CLUSTAL format seed alignment for MF_01588

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

DNLJ_TREDE       ------------------------------------------------------------
DNLJ_TREPA       ------------------------------------------------------------
DNLJ_THEFY       -------------------------------------------------------MRNHG
DNLJ_FRACC       ------------------------------------------------------------
DNLJ_SACEN       ------------------------------------------MTSNDPADPADRAEFDDA
DNLJ_NOCSJ       ----------------------MKRNGFVPSNSVGRRGIPSNSTSSAIASAGGAVVWTGA
DNLJ_ARTS2       --------------------------MRLEPDNVGDLGQDRSVSTGNTAADTDTQSMTGA
DNLJ_CUTAK       ----------------------------MHPGGQAILFATDLDESSSVNAQLCELRKDGT
DNLJ_CORJK       ------------------------------------------------------------
DNLJ_LEIXX       ------------------------------------------------------------
DNLJ_BIFLO       -----------------------MSTNEQLAWDFDDGDVAEVRPDTGIARFAPGSEQWIA
DNLJ_TROWT       ------------------------------------------------------------
DNLJ_RHORT       ------------------------------------------------------------
DNLJ_MAGSA       ------------------------------------------------------------
DNLJ_CHESB       ------------------------------------------------------------
DNLJ_BRADU       ------------------------------------------------------------
DNLJ_RHILO       ------------------------------------------------------------
DNLJ_BARBK       ------------------------------------------------------------
DNLJ_PARDP       -----------------------------------------------------MAGDDED
DNLJ_MARMM       ------------------------------------------------------------
DNLJ_HYPNA       ------------------------------------------------------------
DNLJ_CAUVC       ------------------------------------------------------------
DNLJ_SPHAL       ------------------------------------------------------------
DNLJ_ZYMMO       -------------------------------------------------------MNADI
DNLJ_RHOPB       ------------------------------------------------------------
DNLJ_GLUOX       ------------------------------------------------------------
DNLJ_PELPD       ------------------------------------------------------------
DNLJ_RICTY       ------------------------------------------------------------
DNLJ_ORITB       ------------------------------------------------------------
DNLJ_WOLTR       ------------------------------------------------------------
DNLJ_EHRRW       ------------------------------------------------------------
DNLJ_ANAPZ       ------------------------------------------------------------
DNLJ_NEOSM       ------------------------------------------------------------
DNLJ_PELUB       ------------------------------------------------------------
DNLJ_SPICI       ------------------------------------------------------------
DNLJ_MESFL       ------------------------------------------------------------
DNLJ_UREPA       ------------------------------------------------------------
DNLJ_MYCPE       ------------------------------------------------------------
DNLJ_MYCPN       ------------------------------------------------------------
DNLJ_MYCGA       ------------------------------------------------------------
DNLJ_MYCMO       ------------------------------------------------------------
DNLJ_MYCS5       ------------------------------------------------------------
DNLJ_MYCPU       ------------------------------------------------------------
DNLJ_MYCH7       ------------------------------------------------------------
DNLJ_FUSNN       -------------------------------------------------------MEIKK
DNLJ_LEPIC       ------------------------------------------------------------
DNLJ_BORBU       ------------------------------------------------------------
DNLJ_ONYPE       ------------------------------------------------------------
DNLJ_NITSB       ------------------------------------------------------------
DNLJ_SULDN       ------------------------------------------------------------
DNLJ_CAMHC       ------------------------------------------------------------
DNLJ_CAMJJ       ------------------------------------------------------------
DNLJ_WOLSU       ------------------------------------------------------------
DNLJ_HELHP       ------------------------------------------------------------
DNLJ_HELAH       ------------------------------------------------------------
DNLJ_CLOTE       ------------------------------------------------------------
DNLJ1_CLOAB      ------------------------------------------------------------
DNLJ_MARHV       ------------------------------------------------------------
DNLJ_ALCBS       ------------------------------------------------------------
DNLJ_IDILO       ------------------------------------------------------------
DNLJ_COLP3       ------------------------------------------------------------
DNLJ_SHEAM       ------------------------------------------------------------
DNLJ_SACD2       ------------------------------------------------------------
DNLJ_CHRSD       ------------------------------------------------------------
DNLJ_LEGPA       ------------------------------------------------------------
DNLJ_MAGMM       ------------------------------------------------------------
DNLJ_NITMU       ------------------------------------------------------------
DNLJ_JANMA       -----------------------------------------------------------M
DNLJ_METCA       ------------------------------------------------------------
