVLDVASYITPVPKGVGPMTITM
FOLD_BACC1       T----------GKLCGDVDF----------------DNVLDVAGYITPVPKGVGPMTITM
FOLD_BACCR       T----------GKLCGDVDF----------------DNVLDVAGYITPVPKGVGPMTITM
FOLD_GEOKA       N----------GKLCGDVDF----------------DAVKEVAGYITPVPGGVGPMTITM
FOLD_BACHD       -----------GKLCGDVDF----------------ESVREVASHLTPVPGGVGPMTITM
FOLD_OCEIH       D----------GKLTGDVDF----------------ESAEQKASYITPVPRGVGPMTITM
FOLD_LISMF       N----------NKLCGDVDF----------------DDVVEEAGFITPVPGGVGPMTITM
FOLD_LISMO       N----------NKLCGDVDF----------------DDVVQEAGFITPVPGGVGPMTITM
FOLD_LISIN       N----------NKLCGDVDF----------------DDVKEQAGFITPVPGGVGPMTITM
FOLD_STAA3       N----------GKLKGDVDY----------------DAVKEIAGAITPVPGGVGPLTITM
FOLD_STAAC       N----------GKLKGDVDY----------------DAVKEIAGAITPVPGGVGPLTITM
FOLD_STAAS       N----------GKLKGDVDY----------------DAVKEIAGAITPVPGGVGPLTITM
FOLD_STAAW       N----------GKLKGDVDY----------------DAVKEIAGAITPVPGGVGPLTITM
FOLD_STAA8       N----------GKLKGDVDY----------------DAVKEIAGAITPVPGGVGPLTITM
FOLD_STAAM       N----------GKLKGDVDY----------------DAVKEIAGAITPVPGGVGPLTITM
FOLD_STAAN       N----------GKLKGDVDY----------------DAVKEIAGAITPVPGGVGPLTITM
FOLD_STAAB       N----------GKLKGDVDY----------------DAVKEIAGAITPVPGGVGPLTITM
FOLD_STAAR       N----------GKLKGDVDY----------------DAVKEIAGAITPVPGGVGPLTITM
FOLD_STAHJ       N----------GKLKGDVEF----------------EEVKEVAGAITPVPGGVGPLTITM
FOLD_STAEQ       N----------GKLKGDVAY----------------DEIKEIASAITPVPGGVGPLTITM
FOLD_STAES       N----------GKLKGDVAY----------------DEVKEIASAITPVPGGVGPLTITM
FOLD_STAS1       N----------GKLKGDIEY----------------DEVKEVAGAITPVPGGVGPMTITM
FOLD_STRTR       E----------GKLCGDVDF----------------DQVKEKVSMITPVPGGVGPMTITM
FOLD_STRT1       E----------GKLCGDVDF----------------DQVKEKVSMITPVPGGVGPMTITM
FOLD_STRT2       E----------GKLCGDVDF----------------DQVKEKVSMITPVPGGVGPMTITM
FOLD_STRA1       N----------GKLIGDVVF----------------EQVAEVASMITPVPGGVGPMTITM
FOLD_STRA3       N----------GKLIGDVVF----------------EQVAEVASMITPVPGGVGPMTITM
FOLD_STRA5       N----------GKLIGDVVF----------------EQVAEVASMITPVPGGVGPMTITM
FOLD_STRMU       N----------GKLIGDVNF----------------DHVAQKASLITPVPGGVGPMTITM
FOLD_STRP8       N----------GKLIGDVAF----------------DEVAEVAAKITPVPGGVGPMTIAM
FOLD_STRPM       N----------GKLIGDVAF----------------DEVAEVAAKITPVPGGVGPMTIAM
FOLD_STRP1       N----------GKLIGDVAF----------------DEVAEVAAKITPVPGGVGPMTIAM
FOLD_STRP3       N----------GKLIGDVAF----------------DEVAEVAAKITPVPGGVGPMTIAM
FOLD_STRP6       N----------GKLIGDVAF----------------DEVAEVAAKITPVPGGVGPMTIAM
FOLD_STRPB       N----------GKLIGDVAF----------------DEVAEVAAKITPVPGGVGPMTIAM
FOLD_STRPC       N----------GKLIGDVAF----------------DEVAEVAAKITPVPGGVGPMTIAM
FOLD_STRPD       N----------GKLIGDVAF----------------DEVAEVAAKITPVPGGVGPMTIAM
FOLD_STRPF       N----------GKLIGDVAF----------------DEVAEVAAKITPVPGGVGPMTIAM
FOLD_STRPN       N----------GKLCGDVDY----------------EAVAPLASHITPVPGGVGPMTITM
FOLD_STRR6       N----------GKLCGDVDY----------------EAVAPLASHITPVPGGVGPMTITM
FOLD_ENTFA       E----------GKLIGDVAF----------------DEVSEIASYITPVPKGVGPMTITM
FOLD_LACLA       D----------GKLHGDVDF----------------DEVKDVASLITPVPGGVGPMTITM
FOLD_LACS1       D----------GKLVGDVNM----------------ESVSKVASYITPVPGGVGPMTIAM
FOLD1_LACJO      N----------HYLVGDVDF----------------DDVKEVAKNITPVPGGVGPMTIAT
FOLD_LACPL       N----------GKLVGDVDF----------------DSAQGIAGLITPVPGGVGPMTIAT
FOLD_LACSS       D----------GSVTGDVDF----------------EALQTHVSAMTPVPRGVGPMTITM
FOLD_RICCN       SNK----------IIGDVDF----------------ENVQSKVQYITPVPGGIGPMTIAF
FOLD_RICFE       GNK----------IIGDVDF----------------ENVKSKVKYITPVPGGIGPMTIAF
FOLD_RICPR       HNK----------IAGDVDF----------------ENVKSKVKYITPVPGGIGPMTIAF
FOLD_RICTY       NNK----------IIGDVDF----------------ENVKSKVKYITPVPGGIGPMTIAF
FOLD_RICBR       GNK----------IVGDVDF----------------ENVKSKVKYITPVPGGIGPMTIAF
FOLD_PELUB       -NG----------IVGDVAF----------------EEVSKVARALTPVPGGVGPMTIAC
FOLD_ANAMM       ESGK-------KRFVGDVEF----------------EGLQDVPCSVTPVPGGVGPMTIAF
FOLD_ANAPZ       SESK-------NRFVGDVDF----------------ESVRDKVAAITPVPGGVGPMTIAF
FOLD_EHRCJ       EDGV-------KKFVGDVNF----------------AEAKNVASAITPVPGGVGPMTIAF
FOLD_EHRCR       EGGV-------KKFVGDVDF----------------SEARNIASAITPVPGGVGPMTIAF
FOLD_EHRRG       EDGV-------KKFVGDVDF----------------AEVNKIASAITPVPGGVGPMTIAF
FOLD_EHRRW       EDGV-------KKFVGDVDF----------------AEVNKIASAITPVPGGVGPMTIAF
FOLD_WOLPM       VG----------KLVGDVDF----------------EGIKGKAKAMTPVPGGVGPMTIAF
FOLD_WOLTR       IEGK-------TKLIGDVDF----------------DRVKEKTKAITPVPGGVGPMTIAF
FOLD_NEOSM       GK-----------LVGDVDF----------------EDVLQKVKFITPVPRGVGPMTIAF
FOLD2_PSE14      D-------QGRSRLVGDIDF----------------DNALSVASAITPVPGGVGPMTIAF
FOLD2_PSESM      D-------QGRSRLVGDVDF----------------DNALDVVSAITPVPGGVGPMTIAF
FOLD2_PSEU2      D-------HGRSRLVGDVDF----------------ASATEVASAITPVPGGVGPMTIAF
FOLD1_ACIAD      T-------HEKTRLVGDVDF----------------EDALPMVSAITPVPGGVGPMTIAY
FOLD_GLUOX       AE------NGKTRLVGDVAF----------------DEAFPIAGHITPVPGGVGPMTIAC
FOLD1_PSEPK      LP------NGRDKLTGDVAF----------------EEAVEVAGAITPVPGGVGPMTIAY
FOLD_SPHCR       LD------DGRSRIVGDVAS----------------DE-IGHAAAFTPVPGGVGPMTIAC
FOLD_METC4       VS------SGY-RLVGDVDF----------------EGVQYVASAITPVPGGVGPMTVAA
FOLD1_RHIEC      AP---EKGEGKTRLVGDVAF----------------REVSEIASTITPVPGGVGPMTIAM
FOLD2_RHIEC      AP---EKGEGKTRLVGDVAF----------------REVSEIAGTITPVPGGVGPMTIAM
FOLD_RHIL3       AP---ETGEGKTRLVGDVAF----------------EEVSAVASTITPVPGGVGPMTIAM
FOLD_RHILT       AP---ERGEGKTRLVGDVAF----------------EEVSAVASTITPVPGGVGPMTIAM
FOLD2_RHIME      AP---ERGEGRTKLVGDVAF----------------DECAKVAGVITPVPGGVGPMTIAM
FOLD1_RHIME      AP---EKGENRTRLVGDVAF----------------AECAPFASAITPVPGGVGPMTIAM
FOLD_AGRFC       AP---EKGEGKSKLVGDVAF----------------DEASAVAAAITPVPGGVGPMTIAM
FOLD_BARHE       AP---EKGVGKTRLVGDVDF----------------EEIKEKAAAITPVPGGVGPMTIAM
FOLD_BARQU       AP---EKGIGKTRLVGDVDF----------------EAIKGKTAAITPVPGGVGPMTIAM
FOLD_BRUA2       AP---ERGEGKTRLVGDVDF----------------AEAEKVAGAITPVPGGVGPMTIAM
FOLD_BRUAB       AP---ERGEGKTRLVGDVDF----------------AEAEKVAGAITPVPGGVGPMTIAM
FOLD_BRUME       AP---ERGEGKTRLVGDVDF----------------AEAEKVAGAITPVPGGVGPMTIAM
FOLD_BRUSU       AP---ERGEGKTRLVGDVDF----------------AEAEKVAGAITPVPGGVGPMTIAM
FOLD1_RHILO      AP---EKGEGKSRLVGDVAY----------------AEAARQAGAITPVPGGVGPMTIAM
FOLD_CHESB       AP---EKGEGKMKLVGDVAY----------------AEAEKVAGAITPVPGGVGPMTIAM
FOLD_SINFN       SR---DDG-GKTRLVGDVDF----------------DGAVERAGAVTPVPGGVGPMTIAM
FOLD_NITHX       A-----ADG-KTRLIGDVAF----------------DEAMEVAGAVTPVPGGVGQMTVAC
FOLD_NITWN       A-----AEG-KTRLIGDVAF----------------DEAMQVAGAVTPVPGGVGQMTVAC
FOLD_BRADU       K-----EDG-KTRLVGDVAY----------------QEALGVAGAITPVPGGVGQMTVAC
FOLD_RHOP2       S-----PDGGKDKLVGDVAF----------------AEAKDIAGAITPVPGGVGLMTVAC
FOLD_RHOPS       S-----PDGGKDKLVGDVAF----------------HEAKDVAGAITPVPGGVGLMTVAC
FOLD_RHOPB       S-----PDGGKDKLVGDVAF----------------AEAKEVAGAITPVPGGVGLMTVAC
FOLD_RHOPA       G-----KDGGKDKLLGDVAF----------------AEAKEVAGAITPVPGGVGLMTVAC
FOLD2_ROSDO      APE---KGEGKTRLVGDCHY----------------DSCAETAGAITPVPGGVGPMTIAC
FOLD_RUEST       APE---KGEGKTRLVGDVHY----------------ESAAARAGAITPVPGGVGPMTIAC
FOLD1_ROSDO      APE---KGEGKTRLVGDVDF----------------DSCAAVAGAITPVPGGVGPMTIAC
FOLD1_RUEPO      R-------DGKTRLVGDVHY----------------DSCAQVAGAITPVPGGVGPMTIAC
FOLD_RHOS4       R-------DGKTKLVGDVDY----------------ASAAEVAGAITPVPGGVGPMTIAC
FOLD_JANSC       HPD---K-PGKTKLIGDVHF----------------AEAVDVAGAITPVPGGVGPMTIAC
FOLD_MAGSA       LP------DGTKKLVGDVDF----------------ASAVKVAGAITPVPGGVGPMTIAC
FOLD_NOVAD       GKE-----EGKTRLVGDVDY----------------ASAAEVASAITPVPGGVGPMTIAV
FOLD_SPHAL       PAD---G-AAKGRLVGDVDY----------------AAALGVADAITPVPGGVGPMTIAC
FOLD_CAUVC       ARDPEAAAAGKTRLVGDVAF----------------DEVREVAGAITPVPGGVGPMTIAC
FOLD_ZYMMO       AEDEAAKAAGKTRIVGDVDF----------------VEAAKVASAITPVPGGVGPMTIAC
FOLD_RHORT       A----APGAEKGKLVGDVDY----------------ASAAAVAGAITPVPGGVGPMTIAC
FOLD_HYPNA       APE---KGEGKTRLVGDAHY----------------ESCAEVAGFITPVPGGVGPMTIAC
FOLD_MARMM       APE---RGAGKTRLVGDAAF----------------DEIVGHAGWITPVPGGIGPMTIAM
FOLD_CHLTR       AA----NPK-GYILVGDVDF----------------NNVVPVCRAITPVPGGVGPMTVAM
FOLD_CHLTA       AA----NPK-GYILVGDVDF----------------NNVVPVCRAITPVPGGVGPMTVAM
FOLD_CHLMU       AD----NPK-GYSLVGDVDF----------------NNVVPVCQAITPVPGGVGPMTVAM
FOLD_CHLAB       TN----NAK-GYILVGDVDF----------------NNVVTKCKAISPVPGGVGPMTVAM
FOLD_CHLCV       AN----NDK-GYTLVGDVDF----------------NNVVAKCKAVSPVPGGVGPMTVAM
FOLD_CHLFF       TN----NDK-GYMLVGDVDF----------------NNVVTKCKAITPVPGGVGPMTVAM
FOLD_CHLPN       AD----NAK-GYTLLGDVDF----------------NNVVTKCAAITPVPGGVGPMTVAM
FOLD_PARUW       DS----SKKNGYQIVGDVDF----------------VNVAPKCAFITPVPGGVGPMTIAM
FOLD_BACFN       DA----SKKSGFKLTGDVKF----------------DEVSPKCSFITPVPGGVGPMTIVS
FOLD_BACFR       DA----SKKSGFKLTGDVKF----------------DEVSPKCSFITPVPGGVGPMTIVS
FOLD_BACTN       DA----SKKSGFKLTGDVKF----------------DEVAPKCSFITPVPGGVGPMTIVS
FOLD_PORGI       DS----TRKSGFRLTGDVKF----------------DEVAPKCSYITPVPGGVGPMTIVS
FOLD_CYTH3       DA----TKKSGFRLLGDVKF----------------DEVAPKTSYISPVPGGVGPMTIAS
FOLD1_GEOMG      DG----------KIVGDVDF----------------ENVKKKCSWITPVPGGVGRMTVAA
FOLD1_GEOSL      SG----------KIVGDVDF----------------ENVAQKCSWITPVPGGVGRMTVAA
FOLD_CHLCH       DA----SAKNGYRLVGDVEY----------------AGVSALASAITPVPGGVGPMTIAM
FOLD_PELLD       DP----TTKSGTRLVGDVDY----------------EGVSAKAAAMTPVPGGVGPMTIAM
FOLD_HELPY       ------NHLNDGRIVGDVDF----------------NNVQKVAGFITPVPKGVGPMTIVS
FOLD_HELPH       ------NHLNDGRIVGDVDF----------------NNAQKVAGFITPVPKGVGPMTIVS
FOLD_HELPJ       ------NHLNDGRIVGDVDF----------------INAQKIAGFITPVPKGVGPMTIVS
FOLD_HELHP       ------NRLESGTLVGDVDF----------------ENVAPKSSFITPVPGGVGPMTIVS
FOLD_SULDN       ------NRAESGKLVGDVDF----------------ENVAKKCSFITPVPGGVGPMTIAM
FOLD_WOLSU       ------NRLEDGSLVGDVDF----------------ASVAPKCSYITPVPGGVGPMTIAS
FOLD_CAMJE       ------NRLESGKIVGDVDF----------------EEVSKKSSYITPVPGGVGPMTIAM
FOLD_CAMJR       ------NRLESGKIVGDVDF----------------EEVSKKSSYITPVPGGVGPMTIAM
FOLD_AQUAE       ------SRLN-GKIVGDVDF----------------ERVKEKASAITPVPGGVGPMTVTA
FOLD_FUSNN       ------NRVN-GKLEGDVDF----------------ENVQKKASHITPVPGGVGALTVAM
FOLD_FRAT1       ------NHVD-GKIVGDVDF----------------AAVKDKVAAITPVPGGVGPMTITE
FOLD_FRATT       ------NHVD-GKIVGDVDF----------------AAVKDKVAAITPVPGGVGPMTITE
FOLD_FRATH       ------NHVD-GKIVGDVDF----------------AAVKDKVAAITPVPGGVGPMTITE
FOLD_FRATO       ------NHVD-GKIVGDVDF----------------AAVKDKVAAITPVPGGVGPMTITE
FOLD_MYCCT       ------RDPITNKIVGDVDF----------------ENVKELCSYITPVPGGVGPMTVAM
FOLD_MYCMS       ------KDPITNKIVGDVDF----------------ENVKELCSYITPVPGGVGPMTVSM
FOLD_MESFL       ------RDPVTNKLVGDVDF----------------EKVKLKSSYITPVPGGVGPMTVIT
FOLD_SPICI       ------RDE-DNNLCGDIDF----------------HNVFSKVKMITPVPGGVGPMTIAA
FOLD_BUCAI       ----------NGKVVGDVEF----------------KTAYLRASYITPVPGGVGPMTVAT
FOLD_BUCAP       ----------DGSIVGDVDF----------------KSASLKAAYITPVPGGVGPITVIT
FOLD_BUCBP       ----------NGEIVGDVDF----------------KTAYKKSSYITPVPGGVGPMTVIT
FOLD_BLOFL       ----------NGNIVGDVHF----------------PSAYKRAAYITPVPGGVGPMTVIS
FOLD_BLOPB       ----------NGNIVGDVHF----------------SSAYERAAYITPVPGGVGPMTVVT
FOLD_WIGBR       ----------SGKIVGDVNY----------------EDAIEKASYITPVPGGIGPMTIAM
FOLD_ECOLI       ----------NGKVVGDVVF----------------EDAAKRASYITPVPGGVGPMTVAT
FOLD_SHIDS       ----------NGKVVGDVVF----------------EDAAKHASYITPVPGGVGPMTVAT
FOLD_SHIFL       ----------NGKVVGDVVF----------------EDAAKRASYITPVPGGVGPMTVAT
FOLD_SHISS       ----------NGKVVGDVVF----------------EDAAKRASYITPVPGGVGPMTVAT
FOLD_SHIBS       ----------NGKVVGDVVF----------------EDAAKRASYITPVPGGVGPMTVAT
FOLD_ECO57       ----------NGKVVGDVVF----------------EDAAKRASYITPVPGGVGPMTVAT
FOLD_ECOL5       ----------NGKVVGDVVF----------------EDAAKRASYITPVPGGVGPMTVAT
FOLD_ECOL6       ----------NGKVVGDVVF----------------EDAAKRASYITPVPGGVGPMTVAT
FOLD_ECOUT       ----------NGKVVGDVVF----------------EDAAKRASYITPVPGGVGPMTVAT
FOLD_SALTY       ----------NGKVVGDVVF----------------DEAAARASYITPVPGGVGPMTVAT
FOLD_SALCH       ----------NGKVVGDVVF----------------DEAAARASYITPVPGGVGPMTVAT
FOLD_SALPA       ----------NGKVVGDVVF----------------DEAAARASYITPVPGGVGPMTVAT
FOLD_SALTI       ----------NGKVVGDVVF----------------DEAAARASYITPVPGGVGPMTVAT
FOLD_PHOLL       ----------DGKVIGDVDF----------------ETASERASWISPVPGGVGPMTVAT
FOLD_YERPA       ----------SGKVVGDVAF----------------DVAAERAGWITPVPGGVGPMTVAT
FOLD_YERPE       ----------SGKVVGDVAF----------------DVAAERAGWITPVPGGVGPMTVAT
FOLD_YERPN       ----------SGKVVGDVAF----------------DVAAERAGWITPVPGGVGPMTVAT
FOLD_YERPS       ----------SGKVVGDVAF----------------DVAAERAGWITPVPGGVGPMTVAT
FOLD_PECAS       ----------SGKVVGDIEF----------------ETAQERASYISPVPGGVGPMTVAT
FOLD_SODGM       ----------SGKVVGDVDY----------------ASAAERAAYITPVPGGVGPMTVAT