DNLJ_NITOC       ------------------------------------------------------------
DNLJ_COXBU       ------------------------------------------------------------
DNLJ_PSYCK       ------------------------------------------------------------
DNLJ_HYDCU       ------------------------------------------------------------
DNLJ_FRATN       ------------------------------------------------------------
DNLJ_DICNV       ------------------------------------------------------------
DNLJ_SODGM       ------------------------------------------------------------
DNLJ_BAUCH       ------------------------------------------------------------
DNLJ_BUCBP       ------------------------------------------------------------
DNLJ_BUCCC       ------------------------------------------------------------
DNLJ_BUCAI       ------------------------------------------------------------
DNLJ_WIGBR       ------------------------------------------------------------
DNLJ_BLOPB       ------------------------------------------------------------
DNLJ_BLOFL       ------------------------------------------------------------
DNLJ_BORA1       ------------------------------------------------------------
DNLJ_PSESM       ------------------------------------------------------------
DNLJ_RALSO       ------------------------------------------------------------
DNLJ_XYLFT       ------------------------------------------------------------
DNLJ_NEIG1       ------------------------------------------------------------
DNLJ_BDEBA       ------------------------------------------------------------
DNLJ_GEOSL       ------------------------------------------------------------
DNLJ_PELCD       ------------------------------------------------------------
DNLJ_SYNAS       ------------------------------------------------------------
DNLJ_SYNFM       ------------------------------------------------------------
DNLJ_MYXXD       ------------------------------------------------------------
DNLJ_ANADF       ------------------------------------------------------------
DNLJ_HALHL       ------------------------------------------------------------
DNLJ_NATPD       ------------------------------------------------MEEPE-------
DNLJ_HALWD       MSTTISDSIASMISRINDIVITVAPSGDSNDSHRHSQIICDGGRTIQPLDDSSETTLAYA
DNLJ_SALRD       ------------------------------------------------MPDVD-------
DNLJ_LISW6       ------------------------------------------------------------
DNLJ_STAS1       ------------------------------------------------------------
DNLJ_GEOSE       ------------------------------------------------------------
DNLJ_ENTFA       ------------------------------------------------------------
DNLJ_STRS2       ------------------------------------------------------------
DNLJ_LACS1       ------------------------------------------------------------
DNLJ_LACPL       ------------------------------------------------------------
DNLJ_OENOB       ------------------------------------------------------------
DNLJ_LEUMM       ------------------------------------------------------------
DNLJ_PEDPA       ------------------------------------------------------------
DNLJ_LACDB       ------------------------------------------------------------
DNLJ_SYMTH       ------------------------------------------------------------
DNLJ_MOOTA       ------------------------------------------------------------
DNLJ_DESHY       ------------------------------------------------------------
DNLJ_CARHZ       ------------------------------------------------------------
DNLJ_HUNT2       ------------------------------------------------------------
DNLJ_CALS8       ------------------------------------------------------------
DNLJ_CALS4       ------------------------------------------------------------
DNLJ_CLOD6       ------------------------------------------------------------
DNLJ_SYNWW       ------------------------------------------------------------
DNLJ_THEMA       -------------------------------------------------------MSERK
DNLJ_AQUAE       -----------------------------------------------------MFTPERE
DNLJ_SOLUE       ------------------------------------------------------------
DNLJ_KORVE       ------------------------------------------------------------
DNLJ_SYNE7       ------------------------------------------------------------
DNLJ_SYNJA       ------------------------------------------------------------
DNLJ_SYNY3       ------------------------------------------------------------
DNLJ_GLOVI       ------------------------------------------------------------
DNLJ_PROMT       ------------------------------------------------------------
DNLJ_PROMA       ------------------------------------------------------------
DNLJ_PARD8       ------------------------------------------------------------
DNLJ_PORGI       ------------------------------------------------------------
DNLJ_GRAFK       ------------------------------------------------------------
DNLJ_CYTH3       ------------------------------------------------------------
DNLJ_PELLD       ------------------------------------------------------------
DNLJ_CHLPN       ------------------------------------------------------------
DNLJ_CHLMU       ------------------------------------------------------------
DNLJ_PARUW       ------------------------------------------------------------
DNLJ_RHOMR       ------------------------------------------------------------
DNLJ_RUBXD       ------------------------------------------------------------