FOLD_BAUCH       ----------NGKVVGDVNF----------------SEAIERAAYITPVPGGVGPMTVAT
FOLD_PHOPO       ----------NGKLCGDVEF----------------DVACQRAKYITPVPGGVGPMTVAS
FOLD_PHOPR       ----------SGKLAGDVEY----------------DVAREKAKYITPVPGGVGPMTVAT
FOLD_VIBVU       ----------SGKLIGDVEY----------------NKARERASFITPVPGGVGPMTVAS
FOLD_VIBVY       ----------SGKLIGDVEY----------------NKARERASFITPVPGGVGPMTVAS
FOLD_VIBPA       ----------SGKLVGDVEY----------------DKARESASFITPVPGGVGPMTVAS
FOLD_VIBCH       ----------TGKLVGDVEY----------------DVARTRASFITPVPGGVGPMTVAS
FOLD_ALIF1       ----------SGKLIGDVEY----------------DVAKTKASYITPVPGGVGPMTVAT
FOLD_PSEHT       ----------SGKLVGDVEY----------------SVAEQKADFITPVPGGVGPMTVAS
FOLD_IDILO       ----------DGRLTGDVEF----------------SVAAERAGWITPVPGGVGPMTVAS
FOLD_PSEA6       ----------DGTLIGDVDY----------------ATAEKRAGWITPVPGGVGPMTVAS
FOLD_SHEDO       ----------NGSLVGDVEF----------------DAASQHAGFITPVPGGVGPMTIAC
FOLD_SHEFN       ----------NGSLVGDVEF----------------NVAAEKAAFITPVPGGVGPMTIAS
FOLD_SHESM       ----------NGTLVGDVQY----------------DVAAQNASFITPVPGGVGPMTIAS
FOLD_SHESR       ----------NGTLVGDVQY----------------EVAAQNASFITPVPGGVGPMTIAS
FOLD_SHEON       ----------NGTLVGDVQY----------------ETAAQNASFITPVPGGVGPMTIAS
FOLD2_COLP3      ----------NGKLVGDVDF----------------GAAKERASFITPVPGGVGPMTVAS
FOLD_HAEIN       ----------DGKLVGDVEF----------------DKAAEKAAYITPVPGGVGPMTVAM
FOLD_HAEI8       ----------DGKLVGDVEF----------------DKAAEKAAYITPVPGGVGPMTVAM
FOLD_HAES1       ----------DGKLVGDVQY----------------DEASKKASFITPVPGGVGPMTVAM
FOLD_PASMU       ----------EGKLVGDVEY----------------DVALEKAGYITPVPGGVGPMTVAM
FOLD_MANSM       ----------DGKLRGDVEF----------------AAAAEKAGFITPVPGGVGPMTVAM
FOLD_HAEDU       Y---------SKKLVGDVDF----------------LTAEAKASFITPVPGGVGPMTVAM
FOLD_COXBU       ----------PNKIAGDIDF----------------ETAKERASWITPVPGGVGPMTVAT
FOLD_LEGPH       ----------DGSIRGDIDF----------------KKAVEKVAWITPVPGGVGPMTIVT
FOLD_LEGPL       ----------DGSIRGDIDF----------------KKAVEKVAWITPVPGGVGPMTIVT
FOLD_LEGPA       ----------DGSIRGDIDF----------------KKAVEKVAWITPVPGGVGPMTIVT
FOLD1_PSE14      ----------DGKLVGDVVY----------------ETALPRAGWITPVPGGVGPMTRAC
FOLD1_PSESM      ----------DGKLVGDVVY----------------ETALPRAGWITPVPGGVGPMTRAC
FOLD1_PSEU2      ----------DGKLVGDVVY----------------ETALPRAGWITPVPGGVGPMTRAC
FOLD_PSEF5       ----------DGKLVGDVVY----------------ETALPRAGWITPVPGGVGPMTRAC
FOLD_PSEPF       ----------DGKLVGDVVY----------------ETALPRAGWITPVPGGVGPMTRAC
FOLD2_PSEPK      ----------DGKLVGDVVY----------------ETALPRAGWITPVPGGVGPMTRAC
FOLD_PSEAE       ----------DGRLVGDVEY----------------EVAAQRASWITPVPGGVGPMTRAC
FOLD_HAHCH       ----------DGALVGDIEF----------------NEAAERASWITPVPGGVGPMTVAT
FOLD_CHRSD       ----------DGKLAGDVEF----------------APAAARASYITPVPGGVGPMTVAS
FOLD_METFK       ----------DGSLCGDVEF----------------DIAKTRAAWITPVPGGVGPMTVAT
FOLD_NITOC       ----------DGTLTGDVEF----------------ESARQRALWITPVPGGVGPMTIAT
FOLD2_HYDCU      ----------DGSLTGDVD-----------------PRAREVAAYVTPVPGGVGPMTIAT
FOLD_THIDA       ----------DGKLVGDVDF----------------DTAVERAGWITPVPGGVGPMTVAT
FOLD_NEIMA       ----------DGSLCGDVEF----------------ETAKERAAMITPVPGGVGPMTIAT
FOLD_NEIMB       ----------DGSLCGDVEF----------------ETAKERAAMITPVPGGVGPMTIAT
FOLD_NEIG1       ----------DGSLCGDVEF----------------ETAKERAAMITPVPGGVGPMTIAT
FOLD_CHRVO       ----------TGKLCGDVEF----------------DAARERAGFITPVPGGVGPMTVAT
FOLD1_HYDCU      ----------DGSLCGDVEY----------------DVAKEKASWITPVPGGVGPMTIAT
FOLD_ALKEH       ----------SGKLTGDVDF----------------AAARELAGWITPVPGGVGPMTVAT
FOLD_XANAC       ----------DGRLVGDVGF----------------DAAAQRAAWITPVPGGVGPMTVAT
FOLD_XANC5       ----------DGRLVGDVGF----------------DAAAQRAAWITPVPGGVGPMTVAT
FOLD_XANOM       ----------DGRLVGDVGF----------------DAAAQRAAWITPVPGGVGPMTVAT
FOLD_XANOR       ----------DGRLVGDVGF----------------DAAAQRAAWITPVPGGVGPMTVAT
FOLD_XANC8       ----------DGRLVGDVGF----------------EAAAQRAGWITPVPGGVGPMTVAT
FOLD_XANCP       ----------DGRLVGDVGF----------------EAAAQRAGWITPVPGGVGPMTVAT
FOLD_XYLFA       ----------DGRLVGDVGF----------------ESAVKRASWITPVPGGVGPMTVAT
FOLD_XYLFT       ----------DGQLVGDVGF----------------ESAVKRASWITPVPGGVGPMTVAT
FOLD_ANADE       DG----------KLVGDVEF----------------AAAAARASAITPVPGGVGPMTRAM
FOLD2_MYXXD      DG----------KLVGDVEF----------------AAAAERASFITPVPGGVGPMTIAM
FOLD2_GEOMG      EK----------KLVGDVEF----------------AAASQRASAITPVPGGVGPMTITM
FOLD2_GEOSL      EK----------KLVGDVEF----------------AAAAERASAITPVPGGVGPMTITM
FOLD_MOOTA       EK----------KLVGDVHF----------------ESAAQKAGWITPVPGGVGPMTIAM
FOLD_AROAE       EGPD------AGKLCGDVDF----------------ESAKEVASLITPVPGGVGPMTITM
FOLD_DECAR       DG----------KLCGDVDF----------------ASCLEVAGQITPVPGGVGPMTITM
FOLD_BORBR       DG----------KLCGDVDM----------------ASAREVAGAISPVPGGVGPMTIAM
FOLD1_BORPE      DG----------KLCGDVDM----------------ASAREVAGAISPVPGGVGPMTIAM
FOLD1_BORPA      DG----------KLCGDVDM----------------ASAREVAGAISPVPGGVGPMTIAM
FOLD_BORA1       DG----------KLCGDVDF----------------ASAQQVAGAITPVPGGVGPMTIAM
FOLD2_BORPA      DG----------RLCGDVDY----------------GSAAKVAGAITPVPGGVGPMTIAM
FOLD2_BORPE      DG----------RLCGDVDY----------------GSAAKVAGAITPVPGGVGPMTIAM
FOLD_BURCA       AG----------KLCGDVDF----------------AGAKEVAGYITPVPGGVGPMTITM
FOLD_BURL3       AG----------KLCGDVDF----------------AGVKEVASHITPVPGGVGPMTITM
FOLD_BURP1       EG----------KLCGDVDF----------------AGVSQVAGHITPVPGGVGPMTITM
FOLD_BURPS       EG----------KLCGDVDF----------------AGVSQVAGHITPVPGGVGPMTITM
FOLD_BURMA       EG----------KLCGDVDF----------------AGVSQVAGHITPVPGGVGPMTITM
FOLD_BURTA       EG----------KLCGDVDF----------------AGVSQVAGHITPVPGGVGPMTITM
FOLD_PARXL       AG----------KLCGDVDF----------------AGVKEVAGYITPVPGGVGPMTITM
FOLD_CUPPJ       NG----------KLCGDVDF----------------AGVREVAGYITPVPGGVGPMTITM
FOLD_CUPMC       AG----------KLCGDVDF----------------AGVREVAGHITPVPGGVGPMTITM
FOLD_RALSO       AG----------KLCGDVDF----------------AGVRDVAGHITPVPGGVGPMTITM
FOLD_POLSJ       EG----------KLCGDVDF----------------EGVKEVAGYITPVPGGVGPMTITM
FOLD_RHOFT       EG----------KLCGDVDF----------------AGVKEVAGFITPVPGGVGPMTITM
FOLD_NITEU       DG----------RLCGDVEF----------------SGVKEKAGYITPVPGGVGPMTIVM
FOLD_NITMU       DG----------KLAGDVDF----------------ESVKEKAGYITPVPGGVGPMTIAM
FOLD_PSYA2       -----------NGGVGDIEL----------------QGVENIASAYTPVPGGVGPMTINT
FOLD_PSYCK       -----------NGGVGDIEL----------------QGVENIASAYTPVPGGVGPMTINT
FOLD2_ACIAD      -----------GGGVGDIQL----------------QGIEDVASAYTPVPGGVGPMTITT
FOLD_ALCBS       ------------ERCGDIEL----------------APLVDRVAAYTPVPGGVGPMTINT
FOLD_SACD2       ------------GGVGDIEL----------------APLADRAAAITPVPGGVGPMTINT
FOLD1_COLP3      ------------GGIGDIEL----------------QPLMSRVKAYTPVPGGVGPMTINT
FOLD_BACSK       ------------GNIGDCEY----------------DGCAQRASAITPVPGGVGPVTISM
FOLD_LEPIC       ------------GNIGDIEI----------------SKAKDRSSFYTPVPGGVGPMTIAV
FOLD_LEPIN       ------------GNIGDIEI----------------SKAKDRSSFYTPVPGGVGPMTIAV
FOLD1_STRAW      ------------GNVGDVDF----------------DAVLTRARLITPVPGGVGPMTIAV
FOLD2_FRACC      -----------QGLRGDVDF----------------EAVREVAGKLTPVPGGVGPMTIAM
FOLD_SYMTH       GF--------KKRIRGDVDF----------------DSVQEVAGLITPVPGGVGPMTIAM
FOLD_DEHM1       YTPE-----GKRILSGDVDF----------------EAVKEKAFAITPVPKGVGPMTIIM
FOLD_DEHMC       YTPE-----GKRILSGDVDF----------------EEVKEKAFAITPVPKGVGPMTIIM
FOLD_DESPS       TNSE----TGKAILRGDVDF----------------EAVKEIAGKITPVPGGVGPMTIAM
FOLD_LAWIP       FNED----TGKPILSGDVDF----------------VNVSQVAGKITPVPGGVGPMTIAM
FOLD_SYNAS       VTSD-----GKAKLCGDVDF----------------EPVREKAGAITPVPGGVGPMTITM
FOLD_TREDE       DSTK----KSGFRLVGDVDF----------------EPACEIASAITPVPKGVGPMTIAM
FOLD1_MYXXD      DASS----PRGYRMVGDVDF----------------DAIQPIASAITPVPGGVGPMTITM
FOLD_TREPA       DATA----PRGRRLCGDVDF----------------DAVAHKVQAITPVPGGVGPMTIAM
FOLD1_HALMA      -ADT----EKGYELVGDVEY----------------ESAKEVAGAITPVPGGVGPMTRAM
FOLD_NATPD       -ADN----EKGYELVGDVEY----------------ESATQNASAITPVPGGVGPMTRAM
FOLD2_HALMA      -ADT----EKGYELVGDVDF----------------ESAKEKADAITPVPGGVGPLTIAM
FOLD_HALSA       -ADT----EKGYELVGDVDY----------------DSAEAAASAITPVPGGVGPMTRAM
FOLD_HALWD       -TEN------GSELVGDVEF----------------ESAAKKADAITPVPGGVGPMTRAM
FOLD_SALRD       DPST----DRGYRLVGDVDF----------------EGVRPKARRITPVPGGVGLMTRAM
FOLD_RHOBA       -----------DKLVGDVAF----------------DEAEAVASAITPVPGGVGPLTIAM
FOLD_NOSS1       DA------HGKSRLVGDINF----------------ASIAGVAEYITPVPGGIGPMTVAL
FOLD_TRIV2       DA------NGKSRLVGDINF----------------ASIAGVAEYITPVPGGIGPMTVAL
FOLD_TRIEI       DE------AGNSQLVGDVQF----------------NSVAQVAEYITPVPGGIGPMTVAM
FOLD_SYNY3       LG------EGKSTLVGDVDF----------------AGVAPVASYLTPVPGGIGPMTVTL
FOLD_GLOVI       DY------EGNSRLVGDVDF----------------DSVRDVAAAITPVPRGVGPMTVTM
FOLD_SYNJA       DP------DGSEQLVGDVDY----------------EAVKERAAAITPVPGGVGPMTVTM
FOLD_SYNJB       TP------TGAEQLVGDVDY----------------EAVKELAAAITPVPGGVGPMTVTM
FOLD_THEEB       RP------DGKSSLWGDVDY----------------EAARAVASYITPVPGGVGPMTVAM
FOLD_SYNP6       --------DGR--LVGDVDY----------------EAASAITSWITPVPGGVGPMTVAM
FOLD_SYNE7       --------DGR--LVGDVDY----------------EAASAITSWITPVPGGVGPMTVAM
FOLD_PROM9       SSDK-----NKTRLCGDVLL----------------EDVIPKVLAYTPVPGGVGPMTVTM
FOLD_PROMP       SSDK-----SKTRLCGDVLL----------------EDVIPKVFAYTPVPGGVGPMTVTM
FOLD_SYNS9       ----------EGGLCGDVRA----------------AEVEPIAAALSPVPGGVGPMTVTM
FOLD_SYNSC       ----------EGGLCGDVRA----------------AEVESIAAALSPVPGGVGPMTVTM
FOLD_SYNPX       ----------EGGLCGDVVA----------------EEVEPIAAALSPVPGGVGPMTVTM
FOLD_SYNS3       ----------EGGLCGDVCA----------------EELEPVAAALSPVPGGVGPMTVTM
FOLD_PROMM       LDPE-LGTQAKARLCGDVRT----------------QEVEPLASALTPVPGGVGPMTVTM
FOLD_PROMA       MEPL-KLTGSNYKLCGDVRA----------------EEIYSKIKAITPVPGGVGPMTVAM
FOLD_PROMT       PDEENMKELKKTKLCGDVKI----------------FEIEDKVAAYSPVPGGVGPMTVTM
FOLD_DESAG       -----------NGLAGDVDF----------------GPVSKVASAITPVPGGIGPMTIAQ
FOLD_DESVH       -----------TGLAGDCDF----------------EGVSRVASAITPVPGGVGPMTIAQ
FOLD_THET2       G-----------RLLGDV-----------------HPEVAEVASALTPVPGGVGPMTVAM
FOLD_THET8       G-----------RLLGDV-----------------HPEVAEVAFALTPVPGGVGPMTVAM
FOLD2_DEIGD      GEGG-----GKAQLTGDV-----------------APEVAQVAGAITPVPGGVGPMTIAQ
FOLD1_RUBXD      D----------GGLTGDVR----------------QEEVAARAAALTPVPGGVGPMTRAM
FOLD_KORVE       DRAE-----FEKFFAGDAKREAAFAKNGSTLVGDCHPKVAEVAGAFTPVPGGVGPLTIAM
FOLD_COREF       D----------GKLLGDV-----------------HPDVWEVAGAVSPNPGGVGPLTRAF
FOLD_CORGL       D----------GKLLGDV-----------------HPDVWEVAGAVSPNPGGVGPLTRAF
FOLD_CORJK       D----------GKLKGDV-----------------HPDVWDVAGAVSPNPGGVGPLTRAF
FOLD_CORDI       D----------GKLLGDV-----------------HPDVWDVAGAVSPNPGGVGPLTRAF
FOLD_MYCBO       -----------DGLVGDV-----------------HPDVWELAGHVSPNPGGVGPLTRAF
FOLD_MYCTU       -----------DGLVGDV-----------------HPDVWELAGHVSPNPGGVGPLTRAF
FOLD_MYCPA       -----------GKLAGDV-----------------HPDVWEVAGHVSPNPGGVGPLTRAF
FOLD_MYCLE       -----------TRLVGDV-----------------HPDVWEVAGHVSPNPGGVGPLTRVF
FOLD_MYCFO       -----------GKLTGDV-----------------APDVWEVAGHVSPNPGGVGPLTRAF
FOLD_MYCSS       N----------GKLVGDV-----------------APDVWEVAGHVSPNPGGVGPLTRAF
FOLD2_RHOJR      -----------DGLRGDV-----------------AADVAEVAGFLSPNPGGVGPLTRAF
FOLD2_STRAW      E----------GKIVGDV-----------------HPGVAEVAGWISPNPGGVGPMTRAQ
FOLD_STRCO       E----------GKIMGDV-----------------HPGVAEVAAWISPNPGGVGPMTRAQ
FOLD_THEFY       K----------G-LVGDV-----------------APDVAEVAGYLSPNPGGVGPMTRAM
FOLD_CUTAK       E----------GKIQGDF-----------------TADVWEKAAWVSPNPGGVGPMTRAM
FOLD_LEIXX       DPET-----GKSRVAGDV-----------------AADVAGVASWISPNPGGVGPMTRAL
FOLD_BIFLO       DEEA-----GRYRIKGDV-----------------DKACYDKASAYTPNPGGVGPMTRAM
FOLD_PELCD       R-----------KLLPDV-----------------DEAVGEVAGWITPRLGGVGPTTVAM
FOLD_TROW8       VSSS-----GKMILTGDV-----------------HPLTKNIASYISPVVGGVGPMTRAM
FOLD_TROWT       VSSS-----GKMILTGDV-----------------HPLTKNIASYISPVVGGVGPMTRAM
FOLD_BDEBA       Q---------GGKLCGDVRF----------------EELDGWAKAATPVPGGVGPMTIAM
FOLD_LACAC       -----------GKLVGDVDF----------------ENVKKKASYITPVPGGVGPLTVQF
FOLD_LACDA       -----------GHLVGDVDF----------------APVKEKASWITPVPGGVGPLTVEF
FOLD2_LACJO      -----------GKLMGDVDF----------------DMVAPKAKAITPVPGGVGPLTVAS
FOLD_METHJ       -----------GKLCGDVAF----------------DEVEKIAGAITPVPGGVGPMTIAS
FOLD_CLOD6       E----------GNLCGDVD----------------TNAVLDKVSMITPVPAGVGSVTTSI
FOLD1_DESHY      D----------GKICGDVD----------------YDAVVDKVKAITPVPGGVGSVTTTI
FOLD_CARHZ       DNP--------GKYCGDVD----------------FDKVEPIVDKITPVPGGVGSVTTAV
FOLD_CLOAB       G-----------KLRGDVV----------------FDEVIKKAAYVTPVPGGVGAMTTTM
FOLD_CLOTE       G-----------KMVGDID----------------YDNVFKKAGFITPVPGGVGSVTPTM
FOLD_CLOP1       G-----------KITGDVN----------------FDDVYEKASLITPVPGGVGSLTTTL
FOLD_CLOPE       G-----------KITGDVN----------------FDDVYDKASLITPVPGGVGSLTTTL
FOLD_CLOPS       G-----------KITGDVN----------------FDDVYEKASLITPVPGGVGSLTTTL