DNLJ_ROSS1       ------------------------------------------------------------
DNLJ_THEFI       ------------------------------------------------------------
DNLJ_DEIRA       ------------------------------------------------------------
DNLJ_DEHMC       ------------------------------------------------------------
DNLJ_DESAG       ------------------------------------------------------------
DNLJ1_DESVV      ------------------------------------------------------------
DNLJ_LAWIP       ------------------------------------------------------------
DNLJ_RHOBA       ------------------------------------------------------------
DNLJ2_STRCO      ------------------------------------------------------------
DNLJ1_NOCFA      ------------------------------------------------------------
DNLJ_PSYIN       ------------------------------------------------MITLSKSQEEVF
DNLJ_DESPS       ---------------------------MLFCAGNPWLPAFFLQFVIMKKIDLTEKQRDLL
DNLJ_RUTMC       ------------------------------------------------------------
DNLJ_VESOH       ------------------------------------------------------------
DNLJ_DESAL       ------------------------------------------------------------
                                                                             

DNLJ_TREDE       ----------------------MAKEKR-------------ILDLEKTIKKHQDLYYNAQ
DNLJ_TREPA       ---------------------MSTAQRR-------------VQELEKLILHHQDRYYNAE
DNLJ_THEFY       PGSERKDACVSAPDPTFSDDVPADVRERH-------------ARLSQDLDDYSYRYY-LG
DNLJ_FRACC       ---MSATAGTADESGVASAAASADERARA-------------ASLARELDEHAYRYYVLD
DNLJ_SACEN       AVAGMTSEAEAGATAEGVEDVPAGVRERY-------------ADLVEQVRAHQFRYYVLD
DNLJ_NOCSJ       GAGRVRARPEQVSVGPGTMSCVTDPREEH-------------RLIAEEIEEARWRYYVLD
DNLJ_ARTS2       GTREADTASERVPSGA--------VREEY-------------ENLVEEVRKHRFAYYQED
DNLJ_CUTAK       MVDDSTQGGELEASEAG-----AEARHHW-------------TELAQRILDAQDAYYARD
DNLJ_CORJK       ----------------------MSTQSRW-------------QELADQVRHHRQLYYYGE
DNLJ_LEIXX       --------------------MAADARAEA-------------QGLTTRILELRDAYYELD
DNLJ_BIFLO       ALQPTDDDAIRLDRFDVNTMTAEAAARLW-------------ARVAAWVESDQIAYYIDD
DNLJ_TROWT       -----------------MPHPDGDLDRRI-------------ELLTAQIIAARKAYYQEN
DNLJ_RHORT       --------------MIPVADLTEAEAARE------------LERLAAEIARHDRLYHQQD
DNLJ_MAGSA       --------------MIPVEALTPFEARIE------------HAELVETIARWDEAYHAKD
DNLJ_CHESB       ----------MTTARIPVDELTEEQAKDE------------LARLAQEIGRHDRLYYSED
DNLJ_BRADU       ----MMARAAKSKPLRDVAELTKAQAKVE------------LMRLALELEGHDKRYYQDD
DNLJ_RHILO       ------------MAEKPVDSLSESEAEAE------------LKRLAEEIAGHDRRYHAED
DNLJ_BARBK       -------------MDKDAKNLTALEAERE------------LEWLAKEIARHDVLYNNHD
DNLJ_PARDP       RAVPAAEGAPPPSALPPVSGLDVKAAEAE------------HARLSEEVAQANLAYYQED
DNLJ_MARMM       -----------MSALKDVDQLTEAEARAE------------HARLAREIAGHDKAYYQSD
DNLJ_HYPNA       -----------MSGDKPVEALSEAEAAAE------------LERLARAIADADAAYYQND
DNLJ_CAUVC       ------------MSQIPVADLTEAQAVED------------LERLADLLATHDIAYHQED
DNLJ_SPHAL       --------------MKDVGSLTEAEAANE------------LMRLAKQIAHHNKLYHAED
DNLJ_ZYMMO       DLFSYLNPEKQDLSALAPKDLSREQAVIE------------LERLAKLISHYDHLYHDKD
DNLJ_RHOPB       ------MTAKPKTAPTDLDTLSKAKAKVE------------LKRLSLEIERHNNAYYQDD
DNLJ_GLUOX       ------------------MTTAPVSAAER------------HAALEADLAQWDEAYHGRD
DNLJ_PELPD       ------------MQNSPTTEQTKNIVAER------------IQELRQLIAHNNRLYYENI
DNLJ_RICTY       --------------MQNIDLISEKEAKKL------------LEELADKIAMYNHAYYIED
DNLJ_ORITB       -------MNKLDISTINIEQLTSDHAKKI------------VDFLALELQKYDQAYYSDN
DNLJ_WOLTR       -------------------MADLEKMIEE------------FTKLRDQISYHDVLYHQKS
DNLJ_EHRRW       -------------------MTDQEEAKLI------------LDKLNEKIRYHDLLYYTQD
DNLJ_ANAPZ       -------------------MSD-NDSRRR------------LADLNAQLKLHDVLYHEHD
DNLJ_NEOSM       -----------------------MEAKKE------------IQELYEKLLRHNKKYYQDD
DNLJ_PELUB       --------------------MNDKDLEIE------------YLKKIDLFQRHNKHYYDKN
DNLJ_SPICI       ----------------MTFEQAKKRSLVL------------KEQLEK----WNYEYYVND
DNLJ_MESFL       ----------------MTKEQASKLINDL------------RLKLNE----WAKEYYVLD
DNLJ_UREPA       ------------------MDKIKAKIDEL------------KQKLDQ----WNYEYYVLD
DNLJ_MYCPE       MFVILHNKLIIYYLDMSNNKEILNRIQNL------------RKNLNQ----YNYEYYGLE
DNLJ_MYCPN       -------------------MAKVAQIRAI------------VEQLKR----YDYHYYVLD
DNLJ_MYCGA       -------------MIEKKNESIKEIIEDL------------VKKLTK----WEHEYYVLS
DNLJ_MYCMO       ----------MKVKSKMNDNEKNNRIISE------------YNDLKNKINLWNKAYFDYD
DNLJ_MYCS5       ----------------MSNQQIKEKIISL------------NNYLKH----LNHLYYDLD
DNLJ_MYCPU       --------------MSLSKSKVKSKIKEL------------NEKLKL----YNHHYYNKN
DNLJ_MYCH7       ---------------MKKNSQIRAKIIEL------------REKIEK----WNHHYYQLQ
DNLJ_FUSNN       RIEELKNNQTGLTFYSSQELNDLEKIVKL------------REDLNK----YRDSYYNDN
DNLJ_LEPIC       -----MPKKKEDSQKTLSEKEAKGLIAKL------------SDEIRH----HQYLYYVKN
DNLJ_BORBU       -----------------MSSKVQQEIADL------------KKLIRK----WDKEYYVDS
DNLJ_ONYPE       ---------------MQNFDLIKQKIKSL------------VKQLTK----ANYQYYNLS
DNLJ_NITSB       ------------------MIKNYQEYKEA------------VEKLKR----WAYAYYVLD
DNLJ_SULDN       --------------------MKKEQYIKA------------VELLNL----YSYHYYVLD
DNLJ_CAMHC       --------------------MSEAEYLKA------------VEMLNI----WAKAYYTQD
DNLJ_CAMJJ       --------------------MKKEEYLEK------------VALANL----WMRAYYEKD
DNLJ_WOLSU       --------------------MNPDQYSQA------------IERLNA----WAHAYYVLD
DNLJ_HELHP       --------------------MTSQEYYTQ------------VQILKK----MAYHYYVLD