FOLD2_SYNWW      N----------GKMLGDV-----------------HEEARNHCRLASAVPGGIGVITVAE
FOLD2_DESHY      G-----------GICGDVD----------------FEEVKEVASLISPVPGGVGSLTTAL
FOLD_CALS4       G-----------KIYGDAD----------------FESIKDKASYVTPVPGGVGPVTTAM
FOLD_METAC       D-----------GVYGDVD----------------FENVIKKASLVTPVPGGVGPMTIAM
FOLD_METMA       D-----------GVYGDVD----------------FENVIKKASLITPVPGGVGPLTVAM
FOLD_METBF       D-----------GVYGDVD----------------FENVIKKAALITPVPGGVGPLTVAM
FOLD_METBU       G-----------KVYGDVD----------------FENVIKKASRVTPVPGGVGPVTIAT
FOLD1_SYNWW      G-----------GVCGNVDRA--------------ALERQGFEARLLPVPGGMGPILIAK
FOLD2_RUBXD      DPGG----SGRTLLVGDLDF----------------GSVARKAEALTPVPGGVGPITDVW
FOLD3_RUBXD      DPGG----SGRTLLVGDLDF----------------GSVARKAEALTPVPGGVGPITDVW
FOLD_NOCFA       ---------EDGGIVGDVDA----------------ESVRGKAAGLSPVPGGVGPVTTAL
FOLD1_RHOJR      ---------ADGQLLGDVDA----------------AAVDGRAGALTPVPGGVGPVTTAL
FOLD_ARTGO       ---------SDGSLTGDVDE----------------ASVRPVAAALTPVPGGVGSVTTAL
FOLD1_FRACC      ---------ETG-QVGDVDA----------------AAVSSVAGALTPVPGGVGPVTTML
FOLD3_ROSDO      EAD------GNTRIVGDVDT----------------DAVKEIAGWVTPVPGGVGPVTVAI
FOLD2_RUEPO      GPD------G-PVVVGDVQT----------------DAVKDVAGWITPVPGGVGLVTVAI
FOLD_RHOCB       DAA------GKVRILGDVDT----------------EAVREVAGWITPVPGGVGPVTVAM
FOLD2_RHILO      GPD------GTSRIVGDVDT----------------DSVKDVASWITPVPGGVGPITVAI
FOLD_PYRAE       AT---------KRWFFDVDE----------------KSVAEKASYLTPNIGGVGLATRAR
FOLD_THEAC       ----------NDKVVGDANF----------------EDLSEYVEAITPVPGGVGPITATN
FOLD_THEVO       ----------QDKVIGDIDF----------------DKVSEKVEAVTPVPGGVGPITATN
FOLD_PICTO       ----------NGKTCGDADY----------------ENIKDYVNAITPVPGGVGPVTATD
FOLD_THEMA       ----------DGKLQGDVD------------------PSVEEIARVTPVPGGVGQVTTAL
FOLD1_DEIGD      ----------PGGVVGDAV-------------------PDLPVRAQTPVPGGVGPLTSAL
FOLD_DEIRA       ----------SGDMVGDAL-------------------PELPVRAQTPVPGGVGPLTSAL
FOLD_MYCPE       ----------DGKVVGDAA-----------------KDLQEYVKYITPVPNGVGRLTVAM
FOLD_BORBU       TDN-------GKILSGDTDF----------------DNIKECVKFITPVKGGIGPVTVLM
FOLD_BORBP       TDN-------GKILSGDTDF----------------DNIKDCVKFITPVKGGIGPVTVLM
FOLD_BORAP       TDA-------GKILSGDTDF----------------DNIKDCVKFITPVKGGIGPVTVLM
FOLD_MYCMO       ENDKM-------IVTGDVDF----------------SNVKTKVKAISPVPGGVGPMTVIS
FOLD_MYCPU       NK-----------IYGDLDI----------------ESIKEKALKYTPPIGAIGPVTVLS
FOLD_MYCS5       NDPS--------VIFGDVDH----------------ESVKTKASAITPVPGGVGPLTVVC
FOLD_MYCGE       Q----------NKLCGDINP----------------EGIEKKARWWTKTPGGVGPFTVLA
FOLD_MYCPN       L----------NKLCGDIDP----------------NGIEKVAKWWSPTPGGVGPFTVLA
FOLD_MYCGA       DPEQ-----SKYLICGDFDY----------------DKLKEIASYGTPTPGGIGPLTIYS
                                 :                                  .:*      

FOLD_BACSU       LAHNTVKSAKRTLS------------------------------
FOLD_BACLD       LAHNTVKSAKRTIQL-----------------------------
FOLD_BACCZ       LLHNTVESAKRAGVVCK---------------------------
FOLD_BACHK       LLHNTVESAKRAGVVCK---------------------------
FOLD_BACAN       LLHNTVESAKRAGVVCK---------------------------
FOLD_BACC1       LLHNTVESAKRAGVVCK---------------------------
FOLD_BACCR       LLHNTVESAKRAGVVCK---------------------------
FOLD_GEOKA       LLHNTIEAARQLAAK-----------------------------
FOLD_BACHD       LLANTIQAAKE---------------------------------
FOLD_OCEIH       LLKNTIKAAKGLNDVER---------------------------
FOLD_LISMF       LLANTLKAAKRIWKMN----------------------------
FOLD_LISMO       LLANTLKAAKRIWKMN----------------------------
FOLD_LISIN       LLANTLKAAKRIWKMN----------------------------
FOLD_STAA3       VLNNTLLAEKMRRGIDS---------------------------
FOLD_STAAC       VLNNTLLAEKMRRGIDS---------------------------
FOLD_STAAS       VLNNTLLAEKMRRGIDS---------------------------
FOLD_STAAW       VLNNTLLAEKMRRGIDS---------------------------
FOLD_STAA8       VLNNTLLAEKMRRGIDS---------------------------
FOLD_STAAM       VLNNTLLAEKMRRGIDS---------------------------
FOLD_STAAN       VLNNTLLAEKMRRGIDS---------------------------
FOLD_STAAB       VLNNTLLAEKMRRGVDS---------------------------
FOLD_STAAR       VLNNTLLAEKMRRGIDS---------------------------
FOLD_STAHJ       VLNNTLLAEKMRRGIE----------------------------
FOLD_STAEQ       VLNNTLLAEKLRRGLTK---------------------------
FOLD_STAES       VLNNTLLAEKLRRGLTK---------------------------
FOLD_STAS1       VLNNTLIAEKMRRGIE----------------------------
FOLD_STRTR       LMEQTYQAALRSLKG-----------------------------
FOLD_STRT1       LMEQTYQAALRSLKG-----------------------------
FOLD_STRT2       LMEQTYQAALRSLKG-----------------------------
FOLD_STRA1       LLEQTYQAALRSVSL-----------------------------
FOLD_STRA3       LLEQTYQAALRSVSL-----------------------------
FOLD_STRA5       LLEQTYQAALRSVSL-----------------------------
FOLD_STRMU       LLEQTYQAALRSVTK-----------------------------
FOLD_STRP8       LLEQTYQSALRSTHK-----------------------------
FOLD_STRPM       LLEQTYQSALRSTHK-----------------------------
FOLD_STRP1       LLEQTYQSALRSTHK-----------------------------
FOLD_STRP3       LLEQTYQSALRSTHK-----------------------------
FOLD_STRP6       LLEQTYQSALRSTHK-----------------------------
FOLD_STRPB       LLEQTYQSALRSTHK-----------------------------
FOLD_STRPC       LLEQTYQSALRSTHK-----------------------------
FOLD_STRPD       LLEQTYQSALRSTHK-----------------------------
FOLD_STRPF       LLEQTYQSALRSTHK-----------------------------
FOLD_STRPN       LMEQTYQAALRTLDRK----------------------------
FOLD_STRR6       LMEQTYQAALRTLDRK----------------------------
FOLD_ENTFA       LMYQTVEAAKKQK-------------------------------
FOLD_LACLA       LMEQTVRAASRKMNENK---------------------------
FOLD_LACS1       LMKQTVELAERSVAGE----------------------------
FOLD1_LACJO      LMQQTVDLAEWNK-------------------------------
FOLD_LACPL       LMQTTVELAKWSDVSE----------------------------
FOLD_LACSS       LMEQTIEIAKERVKRG----------------------------
FOLD_RICCN       LLKNTVKAFKDSLYTLDT--------------------------
FOLD_RICFE       LLKNTVKAFKDSYSTVCHSCL-----------------------
FOLD_RICPR       LLKNTVKAFKNAIAL-----------------------------
FOLD_RICTY       LLKNTVKAFKNAIAL-----------------------------
FOLD_RICBR       LLKNTVQAFKIYS-------------------------------
FOLD_PELUB       LLKNTIECFKRSQK------------------------------
FOLD_ANAMM       LLVNTVLGSCKQCGV-SYEDIKSSLLQ-----------------
FOLD_ANAPZ       LLVNTVLGACRQKGIKQYKNIKSSVLQ-----------------
FOLD_EHRCJ       LMVNTVMAACNQSGIENFVEKYLDL-------------------
FOLD_EHRCR       LMVNTVIAACNQAGIENFVEKYLDL-------------------
FOLD_EHRRG       LMVNTIIAACNQSGIHGFLEKYLDL-------------------
FOLD_EHRRW       LMVNTIIAACNQSGIDGFLEKYLDL-------------------
FOLD_WOLPM       LMMNTVIAACLQKGVD--ASDFIS--------------------
FOLD_WOLTR       LMINTVIAACLQKKVD--ASDFVS--------------------
FOLD_NEOSM       LMLNTVITTCLQNKLEHQEVIGTVIQKL----------------
FOLD2_PSE14      LMKNTVTAARQQALAQRSQSEAVCLSTC----------------
FOLD2_PSESM      LMKNTVTAARQQAHAQRSQSEAVCLSIY----------------
FOLD2_PSEU2      LMKNTVTAARQQAHAQRSQPEAVCLSTY----------------
FOLD1_ACIAD      LMKNTLQAVRLQHPQI----------------------------
FOLD_GLUOX       LLHNTLQAARATQAVADASS------------------------
FOLD1_PSEPK      LLANTLQAARAAVRLR----------------------------
FOLD_SPHCR       LAAEYVQAARRRAWCWRRTNRHSFSLEGEGYGALLSGAKLGAVG
FOLD_METC4       LMENTVACAEALAIRAPEVMSPDNRLHFDHADV-----------
FOLD1_RHIEC      LMANTVIAAHRAAGQTPPQF------------------------
FOLD2_RHIEC      LMANTVIAAHRAAGQVPPKF------------------------
FOLD_RHIL3       LMANTVIAAHRTAGQTPPQF------------------------
FOLD_RHILT       LMANTVIAAHRTAGQTPPQF------------------------
FOLD2_RHIME      LMANTIIAACRMAGRKPPKF------------------------
FOLD1_RHIME      LMANSVIAAHRASGLKVSERLSKLISG-----------------
FOLD_AGRFC       LMANTVIAAHRALGKTAPKF------------------------
FOLD_BARHE       LMVNTLKAAARLHNLPIPKF------------------------
FOLD_BARQU       LMVNTLNAAARLYNLPVLKL------------------------
FOLD_BRUA2       LMANTLTAACRSAGMKKPVF------------------------
FOLD_BRUAB       LMANTLTAACRSAGMKKPVF------------------------
FOLD_BRUME       LMANTLTAACRSAGMKKPVF------------------------
FOLD_BRUSU       LMANTLTAACRSAGMKKPVF------------------------
FOLD1_RHILO      LMANTLASAYLAAGLKRPTF------------------------
FOLD_CHESB       LMANTLAAASKASGRDLPAF------------------------
FOLD_SINFN       LMANTLRAACHANDEPAPHFGSGGVLR-----------------
FOLD_NITHX       LLVNTLRAACAIKGLPAPGV------------------------
FOLD_NITWN       LLVNTLRAACAIEGLSAPGV------------------------
FOLD_BRADU       LLVNTLRAACAIAGLPKPAV------------------------
FOLD_RHOP2       LLVNTVRAASAIHGLPKPAV------------------------
FOLD_RHOPS       LLVNTVRAASAIHGLPKPGV------------------------
FOLD_RHOPB       LLVNTLRAACAIHGLPKPAV------------------------
FOLD_RHOPA       LLVNTVRAACAIHGLPKPAV------------------------
FOLD2_ROSDO      LLANTVTSCCRANGLEEPTGLTA---------------------
FOLD_RUEST       LLANTVTACCRANNLSEPEGLTA---------------------
FOLD1_ROSDO      LLANTVTACCRANGLEEPEGLTA---------------------
FOLD1_RUEPO      LLANTLTACTRANKLTEPDGLTP---------------------
FOLD_RHOS4       LLANTLTACCRANGLPEPQGLTA---------------------
FOLD_JANSC       LLANTVTACCRAHGLDEPRGLTA---------------------
FOLD_MAGSA       LLRNTLVACARLHKLPEVEF------------------------
FOLD_NOVAD       LLRNALVAAYRNAGIDLSADAI----------------------
FOLD_SPHAL       LLRNTLVAAHRRAGLADPEGF-----------------------
FOLD_CAUVC       LLANTLTAAKRLSGIA----------------------------
FOLD_ZYMMO       LLNNTVQAARNLTSAS----------------------------
FOLD_RHORT       LLANTLEACKARGAGA----------------------------
FOLD_HYPNA       LLRNTVLAACARRGWTVPEGL-----------------------
FOLD_MARMM       LLKNTVIAAALRAKQPALADF-----------------------
FOLD_CHLTR       LMRNTWESFLRHTS------------------------------
FOLD_CHLTA       LMRNTWESFLRHTS------------------------------
FOLD_CHLMU       LMRNTWESFLRHTL------------------------------
FOLD_CHLAB       LMKNTWESYQKFSS------------------------------
FOLD_CHLCV       LMKNTWESYKKSSS------------------------------
FOLD_CHLFF       LMKNTWESYQKSSS------------------------------
FOLD_CHLPN       LMSNTWRCYQNFS-------------------------------
FOLD_PARUW       LLYNTLLSYSKSQNLNL---------------------------
FOLD_BACFN       LMKNTLLAGKKAIYQ-----------------------------
FOLD_BACFR       LMKNTLLAGKKAIYQ-----------------------------
FOLD_BACTN       LMKNTLLAGKKAIYK-----------------------------
FOLD_PORGI       LMSNTLLASK-GLYR-----------------------------
FOLD_CYTH3       LLMNTLQAAALK--------------------------------
FOLD1_GEOMG      LMINTLMAYQNNFDLV----------------------------
FOLD1_GEOSL      LMINTLMAYQNNFNLA----------------------------
FOLD_CHLCH       LLKNTVQSFQRVNGL-----------------------------
FOLD_PELLD       LLKNTLHSFERANGL-----------------------------
FOLD_HELPY       LLENTLIA--FEKQQRKGF-------------------------
FOLD_HELPH       LLENTLIA--FEKQQRKGF-------------------------
FOLD_HELPJ       LLENTLIA--FEKQQRKGF-------------------------
FOLD_HELHP       LLQNTYKAAMYRLEQRMRV-------------------------
FOLD_SULDN       LLSNTLKAAKAHAKENE---------------------------
FOLD_WOLSU       LLENTLKAAKTRQETPQS--------------------------
FOLD_CAMJE       LLENTVKSAKNRLN------------------------------
FOLD_CAMJR       LLENTVKSAKNRLN------------------------------
FOLD_AQUAE       LLLNTLKSYKRKFAHLISTTNP----------------------
FOLD_FUSNN       LLSNILKSFKANRGII----------------------------
FOLD_FRAT1       LLYNTFQCAQELNR------------------------------
FOLD_FRATT       LLYNTFQCAQELNR------------------------------
FOLD_FRATH       LLYNTFQCAQELNR------------------------------
FOLD_FRATO       LLYNTFQCAQELNR------------------------------
FOLD_MYCCT       LLENTLQLYKKHIKE-----------------------------
FOLD_MYCMS       LLENTFKLYKLHIKENYEN-------------------------
FOLD_MESFL       LMENTFVLYEKHINKSK---------------------------
FOLD_SPICI       LLENILYFYQLNQKI-----------------------------
FOLD_BUCAI       LLQNTLEACENHDDI-----------------------------
FOLD_BUCAP       LLENTLEACEKYHEF-----------------------------
FOLD_BUCBP       LLNNTLKAYEQISKDCK---------------------------
FOLD_BLOFL       LIQNTLQAYHAHVCCDSKKKIHFKKF------------------
FOLD_BLOPB       LIQNTLQAYDDHHLVR----------------------------
FOLD_WIGBR       LIENTMQIYINNY-------------------------------
FOLD_ECOLI       LIENTLQACVEYHDPQDE--------------------------
FOLD_SHIDS       LIENTLQACVEYHDPQDE--------------------------
FOLD_SHIFL       LIENTLQACVEYHDPQGE--------------------------
FOLD_SHISS       LIENTLQACVEYHDPQGE--------------------------
FOLD_SHIBS       LIENTLQACVEYHDPQGE--------------------------
FOLD_ECO57       LIENTLQACVEYHDPQGE--------------------------
FOLD_ECOL5       LIENTLQACVEYHDPQGE--------------------------
FOLD_ECOL6       LIENTLQACVEYHDPQGE--------------------------
FOLD_ECOUT       LIENTLQACVEYHDPQGE--------------------------
FOLD_SALTY       LIENTLQACIEYHDPQGK--------------------------
FOLD_SALCH       LIENTLQACIEYHDPQGK--------------------------
FOLD_SALPA       LIENTLQACIEYHDPQGK--------------------------
FOLD_SALTI       LIENTLQACIEYHDPQGK--------------------------