DNLJ_HELAH       ------------------MIKSQKEYLER------------IEYLNT----LSHHYYNLD
DNLJ_CLOTE       ---------------MDISEEKKRRIHEL------------IEELNK----YAYEYYVLD
DNLJ1_CLOAB      ----------------------MKLIEDL------------IEKLNK----YSYSYYVLD
DNLJ_MARHV       -----------------MTNVPETIRKRV-------------DSLRATLEDHNYYYYVQD
DNLJ_ALCBS       -----------------MTNNNDP-SLQA-------------QSLRDQLNDWSYRYYVQD
DNLJ_IDILO       --------------------MNQSVHQRM-------------QELEQLLNRYNQEYYEND
DNLJ_COLP3       ---------------------MSNVEKKI-------------SQLQQQLNQYNHEYYVLD
DNLJ_SHEAM       -----------MSGPAHFQGTIMQVKAEI-------------QRLTAEINRHNIAYYVQD
DNLJ_SACD2       ------------------MAASDAVLDKL-------------ESLKNQINYHNKLYYVLD
DNLJ_CHRSD       -----------------MSQIPQAVRERA-------------DTLHQQLDDANYQYYVED
DNLJ_LEGPA       -------------------MNDQGIKESI-------------ETLKEQIRKYDYHYYVLD
DNLJ_MAGMM       -----------------------MSASRA-------------AELRKRLNHYAHSYHTLD
DNLJ_NITMU       -----------------MSERLSEISRHM-------------RELRDAIELHNIRYYELD
DNLJ_JANMA       QPDLFSTASQADANATPEEPDASNPAARA-------------AWLRDELNRHNYSYHVLD
DNLJ_METCA       ------------------MSVPAEVVEKA-------------RKLREEIEFHNVRYYRLD
DNLJ_NITOC       ------------------MVAPAPAKERI-------------QALKELINNYDYAYYVVN
DNLJ_COXBU       ---------------MNGVEVPAKIQKRI-------------ERLRQEINDHNYRYYVLS
DNLJ_PSYCK       MTDPIAPLTSKDINTAKSAANEDAIVAQM-------------RTFIDALKKHNYAYYVLD
DNLJ_HYDCU       ---------------------MQDQKAY--------------QKLVESLNQHSYQYYVLD
DNLJ_FRATN       ------MTPNEFFSIKYHILAKAELKAYI-------------DKLADYLSQQSYLYHTLD
DNLJ_DICNV       -----------------MAQNSSLIAAEL-------------EALRQTIRAHEYAYYVLE
DNLJ_SODGM       ---------------------MEQIEQHI-------------LRLRKQLRHWEYLYYVEA
DNLJ_BAUCH       ---------------------MKQIEQYI-------------EQLRQQLRYWNFLYYAKD
DNLJ_BUCBP       ---------------------MKDIKNYI-------------LKLQDEIRYHAYLYHTLN
DNLJ_BUCCC       ---------------------MKDIYNQI-------------LKLQLQIKYHNYMYHTLD
DNLJ_BUCAI       ---------------------MTSTKDKI-------------EKLRKILLKYEYFYHTLN
DNLJ_WIGBR       ---------------MFKKNINIKIKTKI-------------LNLRKKIEMWNNNYYVKN
DNLJ_BLOPB       ---------------------MKFVKQKI-------------QKLRKKLRHWEYLYYTKN
DNLJ_BLOFL       ---------------------MKLIKNRV-------------QILRERLNYLEYLYYVKS
DNLJ_BORA1       -----------------MSAFEQAAREQA-------------ARLRAEIAQHNIRYYVYD
DNLJ_PSESM       ---------------------MKAAETRI-------------LELRAELDQHNYRYHVLD
DNLJ_RALSO       ------------MSKTEHPASGASPETRA-------------AALRATLNRYAHEYYVLD
DNLJ_XYLFT       -------------------MIPLDPAQRA-------------AELRRRLQEANYHYHVLD
DNLJ_NEIG1       ---------------------MNPTAQRI-------------HELTDLLNRYAYEYYTLD
DNLJ_BDEBA       -----MPDAFCRDWTSEMGANYSMSKKRH-------------EELKKIISEHDHNYHVLD
DNLJ_GEOSL       -------------------MDKQTAADRV-------------AALRTELERHNRLYYAED
DNLJ_PELCD       -------------------MDKAQRIRRY-------------QQLCDELHRHSRLYYTYD
DNLJ_SYNAS       ------------------MMDAESARKNI-------------EDLKARIEYHNRRYYQLD
DNLJ_SYNFM       ------------------MPDREKAHARI-------------EALREEIRHHNYLYYVLD
DNLJ_MYXXD       ------------------MDDFQKAAARA-------------RELHRELAHHNYRYYVLD
DNLJ_ANADF       ---------------MRADADRDSAETRA-------------AELRARILDADHAYYVLD
DNLJ_HALHL       --------------MAEPTATREQAQQRM-------------AQLRGEISEHDYHYYVLD
DNLJ_NATPD       --DNPYIRDPPLDFEPVDELDAASATRQV-------------ETLREAIRFHDYRYYQLA
DNLJ_HALWD       DPNNPYLSNIDGDFRPIEQLSEEAAVEQA-------------TQLREAIREHDYQYYIRA
DNLJ_SALRD       -------PTPDLDLEAID--SEPAAAEAA-------------EQLRAALRHHNYRYYVLD
DNLJ_LISW6       ---------------------MAD-KKR-------------YEELINILDQYSYDYYVID
DNLJ_STAS1       ---------------------MADIQSR-------------VDELHRLLNQYSYEYYVKD
DNLJ_GEOSE       -------------------MDRQQAERR-------------AAELRELLNRYGYEYYVLD
DNLJ_ENTFA       --------------MEQQPLTLTAATTR-------------AQELRKQLNQYSHEYYVKD
DNLJ_STRS2       ------------------------MKTR-------------ISELVSVLNQYAKEYYQLD
DNLJ_LACS1       -------------------MSQKDIEME-------------LKELRNKLNRWSNEYYVLD
DNLJ_LACPL       ------------MADKPNTMTVEQAADE-------------AAALRQTLNEWRRQYYDED
DNLJ_OENOB       -------MNPADQFTPIEDLTFTQAQAE-------------IRDLSDELTKWGREYYEED
DNLJ_LEUMM       ---------MLPDFTPIEKLTTQDAQQE-------------TARLQKQLVQYGTAYYEDD
DNLJ_PEDPA       ----------MSLPKKLEEMQVEEASKL-------------AQNLREILDRWSKLYYTKD
DNLJ_LACDB       -----------------MAESLEEAKQE-------------VRQLRAQLDQWAKAYYEQD
DNLJ_SYMTH       -------------------MDRSWAERR-------------IPELIETIRHHEYLYYVKN
DNLJ_MOOTA       -------------------MDLAAARQR-------------VEELRRLIEEHNYRYYVLD
DNLJ_DESHY       ---------------------MPDVSQR-------------IEALREQIEEANYQYYGLD
DNLJ_CARHZ       -------------------MDKEAVKKR-------------IEELRALLHYHNYRYYVLD
DNLJ_HUNT2       ----------------------MDIEKR-------------ILELREILNYHSHKYYVED
DNLJ_CALS8       --------------------MSEFIKKR-------------IRELVDLINYHDYKYYVED
DNLJ_CALS4       -------------------MDREEARKR-------------IEELREKINYHNYRYYVLD
DNLJ_CLOD6       ----------------------MSVKDE-------------INKLIETINYHNERYYNQD
DNLJ_SYNWW       ----------------------MEVSSR-------------IKELREEMQKHDYHYYILD
DNLJ_THEMA       --------------------IPKEVIEE-------------VERLREEIEYHNYRYYVLN
DNLJ_AQUAE       KELQEKTRELLRKIKDVKVLSFEEAKKL-------------AEDLREVIRYHDYKYYVEA
DNLJ_SOLUE       ---------------------MKDPAVE-------------IEKLREQLHHHEHLYYVLD
DNLJ_KORVE       ------------------MSRTKDPAKQ-------------AEDLREKLRYHEHRYYVLD
DNLJ_SYNE7       ------------MTASQTGPTTTAIAQR-------------ASELRQLLQQASYAYYVLD
DNLJ_SYNJA       --------------------MDPKLEQR-------------ARELRALLQKASIAYYVHD
DNLJ_SYNY3       ----------------------MTTPDR-------------LLQLRQQLQKASYAYYVLD
DNLJ_GLOVI       ----------------MSTTVPPEIEEH-------------TRTLRALLHRWGYAYYVLD
DNLJ_PROMT       -----------------MNSNFNQHFER-------------IKELRALLNKANYSYYVLD
DNLJ_PROMA       -------------------MAETNHSKR-------------ISELRSLLNKANHAYYILD
DNLJ_PARD8       -----------------------MVEAK-------------IKALRDELERHNYNYYVLS
DNLJ_PORGI       ------------------MEKIVPPAVR-------------IEELRRILREHEYRYYVLS
DNLJ_GRAFK       ----------------------MEVEKK-------------IRGLREELQQHNYNYYVLD
DNLJ_CYTH3       -------------------MNDAQALAR-------------IEELNKVLHYHNNLYYQKD
DNLJ_PELLD       ---------------MVSMHREDAQRRE-------------AEELRREIERHNHLYYVEA
DNLJ_CHLPN       -------------------MKEENSQAH-------------YLALCRELEDHDYSYYVLH
DNLJ_CHLMU       --------------------MRALSQDY-------------YIALCTELIEHDRRYYVLD
DNLJ_PARUW       ----------------------MITQKD-------------YEKLCHEIWHHNKLYYIEH
DNLJ_RHOMR       METHTAPQTAEARLLEATHTLLQTVRQRDLEAIDRKEAEALAARLREVLNQHAYRYYVLD
DNLJ_RUBXD       MGAPTLP-----RIIPPVAEKLAEARQR-------------VEELREQIRYHNRKYYVED
DNLJ_ROSS1       -------------------MNNDHLTRR-------------VEALREQIRYHNYRYYVLD
DNLJ_THEFI       -----------------MTRE--EARRR-------------INELRDLIRYHNYRYYVLA
DNLJ_DEIRA       -----------MRYPGRMTDAPPDPRAR-------------YLALRDEVALHNRAYYEQD
DNLJ_DEHMC       ---------------------MFSPLIE-------------VENLRREINRHNQLYYVQD
DNLJ_DESAG       ----------MDRRGAPVKQDSAKVEQR-------------MEELRTLLEYHGHRYYVMD
DNLJ1_DESVV      ------------------MCNIPQHQSR-------------AAWLRAELARHNRLYYELD
DNLJ_LAWIP       ----------MSINSPQYSLPSKKEKQR-------------VRELRKFINHHNYLYYTLD
DNLJ_RHOBA       -------------MPQDRFVASDSIASRV-------------QQLVDEINRHNRLYYDDA
DNLJ2_STRCO      ------------MIRAMTTPAAVIVDATA------------YAQAVEDAAHAAAAYYAGG
DNLJ1_NOCFA      ----------------------MDAGERI-------------RELADRIVELRTAYYEGA
DNLJ_PSYIN       KKL---AVELSMSKLIEACNKSVDFSSLN------------SNEQ-LDVLKVTNAFYRSA
DNLJ_DESPS       VDVLDAEAGFAEEKLLDIASGAVSPLFLS------------ESDL-LSFLQAANALYRAG
DNLJ_RUTMC       ------------------------MDELS------------DEEL-AQFCQIANLAYRAG
DNLJ_VESOH       --------MLSQNIIDKIIRQDILVDELL------------DEEL-SIFCQTANLAYRSG
DNLJ_DESAL       -----------------MQDLPSSIADIS------------DPELLGQWLEKYNEAYRAG
                                                                             

DNLJ_TREDE       PE---ISDAEFDALWDELKALDPQN---KLFFTVPLESTEGFAKS---------------
DNLJ_TREPA       SD---ISDDAFDALWEELARLDPGN---PLLKAIGSDSQRDAVKK---------------
DNLJ_THEFY       SP--IISDAEYDQLMAELRDLEAQY---PSLVTPDSPTQKVGAPIS--------------
DNLJ_FRACC       SP--TISDAEYDRLMAELAALEERH---PDLRTPDSPTQKVAGSYS--------------
DNLJ_SACEN       SP--TISDGEFDELFTELQTLESDH---PALRDPDSPTQVVGGTFS--------------
DNLJ_NOCSJ       SP--TIDDADFDRRMRRLEALEEEF---PELRTPDSPTQTVGGAVS--------------
DNLJ_ARTS2       AP--IISDAEFDELFRRLETIEAMH---PELVANDSPTQEVGGEVS--------------
DNLJ_CUTAK       AP--TISDAEYDRLMVELKKVEDDH---PELRTPDSPTQRVGAPQRI-------------
DNLJ_CORJK       -P--EISDADFDALLQELKDLEQAH---PEVVTGASPTEEVAPAPPTS------------
DNLJ_LEIXX       TV--LVSDEEYDRMLRRLEELERLH---PELQSQDSPTQTVGGRAQT-------------
DNLJ_BIFLO       SP--VSSDAAYDARMRCLERLEAAF---PSLDNPQSPTHRVGGSFS--------------
DNLJ_TROWT       TS--LMSDVEYDALEHELKDAEHAK---GFS-DRNSPSLTVGIAAQL-------------
DNLJ_RHORT       AP--EITDGEYDALVRRNNEIEAAF---PELVRGDSPSAHVGAA-PAE------------
DNLJ_MAGSA       AP--EVPDDVYDGAKRRLARIEGRF---PELAAKSPIRDKVGAA-PSE------------
DNLJ_CHESB       AP--EVSDAEYDALRRRNLAIEQAF---PNLIRADSPSKRIGAP-AVE------------
DNLJ_BRADU       AP--TVTDAEYDALRQRFNAIEKRF---PEFVSAESPSQKVGAA-PSG------------
DNLJ_RHILO       AP--TITDAEYDALRRRNLAIEERF---PGLVREDSPSRRVGAP-PAE------------
DNLJ_BARBK       QP--EISDARYDALRRRNIEIETLF---PELVRADSPSYKVGAP-ISE------------
DNLJ_PARDP       AP--FISDAEYDASKRRLEEIEARF---PDLAHSGSPTAQVGAA-PDT------------
DNLJ_MARMM       AP--KISDAAYDALRRKLEAIEVRF---PQFIDLLSPTQRVGAV-PSG------------
DNLJ_HYPNA       AP--ELTDADYDALRQRNLAIEARF---PALKREDSPTDRVGAE-AGD------------
DNLJ_CAUVC       NP--TVSDAEYDALKRRNLDIETRF---PHLVRDNSPSMRVGAT-RAE------------
DNLJ_SPHAL       SP--EISDADYDALVRRNTAIEEAF---PHLIRADSPNRLVGAAVEAS------------
DNLJ_ZYMMO       NP--AVPDSEYDALVLRNRRIEQFF---PDLIRPDSPSKKVGSR-PNS------------
DNLJ_RHOPB       AP--KISDAEYDALRHRVEAIEAKF---PELVSSDSPTQKVGAA-PAR------------
DNLJ_GLUOX       EP--EVSDAVYDAARRELLALEEAY---PDLRSQEGASQRVGAT-PDS------------
DNLJ_PELPD       PPRREIHDYEYDELFKELQELESRF---PEFQSADSPTQIVGGS-VSE------------
DNLJ_RICTY       NP--LVSDSEYDQLFNLNLKLENTF---PHLVLSNSPSKKIGA-KITN------------
DNLJ_ORITB       NP--LVTDAQYDVLKNLNNKIVAKF---PHLALVNDHSKKVGF-TPSA------------
DNLJ_WOLTR       KP--EIADAEYDKL-KQKLVEMEGQ---LPGACV--TQDGVGA-APDE------------
DNLJ_EHRRW       SP--EISDAEYDDLCHQRSIILEKF---PSLNSY--YQDYIGG-DPDS------------
DNLJ_ANAPZ       AP--EISDAQYDALVQEKRELLEKF---PELSAYNDYEGVIGALTVDA------------
DNLJ_NEOSM       SP--EITDAEYDSIKDRYLKLLEAN---PSLGFP-----VVVGYPASE------------
DNLJ_PELUB       KP--IVSDQEFDLLKKDIIDLERKY---KFLKSEYSPTKSIGF-KPSK------------
DNLJ_SPICI       NP--SVSDQEYDRALQELIAIEQQY---SELITIDSPTQRVSG-----QISE--------
DNLJ_MESFL       NP--SVDDAEYDKTIHQLLDLENQF---PELITSDSITQKVGG-----IVSD--------
DNLJ_UREPA       DP--SVPDHVYDQTMRELIELENNY---PQFKTNNSPSVKVGG-----FVSE--------
DNLJ_MYCPE       NP--SVSDYEYDMCLKELIQLETQY---PEFDSPNSPSKKVGG-----YISE--------
DNLJ_MYCPN       DP--LVSDFEYDQLYKQLQALEQAH---PELIQPDSPTQRVGG-----IVVE--------