FOLD_PHOLL       LIQNTLQACEEYHDVERIEGC-----------------------
FOLD_YERPA       LIQNTLQACEEYHDISQN--------------------------
FOLD_YERPE       LIQNTLQACEEYHDISQN--------------------------
FOLD_YERPN       LIQNTLQACEEYHDISQN--------------------------
FOLD_YERPS       LIQNTLQACEEYHDISQN--------------------------
FOLD_PECAS       LIQNTLQACEEYHDHAE---------------------------
FOLD_SODGM       LIQNTLQACEDYHDTTMPEA------------------------
FOLD_BAUCH       LIQNTLQAC-KYRKLS----------------------------
FOLD_PHOPO       LIENTLLACEQYHSA-----------------------------
FOLD_PHOPR       LIENTLLACEQYHSD-----------------------------
FOLD_VIBVU       LIENTMLACEQYHTK-----------------------------
FOLD_VIBVY       LIENTMLACEQYHTK-----------------------------
FOLD_VIBPA       LIENTMLACEQFHTEQ----------------------------
FOLD_VIBCH       LIENTMMACEQFHTQG----------------------------
FOLD_ALIF1       LIENTLLACEQYHSK-----------------------------
FOLD_PSEHT       LIENTLEACEKYHS------------------------------
FOLD_IDILO       LIENTLQACVDYHDVR----------------------------
FOLD_PSEA6       LIENTLEAYVKYHSN-----------------------------
FOLD_SHEDO       LLENTLYAAETYHDVN----------------------------
FOLD_SHEFN       LLENTLYACEQYHS------------------------------
FOLD_SHESM       LLENTLYAAEQYHD------------------------------
FOLD_SHESR       LLENTLYAAEQYHD------------------------------
FOLD_SHEON       LLENTLYAAEQYHD------------------------------
FOLD2_COLP3      LIENTLIACQQSSQ------------------------------
FOLD_HAEIN       LMSNTLYAYEHNK-------------------------------
FOLD_HAEI8       LMSNTLYAYEHNK-------------------------------
FOLD_HAES1       LMFNTLLAYESHS-------------------------------
FOLD_PASMU       LMFNTLSAYEMKIAS-----------------------------
FOLD_MANSM       LMFNTLTAYENNG-------------------------------
FOLD_HAEDU       LMQNTLQAYEHHLQAV----------------------------
FOLD_COXBU       LLENTLQAAQTFL-------------------------------
FOLD_LEGPH       LLENTMMSAARLRE------------------------------
FOLD_LEGPL       LLENTMMSAARLRE------------------------------
FOLD_LEGPA       LLENTMMSAARLRE------------------------------
FOLD1_PSE14      LLENTLYAAETLHD------------------------------
FOLD1_PSESM      LLENTLYAAETLHD------------------------------
FOLD1_PSEU2      LLENTLYAAETLHD------------------------------
FOLD_PSEF5       LLENTLYAAESLHS------------------------------
FOLD_PSEPF       LLENTLYAAETLHA------------------------------
FOLD2_PSEPK      LLENTLYAAEELHK------------------------------
FOLD_PSEAE       LLENTLHAAEHLHD------------------------------
FOLD_HAHCH       LMENTLYAANHLHKD-----------------------------
FOLD_CHRSD       LLENTLFAAELHDGMHA---------------------------
FOLD_METFK       LMQNTLTALELGESDQAPA-------------------------
FOLD_NITOC       LLQNTLYATEKLHE------------------------------
FOLD2_HYDCU      LLENTLKACEIHQLGAVS--------------------------
FOLD_THIDA       LLENTLEAALMHNP------------------------------
FOLD_NEIMA       LMENTLHAASLHDA------------------------------
FOLD_NEIMB       LMENTLHAASLHDA------------------------------
FOLD_NEIG1       LMENTLHAASLHDA------------------------------
FOLD_CHRVO       LLQNTLDSANLNA-------------------------------
FOLD1_HYDCU      LLQNTLQAAYGVKA------------------------------
FOLD_ALKEH       LMANTLAAAEARDSRA----------------------------
FOLD_XANAC       LMQNTIEAADAAGIQDSGFGIR----------------------
FOLD_XANC5       LMQNTIEAADAAESGDSGLGIG----------------------
FOLD_XANOM       LMQNTIEAADAAGIEGAGVGIR----------------------
FOLD_XANOR       LMQNTIEAADAAGIEGAGVGIR----------------------
FOLD_XANC8       LMQNTLEAADAAG-------------------------------
FOLD_XANCP       LMQNTLEAADAAG-------------------------------
FOLD_XYLFA       LMQNTLEAAEAADC------------------------------
FOLD_XYLFT       LMQNTLEAAEATDC------------------------------
FOLD_ANADE       LLVNTVELAKRVAR------------------------------
FOLD2_MYXXD      LMRNTLDAAVRYGLVPVVR-------------------------
FOLD2_GEOMG      LLYNTLEAAKKTGEGNR---------------------------
FOLD2_GEOSL      LLHNTLEAAKMAGSGNR---------------------------
FOLD_MOOTA       LLKNTVEAARR---------------------------------
FOLD_AROAE       LLANTVESAERVARSKG---------------------------
FOLD_DECAR       LLANTIEAAERKAGL-----------------------------
FOLD_BORBR       LLVNTVEAAERAAA------------------------------
FOLD1_BORPE      LLVNTVEAAERAAA------------------------------
FOLD1_BORPA      LLVNTVEAAERAAA------------------------------
FOLD_BORA1       LMVNTLQAAERTLTP-----------------------------
FOLD2_BORPA      LLANTVEAAERSAI------------------------------
FOLD2_BORPE      LLANTVEAAERSAI------------------------------
FOLD_BURCA       LLINTIESAERAAAAA----------------------------
FOLD_BURL3       LLINTIEAAERAADAAA---------------------------
FOLD_BURP1       LLVNTIEAAERAAAAA----------------------------
FOLD_BURPS       LLVNTIEAAERAAAAA----------------------------
FOLD_BURMA       LLVNTIEAAERAAAAA----------------------------
FOLD_BURTA       LLVNTIEAAERAAAAA----------------------------
FOLD_PARXL       LLVNTIEAAEREAAANA---------------------------
FOLD_CUPPJ       LLINTLEAAERAAG------------------------------
FOLD_CUPMC       LLINTLEAAEREAGIA----------------------------
FOLD_RALSO       LLINTLEAAERAAEDAALAA------------------------
FOLD_POLSJ       LLVNTLESAERL--------------------------------
FOLD_RHOFT       LLVNTLEAAERTVK------------------------------
FOLD_NITEU       LMNNTIEAAERAKAVALAGGWHSSVQ------------------
FOLD_NITMU       LLCNTVVAAEQAHARLQGN-------------------------
FOLD_PSYA2       LIRQTVDAAEKSAGL-----------------------------
FOLD_PSYCK       LIRQTVDAAEKAAGLDNS--------------------------
FOLD2_ACIAD      LIRQTVEAAEKALA------------------------------
FOLD_ALCBS       LIFQTLQSGEKAFG------------------------------
FOLD_SACD2       LIYQTVDSAQKKLG------------------------------
FOLD1_COLP3      LIYQTVEACELKLAQ-----------------------------
FOLD_BACSK       LLKHTVEAAERSV-------------------------------
FOLD_LEPIC       LLLQTLYSAKEHFTPPVK--------------------------
FOLD_LEPIN       LLLQTLYSAKEHFTPPVK--------------------------
FOLD1_STRAW      LLEQTVDAAANQLGVQQ---------------------------
FOLD2_FRACC      LLRNTLLAAQAATGTDGPG-------------------------
FOLD_SYMTH       LMANTVKAARMQTGR-----------------------------
FOLD_DEHM1       LMLNTLTAAKRAAGLVK---------------------------
FOLD_DEHMC       LMLNTLTAAKRAVGLIK---------------------------
FOLD_DESPS       LMKNTLASALAHSS------------------------------
FOLD_LAWIP       LMRNTVRSAFFHLSL-----------------------------
FOLD_SYNAS       LMVNTLKAARLSAGL-----------------------------