DNLJ_MYCGA       NP--SVSDEVYDNTYRTLLGYERKY---PQYVLSYSPTQRVGS-----SISN--------
DNLJ_MYCMO       EP--LVEDSIYDATLLKLIKFENQY---KFLDNSDSPTKNIGA-----KVSK--------
DNLJ_MYCS5       AP--EVDDKTYDSLYNELLELEAKY---PSLVLEDSVTKIIGA-----FVSN--------
DNLJ_MYCPU       ES--LVSDEYYDAKLLELENIRDNF---PEEYNQVFQKDFSKS-----VLEKVNHLDEQD
DNLJ_MYCH7       NP--LVDDLVYDKTLRELEKLEREN---FFLFSLEELNQSPSQ-----KVGS-----KIT
DNLJ_FUSNN       KS--LISDYEFDILLKELESLEEKY---PQYKEISSPTTSVGA-----SLKE--------
DNLJ_LEPIC       DP--KISDFDFDQLFRRLQDLEEEF---PQFKDLASPTLVVGS-----DLDK--------
DNLJ_BORBU       LP--SVEDFVYDKHILRLQELESKY---PEYKTLDSPTLKFGS-----DLLN--------
DNLJ_ONYPE       NP--DLSDQQYDALLKELINLETRY---PQFKLPYSPTLKIGG-----FVEK--------
DNLJ_NITSB       NP--EVPDEVYDKLYREVEEYEKAH---PDQIDPTSPTQRIGA-----EPAK--------
DNLJ_SULDN       DA--ITTDEVYDKLYHEVLEYEESH---KEDILKNSPTQRVGD-----TVSE--------
DNLJ_CAMHC       NP--LATDIEYDVLYKKVETFENEF---PDLKVSYSPTNRVGD-----AVSE--------
DNLJ_CAMJJ       EP--LASDEEYDVLIRELRVFEEQN---KDEISKDSPTQKIAP-----TIQS--------
DNLJ_WOLSU       AP--LATDEEYDQLYHEALAFERQN---PERIHPASPTQRIGG-----APLE--------
DNLJ_HELHP       EP--IATDEQYDSLYHQIVRFEEEN---PHLIDASSPTQRVGD-----VPLE--------
DNLJ_HELAH       EP--IVSDAVYDELYQELKAYEEKN---PSQIQANSPTQKVGA-----TALN--------
DNLJ_CLOTE       NP--TVSDKEYDKRYDELVNLEKET---GFVL-SYSPTQRVGD-----TVLT--------
DNLJ1_CLOAB      NP--IVADKEYDIMYDELKRLEEET---EYIN-PNSPTQRVGD-----IILD--------
DNLJ_MARHV       DP--RIPDAEYDRLFRELQKLEAEH---PELATEDSPTRRVGSSA-ETSF----------
DNLJ_ALCBS       DP--AVPDAEYDRVFRALKDLEAQY---PDLVTADSPTQRVGDVP-LDAF----------
DNLJ_IDILO       EP--SVPDAEYDRLFRELKTLETEH---PDLKSAQSPTMKVGGKP-LGQF----------
DNLJ_COLP3       QP--SVPDAEYDRLMTALIDLEKTN---PELKTIDSPSQKVGGQA-LKSF----------
DNLJ_SHEAM       AP--SIPDAEYDRLMNQLKALEAEY---PQFAEPDSPTQRVGGAA-LNKF----------
DNLJ_SACD2       AP--ELPDAEYDKLFQELQAIEQQF---PELVTEDSPTQRVGAAP-LDSF----------
DNLJ_CHRSD       DP--RITDAEYDALLRELQSLEAEH---PELKTPDSPTQRVGAAP-AERF----------
DNLJ_LEGPA       EP--LVPDAEYDRCFKALQQYEEQY---PQFLSPDSPTQRVSGTP-SDAF----------
DNLJ_MAGMM       TS--LVSDAEYDRLFRELQSLEAAD---PTLISADSPTHRVGGAI-LEGF----------
DNLJ_NITMU       TP--TIPDADFDKLFRELEELEQRH---PELITPDSPTQRVGIPP-LKAF----------
DNLJ_JANMA       NP--SIPDAEYDKLFRELQALETSH---PELLVFDSPTQRVGALA-LSAF----------
DNLJ_METCA       DP--LITDAEYDRLMAELLAIEARY---PELVTPDSPTQRVGAPP-VEAF----------
DNLJ_NITOC       NP--LVPDSEYDRLIRELQALEENY---PELITLDSPTQRVGAKP-VKSL----------
DNLJ_COXBU       QP--TIPDSVYDELFHELEKLEKKY---PETITPSSPTQRVGAEP-LKVF----------
DNLJ_PSYCK       NP--ILEDSEYDQLRRSLLELEEEY---PDLIQPDSPINQVGDMP-LSAF----------
DNLJ_HYDCU       DP--IISDPQYDVLYQKLLRIEDEH---PDWILPESPSQRIGDEP-LKEF----------
DNLJ_FRATN       KP--IISDSDYDKLFRLLQDLVNDN---PQFKPINSVLDRVGGEV-LAEF----------
DNLJ_DICNV       AP--NIADSEFDALMQKLRALEAAS---GLPIPADSPTQRVGGKA-DNRF----------
DNLJ_SODGM       AP--EVPDSEYDRFMAELRTLEAER---PDLLTADSPSQRVGGQA-QSSF----------
DNLJ_BAUCH       AP--EVSDVEYDWLMMKLRELERQW---PDLKTADSPTQHIGYKA-QSKF----------
DNLJ_BUCBP       SP--KISDEKYDFLVIELQRLEKKC--KYSVRFKDSPTQSVGSEN-LPEF----------
DNLJ_BUCCC       SP--IISDILYDELYNKLLQLEKLYFKKKSLDKKIKLLDQVGAKK-LHIF----------
DNLJ_BUCAI       QS--IISDAEYDYLFRQLYELELKN---KELIPSDSPTQKVGSHI-LQKF----------
DNLJ_WIGBR       LS--LVSDEKYDSTLFELNELEKKY---SMFLNTSYSNKIVAKNI-CNKF----------
DNLJ_BLOPB       ES--AVSDEKYDAMLEKLNQLEQIY---PHLIAESSPTQRIGGVS-QYNF----------
DNLJ_BLOFL       ES--KVSDEEYDILLEELRQLEFKY---PYLITKSSSTQSISNVC-DNSL----------
DNLJ_BORA1       EP--SITDADYDALMRELMALEAQH---PELVTPDSPTQRVGAAP-LAEF----------
DNLJ_PSESM       EP--SIPDAEYDRLFHELKALEAEN---PHLVTPDSPTQRVGSAA-LSAF----------
DNLJ_RALSO       QP--SVPDAEYDRLYRELEALEAEH---PELRTPDSPTLRVGGAV-LPEF----------
DNLJ_XYLFT       QP--RIPDADYDRMLRELDALEATY---PDLATPDSPTQRVGHTI-ATAF----------
DNLJ_NEIG1       AP--SIPDAEYDRLFRELEALERNH---PELKLPDSPTQRVGGEP-LAGF----------
DNLJ_BDEBA       KP--TITDYEYDQLFAELLDIEKNP---KGLDLSDSPSQRVGGTV-LEGF----------
DNLJ_GEOSL       RP--EITDAEYDLLFRELVDLETRFPD---LAAPDSPTQRVGGAP-LDKF----------
DNLJ_PELCD       RP--EITDAEYDRLFRELLELEKAYPE---LVTAASPSLRVGASP-LSQF----------
DNLJ_SYNAS       DP--EISDAEYDSLLQELIALEKQFPQ---WLTEDSPSRRIGAAP-LSKF----------
DNLJ_SYNFM       RP--EISDEAYDGLFRELVRLEESYPA---LITPDSPTQRVGAAP-AEKF----------
DNLJ_MYXXD       SP--EVSDAQYDKLMRELQDLEAKHPS---LQTPDSPTQRVGGAA-AEEF----------
DNLJ_ANADF       RP--VLADAEYDRLVRELAEIEAAHPE---LATSDSPTQRVSGAP-SERF----------
DNLJ_HALHL       RP--TISDAEYDALFRELQRLEAAYPD---LVSSDSPTQRVAGTA-QEGF----------
DNLJ_NATPD       DP--VISDRAYDQLFERLERLESKFD----RSSATSPTQRVGGEP-LDEL----------
DNLJ_HALWD       SP--IIADRAYDILFDRLQALEDIFN----LDTEASPTRRVGGEP-LDEL----------
DNLJ_SALRD       AP--VVSDAEYDRLFQQLQTLEAEYPV---LQTPDSPTHQVGGPV-RDEL----------
DNLJ_LISW6       NP--TVEDAEYDQKMQELLKIEEAH---PEWVTPDSPSKRVGGEV-LEGF----------
DNLJ_STAS1       NP--SVPDSEYDKLLHELIDIETQH---PEYRTADSPTVRVGGSA-QSTF----------
DNLJ_GEOSE       RP--SVPDAEYDRLMQELIAIEEQY---PELKTSDSPTQRIGGPP-LEAF----------
DNLJ_ENTFA       QP--SVEDYVYDRLYKELVDIETEF---PDLITPDSPTQRVGGKV-LSGF----------
DNLJ_STRS2       QP--SVSDAEYDTLYRELVELETAH---PELILPDSPTHRVGGKM-LDGF----------
DNLJ_LACS1       TP--SVEDSVYDKHYQRLLELEQAN---PDLVTADSPSQRVGGKV-LSGF----------
DNLJ_LACPL       AP--NVEDSVYDQKYERLVELEQTF---PQLVTPDSPTQLVGGTV-KAGF----------
DNLJ_OENOB       NP--SVEDYVYDAHYARLVALEKAY---PSLAMPDSPTQHVAAGN-QTKNDSR-------
DNLJ_LEUMM       AP--LVEDYIYDALYARLVALEEKF---PQYVIPDSPTQNVGSAD-TKSE----------
DNLJ_PEDPA       AP--EVEDYEYDEKYADLVALEEAF---PEIITQDSITQRVGGEI-LEGF----------