FOLD_TREDE       LVANTLIAAKRQNGLE----------------------------
FOLD1_MYXXD      LLANTLQAARQTQAR-----------------------------
FOLD_TREPA       LLHNTLCAAEYAAGMIPPFRAALYADLDGRAAGDVPH-------
FOLD1_HALMA      LLYNTVKATGLQHDIDVDLP------------------------
FOLD_NATPD       LLYNTVKAASLQEDIDVALP------------------------
FOLD2_HALMA      LLYNTVKAASLQSGVDIRLP------------------------
FOLD_HALSA       LLYNTLAAASEQTGVAVALP------------------------
FOLD_HALWD       LLWNTVKATAIATDTSIELP------------------------
FOLD_SALRD       LLKNTLKAARLRATSA----------------------------
FOLD_RHOBA       LLHNTLMAAKMQAASN----------------------------
FOLD_NOSS1       LLQNTVTSYLQTAKESGALDVK----------------------
FOLD_TRIV2       LLQNTVTSYLQTAKESGALDVK----------------------
FOLD_TRIEI       LLQNTVERWSTLVE------------------------------
FOLD_SYNY3       LLANTVASYRQRLGI-----------------------------
FOLD_GLOVI       LLANTVQSYKQRLIE-----------------------------
FOLD_SYNJA       LLANTLESYKLRSHL-----------------------------
FOLD_SYNJB       LLANTLQSYKLRSHLCSHY-------------------------
FOLD_THEEB       LLHNTVWSYCRRHNWQQPLLSLTSMPPAP---------------
FOLD_SYNP6       LLHNTVLSYCRRSG--QPFLS-----------------------
FOLD_SYNE7       LLHNTVLSYCRRSG--QPFLS-----------------------
FOLD_PROM9       LLVNTIFSWQKQFGLSSTLNDLLP--------------------
FOLD_PROMP       LLVNTIFSWQKQFGLSSTLNDLLP--------------------
FOLD_SYNS9       LLVNTVVAWCRRHGVDHDLADLLS--------------------
FOLD_SYNSC       LLVNTVVAWCRRHNLDHDLDDLVP--------------------
FOLD_SYNPX       LLVNTVVAWCRRHGIDHELDDLIG--------------------
FOLD_SYNS3       LLVNTVLAWCRRHQVALELSDLVV--------------------
FOLD_PROMM       LLVNTVARWQQHCGLPFGLRDLLV--------------------
FOLD_PROMA       LMVNTVNRWQYHCGLSSTLSDLLP--------------------
FOLD_PROMT       LLANTVDRWQKHCGLPLTISHLLP--------------------
FOLD_DESAG       LLVNTVASWKKRCGV-----------------------------
FOLD_DESVH       LLVNTVQSWKVRCGL-----------------------------
FOLD_THET2       LMGNTLEAALLRRHGASG--------------------------
FOLD_THET8       LMGNTLEAALLRRHGASG--------------------------
FOLD2_DEIGD      LLANTVLAAELQAKGRAAR-------------------------
FOLD1_RUBXD      LLYNTLEAARLREERA----------------------------
FOLD_KORVE       LMANTVKAAKLRRGNTV---------------------------
FOLD_COREF       LVHNVVERAEKLAGL-----------------------------
FOLD_CORGL       LVHNVVERAEKLAGL-----------------------------
FOLD_CORJK       LVRNVVERAEKLLRA-----------------------------
FOLD_CORDI       LIRNVVERAERA--------------------------------
FOLD_MYCBO       LLTNVVELAERR--------------------------------
FOLD_MYCTU       LLTNVVELAERR--------------------------------
FOLD_MYCPA       LLTNVVELAERE--------------------------------
FOLD_MYCLE       LLTNVVELAEGRQ-------------------------------
FOLD_MYCFO       LLTNVVELEESKLA------------------------------
FOLD_MYCSS       LLTNVVERAEALARG-----------------------------
FOLD2_RHOJR      LLTNVVERAERVAASLG---------------------------
FOLD2_STRAW      LLVNVVEAAERSVG------------------------------
FOLD_STRCO       LLVNVVEAAERSAG------------------------------
FOLD_THEFY       LLTNVVEAAERSLS------------------------------
FOLD_CUTAK       LLSNVVDRAERLTADPS---------------------------
FOLD_LEIXX       LLQNVVESAERALR------------------------------
FOLD_BIFLO       LLANVVEMAERHA-------------------------------
FOLD_PELCD       LLLNTVQAAEERARRAGKL-------------------------
FOLD_TROW8       LMSNVINLSERDFRKRLYAS------------------------
FOLD_TROWT       LMSNVINLSERDFRKRLYAS------------------------
FOLD_BDEBA       LLKNTCQLAEQRARDPQF--------------------------
FOLD_LACAC       LMEAVVKLTRRQNGRE----------------------------
FOLD_LACDA       LMEEVIKLTRRQHGLD----------------------------
FOLD2_LACJO      LMKQAVILTRKQHGR-----------------------------
FOLD_METHJ       LMENTADIARNRCGHFM---------------------------
FOLD_CLOD6       LAKHVVKACKLQNNK-----------------------------
FOLD1_DESHY      LLNNLVRACKSQ--------------------------------
FOLD_CARHZ       LCKHTVKACEILNGLV----------------------------
FOLD_CLOAB       LILNVCEALK----------------------------------
FOLD_CLOTE       LIKNLCEVFK----------------------------------
FOLD_CLOP1       LLKNVCKELD----------------------------------
FOLD_CLOPE       LLKNVCKELD----------------------------------
FOLD_CLOPS       LLKNVCKELD----------------------------------
FOLD2_SYNWW      LFDNLRILSQKA--------------------------------
FOLD2_DESHY      IMKNVLKGITLQRKEGQ---------------------------
FOLD_CALS4       ILKNTLEAFKYAVKSL----------------------------
FOLD_METAC       LMKHVLLCAEKSL-------------------------------
FOLD_METMA       LMKHVLMCAEKSL-------------------------------
FOLD_METBF       LMKHVLGCAETNY-------------------------------
FOLD_METBU       LMQHVLMSAQKTA-------------------------------
FOLD1_SYNWW      LMENLAQAARQKR-------------------------------
FOLD2_RUBXD      LLKNTVAAGRGLAFRARSGGE-RGAPGISGGYGGQ---------
FOLD3_RUBXD      LLKNTVAAGRGLASQAKARCLLRGSHAHSSLI------------
FOLD_NOCFA       LMRHVVEAAERHRG------------------------------
FOLD1_RHOJR      LLNHTVDAAGTQYAQTRSESVLAGFRSSV---------------
FOLD_ARTGO       LLLHTAEAAREQSRATSAPVLTR---------------------
FOLD1_FRACC      LLRNTIRAARAA--------------------------------
FOLD3_ROSDO      LMRNAVRAHERQKAAGWYA-------------------------
FOLD2_RUEPO      LLRNAIRAHQQQRAAGWIH-------------------------
FOLD_RHOCB       LMRNALTAHRRQVAAGWLEAAKA---------------------
FOLD2_RHILO      LLRNTMVALSRQRALYEATYGTADRLAAE---------------
FOLD_PYRAE       VLKNLIRTTYQVAQRVLSPRLYEV--------------------
FOLD_THEAC       ILENVVKAAEFQKNNL----------------------------
FOLD_THEVO       ILSNLVKAAEYQSNTNIGR-------------------------
FOLD_PICTO       IFENFINGLKYQIKG-----------------------------
FOLD_THEMA       LFEHVVRAAERQRK------------------------------
FOLD1_DEIGD      MYQNLVRAVKLQRGERVE--------------------------
FOLD_DEIRA       MYQNLVRGVKLQRGEPVDD-------------------------
FOLD_MYCPE       IFKNLMDLVKEKYNERI---------------------------
FOLD_BORBU       LMFNTIKAHLINNRMFDVLNRLEKLLEV----------------
FOLD_BORBP       LMFNTIKAHLINNNMFDILDRLEKLVEV----------------
FOLD_BORAP       LMFNTIKAHLINNNMFDVLDRLEKLVEV----------------
FOLD_MYCMO       LFKNLIEIFEKYLLDDN---------------------------
FOLD_MYCPU       LFENLYEIILKKK-------------------------------
FOLD_MYCS5       LLKNLVEIYK----------------------------------
FOLD_MYCGE       IIKNLWILHEKNKRCLQSSI------------------------
FOLD_MYCPN       IMKNLWVLYEAHQRRI----------------------------
FOLD_MYCGA       LVKNLINLSEIQKVNK----------------------------
                 :