DNLJ_LACDB       AP--VVEDHVYDEKYARLLELEAAY---SELKSADSITQRVGGEV-NSDL----------
DNLJ_SYMTH       EP--EISDAAFDELMQELKQLEEAF---PDLRRPDSPTQRVGGAT-APDF----------
DNLJ_MOOTA       QP--SISDREYDALMQELIALEEAY---PELRTPDSPSQRVGGAP-REEF----------
DNLJ_DESHY       QP--TLSDAEYDALLQELIRLEKEH---PEFLTPDSPSQRVGGYI-AKEF----------
DNLJ_CARHZ       QP--EISDAEYDRMLRELISLEQQY---PEFITPDSPSQRVGGEV-AKEF----------
DNLJ_HUNT2       AP--EISDFEYDELYRELEKLEQER---PDLITPDSPTQRIGGKP-LEGF----------
DNLJ_CALS8       NP--EISDYEYDMLYRELVELEKQY---PEYIFPDSPTQRVGGKV-KEGF----------
DNLJ_CALS4       QP--EISDYEYDMLMRELIELEEKY---PEFKTPDSPSQRVGGEP-LDEF----------
DNLJ_CLOD6       SP--EISDYEYDKLMKELISLEEEH---PELKRIDSPTNRVGGKP-LDKF----------
DNLJ_SYNWW       AP--LISDSGYDRLMQELKKLEEEY---PQYITADSPTQRVAGKA-SEKF----------
DNLJ_THEMA       DP--VITDEEYDRLMRRLIELERMY---PELVTPDSPTQRVGGKV-LEGF----------
DNLJ_AQUAE       NP--VIPDYDYDRLFRALKEIEKKY---PELITPDSPTQRVASEI-SGEF----------
DNLJ_SOLUE       KP--EITDAEYDALMHRLQELETKH---PDLLTPDSPTQRVGGKP-REGF----------
DNLJ_KORVE       DP--EISDADYDVMMNELKALEAKH---PELLTPDSPTQRVGGKP-REGF----------
DNLJ_SYNE7       QP--VMEDAVYDRLYRELQDLEQQH---PSLITPDSPTQRVGEQP-ATGF----------
DNLJ_SYNJA       AP--ILEDSVYDRLYRELQELERAY---PELITPDSPTQRVGEKP-AEQF----------
DNLJ_SYNY3       AP--VMEDSVYDQLYRELQRLEAEN---PELITPDSPTQRVGEQP-ASQF----------
DNLJ_GLOVI       AP--EVSDAIYDQHYRELVDLESRY---PELVSPDSPTRRVGERP-ASAF----------
DNLJ_PROMT       SP--EIDDSVYDQLYRELIEIENIH---PSLITDDSPSQRLGGVP-SKGF----------
DNLJ_PROMA       SP--LIEDAVFDRLYRELIELEKQY---PSLVTPDSPSQRLGNKP-ATKF----------
DNLJ_PARD8       AP--TISDFEFDKMMKELQELEAAH---PEFADPDSPTRRVGSDL-SKEF----------
DNLJ_PORGI       SP--TIDDFEYDAMMKQLEELEREY---PEWDSPDSPTHRVGSDK-TEGF----------
DNLJ_GRAFK       KP--QISDYEFDIKLKELQELEEKY---PEFEDDNSPTRRVGGAV-TKNF----------
DNLJ_CYTH3       TT--EISDFEFDTLLQELIELEKQF---PLYLKADSPSQRVGGTV-TKEF----------
DNLJ_PELLD       KP--EISDYDFDRLLLRLIELEREH---PELVTPDSPTGRVGGAV-TREF----------
DNLJ_CHLPN       RP--RISDYEYDMKLRKLLEIERSH---PEWKVLWSPSTRLGDRP-SGTF----------
DNLJ_CHLMU       RP--TISDYSYDMKMRELQKIEAQH---PEWKVPWSPTIYLGDRP-SGQF----------
DNLJ_PARUW       QP--IISDEEFDALLKKLEEIERSH---PEWITEFSPSQRVNESL-TSGF----------
DNLJ_RHOMR       NP--LIPDADYDLLMQALRKLEARF---PELVTPDSPTQRVGGPP-LGRFE---------
DNLJ_RUBXD       AP--EISDAEYDALYRELEELESRF---PELVTPDSPTQRVGGEP-LEEFE---------
DNLJ_ROSS1       EP--VISDAEYDALMRELRALEAAH---PELVTPDSPTQRVGAPP-GEQFA---------
DNLJ_THEFI       DP--EISDAEYDRLLRELKELEERF---PEFKSPDSPTEQVGARPLEPTFR---------
DNLJ_DEIRA       AP--TIPDDEYDRLARELRELEAAH---PEFADDHSPVQTVGGAP-SSAFE---------
DNLJ_DEHMC       NP--EISDAQYDTLIRRLKELEEAH---PELVTPDSPTQKVGAEP-LKAFG---------
DNLJ_DESAG       EP--EISDAEYDALFRELVRLEEEH---PEHIHPGSPTHKVGGQI-LDGLK---------
DNLJ1_DESVV      TP--EISDAEYDTLYRELVNLETLW---PALMDEASPTQRVGGEV-LDRLE---------
DNLJ_LAWIP       DP--EISDSEYDKAFQELLTLENTF---PSLKTNNSPTQKVGNNI-LKKLE---------
DNLJ_RHOBA       AP--EITDLQYDQLLAELTQLENDH---PDLRRPDSPTQLVGGDVVDQLV----------
DNLJ2_STRCO      SS--PLDDDAYDRLARGIAAWEAEH---PDEVLPDSPTGKVAGGA---------------
DNLJ1_NOCFA      PL---VADAEYDAVEDELRALIAAH---PELAPDPNPLDQVGAPA---------------
DNLJ_PSYIN       EQ--IINDSTYD-AFLSEFSTYNPD---HPYLLTVEPEVLADSK----------------
DNLJ_DESPS       YP--LLSDEAYDFTFLTELRRRNPQ---HPYLLQVEAEPVQQGK----------------
DNLJ_RUTMC       KP--IISDQDYDFIYLDALKNRDPD---NLLFKFIETEGQSFSEE---------------
DNLJ_VESOH       KP--IISNEDYDFIYLATLKNKEPN---NPLFKSIEPEGRAFAEE---------------
DNLJ_DESAL       KP--MISDAHYD-LLVERLREIAPD---HGFLSAVEAETFADKR----------------
                        :  :*                                                

DNLJ_TREDE       ------EHIIPMGSQEKAADPPS---------FEAWALKMPFK-----------------
DNLJ_TREPA       ------RHIVPMGSQHKAADEES---------FSAWAKKNALQ-----------------
DNLJ_THEFY       NEFAPVEHLERMQSLDNAFSDAQ---------LEAWAHRVSA------------------
DNLJ_FRACC       TLFTPVEHLERMLSLENVFDDDE---------FHQWAARVAR------------------
DNLJ_SACEN       TDFTAVDHLERMLSLDNAFDPDE---------LRAWVERVER------------------
DNLJ_NOCSJ       TDFTSHPHLRRMESLDNAFSVEE---------VEAWYARLRR------------------
DNLJ_ARTS2       AAFAAVEHLQRMYSLEDVFSLEE---------LESWIAKAEASVAKLG------------
DNLJ_CUTAK       TDFAPVKHLERLLSLDNVFTRDE---------LSEWMNRVAT------------------
DNLJ_CORJK       SPFRNVDHREQMLSLDNVFDTEQ---------LAGWLDRTPA------------------
DNLJ_LEIXX       TLFAPVEHAERMLSLDNVFSFEA---------FEAWAAKIER------------------
DNLJ_BIFLO       NDFASVRHPSRMMSLDDVFSIEE---------LKDWYDSVIRDLDWP-------------
DNLJ_TROWT       NLFEPVKHIEPMLSLDNVFSLDQ---------LHSWYEKTKKICP---------------
DNLJ_RHORT       -GFAKVTHALPMLSLGNVFSDDE---------AREFDQRIRRFLSLDG------------
DNLJ_MAGSA       -GFGKLVHAVPMLSLDNAFAPED---------VAEFDAKVRRFLGLGD------------
DNLJ_CHESB       -KFEKVRHKVPMLSLDNAFTDDD---------VVDFVARVRRFLKMEP------------
DNLJ_BRADU       -RFRKVRHAVPMLSLDNAFAEED---------VRDFVGRIVRFLKLD-------------
DNLJ_RHILO       -GFAKVRHAVPMLSLAKAYTDED---------VTDFIERGRRFFDRDK------------
DNLJ_BARBK       -RFEKSVHAQAMLSLDNAFSSED---------VHEFVERVRRFLRLPV------------
DNLJ_PARDP       -RFAKVPHRLPMLSLENGFSQGD---------VEAFVQRVRSFLNLAS------------
DNLJ_MARMM       -KFGEIRHAVPMLSLGNAFNDED---------VADFVGRIRRFLGLAE------------
DNLJ_HYPNA       -GFAKARHSAPMLSLDNAFTDED---------VADFAVRIRRFLGLAP------------
DNLJ_CAUVC       -QFAPVEHGVPMLSLDNAFSNDE---------AIEFDARVRRFLRISP------------
DNLJ_SPHAL       -PLAKVTHAQRMMSLDNAFAAED---------VEEFAARVRRFLNLDE------------
DNLJ_ZYMMO       -RLPKIAHRAAMLSLDNGFLDQD---------VEDFLGRVRRFFNLKE------------
DNLJ_RHOPB       -GFAKVQHAVPMLSLGNAFSDDE---------VAEFLTRVRRFLKLDA------------
DNLJ_GLUOX       -AFGKYRHLVPMLSLDNVFDPEG---------FDGFVSRVGRFLGLDED-----------
DNLJ_PELPD       -GFKKVQHSVPMLSIENKP-------------VTKMLSEVRSIIKELKD-----------
DNLJ_RICTY       -KFAKVIHQAPMLSLSNAFDEED---------IRDFLERIKNFLRINE------------
DNLJ_ORITB       -QFSKVVHLKPMLSLANGFCVED---------ISNFITKIQNFLKIDH------------
DNLJ_WOLTR       -KFSKIKHREPMLSLENAYDEQG---------VERFLSRIKRFLIEEE------------
DNLJ_EHRRW       -RFSKVKHNERMLSLDNAFNKQD---------VEKFMVRTRKLLDMKE------------
DNLJ_ANAPZ       -RLPKIAHREPMLSLENSFTIQD---------VEKFISRVKRSLNMDP------------
DNLJ_NEOSM       -KFQKVKHLSPMLSLRNIFSEEE---------LVEYIEKTKRFLNLKS------------
DNLJ_PELUB       -NFQKIKHKVPMLSLGNAFNEED---------LKNFEKKIINFLSLKD------------
DNLJ_SPICI       -KFNKYVHTSPMLSLGNAFNYDD---------LIHFDEQIKEFT-AL-------------
DNLJ_MESFL       -KFEKHTHKYPMLSLGDIFSWDE---------FINFNKQVAKVT-GT-------------
DNLJ_UREPA       -KFNKVKHKRPMLSLSNAFNDDD---------LKKFDQDNQNAS-VD-------------
DNLJ_MYCPE       -KFNKVKHEIPMMSLSNAFDEED---------LLKFDNDIKKAI-GS-------------
DNLJ_MYCPN       -AFNKFPHQNPMLSLDNAFDTAT---------IASFIANINNLT-GV-------------
DNLJ_MYCGA       -KFIKVKHDYLMLSLGNCFNFEE---------LLNFNENIAKIS-KQ-------------
DNLJ_MYCMO       -KFSKVQHQFPMLSLNKAYKFDD---------LKIFERHINKLG-FF-------------
DNLJ_MYCS5       -KFKKTKHNKEMLSLDKAYKESE---------IFSFYENFTQYK-NL-------------
DNLJ_MYCPU       VKLKKEKHQKLMLSLNKAYSFED---------LERYTNRINTFV-GN-------------
DNLJ_MYCH7       SKFEKVAHSSPMLSLNKAYSNEE---------LEKWAKKAREIL-KT-------------
DNLJ_FUSNN       NKFKKVEHLHPMLSLANSYNIGE---------IVEFIERIKKKIPKE-------------
DNLJ_LEPIC       -DFEKFQHKLPVLSLINTYNDNE---------LLEWVNKTDPE-----------------
DNLJ_BORBU       -DFKEVEHSAPILSLDKVYDLDL---------LKSWIDKIDFN-----------------
DNLJ_ONYPE       -KFSTIKHKTPMMSLGNVFNLEE---------IKAFYDRIVKKI----------------
DNLJ_NITSB       -EFKKIKHLSKMWSMEDVFNQRE---------MHEWLERVYKNAGRK-------------
DNLJ_SULDN       -GFSKAPHLSRMWSLEDVFDSDG---------LQKWLIKTYKLDS---------------
DNLJ_CAMHC       -GFEKINHKAKMWSMEDIFDDNE---------LLAWLERGEKAGLE--------------
DNLJ_CAMJJ       -EFKKIAHLKRMWSMEDVFDESE---------LRAWAKRA-KCEKN--------------
DNLJ_WOLSU       -GFQKASHLERMWSLEDVFDFGE---------LKSWAERLYKQFPH--------------
DNLJ_HELHP       -SFSKNTHLERMWSLEDVFNYDE---------LVEWVQRIYKSYPQ--------------
DNLJ_HELAH       -QFNKNPHLTRMWSLDDVFNHNE---------LQAWLQRILKAYPS--------------
DNLJ_CLOTE       -QFDKYTHKSRLWSLDKAQNIEQ---------LKEWINRNEKIIMEYNRLNEE-------
DNLJ1_CLOAB      -KFEKTHHKNKLWSLDKAQKKDE---------VKAFVNKCVKFVEQYNLTHSE-------
DNLJ_MARHV       ---EEVIHRLPMLSLDNAFSEDE---------LRDFDRRVRDRLGADG------------
DNLJ_ALCBS       ---EQVQHEVPMLSLDNAFDDEE---------LWAFDKRIRERLDVSE------------
DNLJ_IDILO       ---RSVEHEVPMLSLDNAFSVDE---------FEAFSKRVEQRLDTNQ------------
DNLJ_COLP3       ---TQVTHQLPMLSLDNVFSLDD---------FHAFVKRVKDRLNDNQ------------
DNLJ_SHEAM       ---EQVSHLKPMLSLDNAFNEED---------FVAFDKRLTDKVGSQ-------------
DNLJ_SACD2       ---ASIEHKRPMLSLDNVFNVEE---------LFAFDKRIRDRINADA------------
DNLJ_CHRSD       ---EEVTHAVPMLSLDNAFDDAE---------LAAFVKRVADKLECDGD-----------
DNLJ_LEGPA       ---MPVAHKQPMLSLSNVFTIDE---------LKAFIKRAIEKLDEP-------------
DNLJ_MAGMM       ---EKVRHRVAMLSLDNAFSAQD---------LVEFHRRVQEGLAESVVVEAVQHYQDEY
DNLJ_NITMU       ---PQVVHRTPMLSLSNAFTEGE---------VEAFDRRVRQSLGIAQ------------
DNLJ_JANMA       ---PQVTHSVPMLSLGNGFEDED---------IIAFDKRVSDGLNSTE------------
DNLJ_METCA       ---TEVRHEVPMLSLENAFSEED---------LTAFDRRVRKELSRDT------------
DNLJ_NITOC       ---GEIKHEIPMLSLNNAFHEGE---------LADFHRRVKTRLGIER------------
DNLJ_COXBU       ---EPVHHEIPMLSLDNVFDEKG---------LRAFDKRIRQRLKLDK------------
DNLJ_PSYCK       ---TQVTHDIPMLSLGNVFEYDD---------LRDFMRRVNDRLSVAQQ-----------
DNLJ_HYDCU       ---HTVRHAVPMYSLDNAFEDDE---------LKSFLKRIEEKLPDQK------------
DNLJ_FRATN       ---ETIKHKKKMTSLANVFSLEE---------LRDFYDKIEYDI----------------
DNLJ_DICNV       ---RNVAHHIAMLSLDNVFNADE---------FADFYRRLQEQLSPTT------------
DNLJ_SODGM       ---GQVRHEVPMLSLDNVFEEPG---------FLAFDKRVRDRLKRDDD-----------
DNLJ_BAUCH       ---RKVIHEVPMLSLDHIFNDTS---------FLAFDRRIRNRLQYGNNY----------
DNLJ_BUCBP       ---KKFSHITPMLSLNNVFIKND---------FLKFYKKIVNNIT-VE------------
DNLJ_BUCCC       ---TEFFHKIPMLSLRSINNISD---------FDLFDKKIKEYFKHIN------------
DNLJ_BUCAI       ---KKIKHFSPMLSLENTFDVNG---------YLNFKKRIKKSIHNNE------------
DNLJ_WIGBR       ---KKIKHLSNMLSLESIFNYKN---------LLNFHEKVKKNLFYNE------------
DNLJ_BLOPB       ---KKIHHKVPMLSLNSIVASFQ---------LLSFDKRIKIKLHANH------------
DNLJ_BLOFL       ---NRIRHQKPMLSLNSIRDKSQ---------LLLFDKRIKYKLSNHYNIN---------
DNLJ_BORA1       ---GSVRHAVPMLSLGNGFEDED---------VLAFDKRVSD--TLREAGLLGP------
DNLJ_PSESM       ---TQVRHEMAMLSLGNAFEEND---------LREFDRRVTEGLDLPAGDLFGE------
DNLJ_RALSO       ---APVRHVVPMLSIRTETDTTAGG-------ALDFDASVRRELGLAESDPP--------
DNLJ_XYLFT       ---SEVRHTVPMLSLNNAFSDPE---------VLEFVRRITARLGETAPG----------
DNLJ_NEIG1       ---AEVRHEVPMLSLTNAFSPQDENGVFDHAEMYAFDQRVRDGLDGGNPE----------
DNLJ_BDEBA       ---TKAQHRLPMLSLANSYSPED---------IFEFDERVRKFLNTED------------
DNLJ_GEOSL       ---EQVTHRIPMLSLENAFTDVE---------IADFDDRVKRFLGLH-GD----------
DNLJ_PELCD       ---TPVPHSRPMLSLENALTEDE---------LYDFDARIRKLLA---SD----------
DNLJ_SYNAS       ---APAVHLSPMLSLANAFSEEE---------ILEFDRRLKRFLD---SS----------
DNLJ_SYNFM       ---LPFPHTIPMLSLENAMSEAE---------VFEFARRVRKILG---DR----------
DNLJ_MYXXD       ---GEVVHRAPMISLANIFEDQG---------LTEFDERIRKLVGLPG------------
DNLJ_ANADF       ---ERVVHREPMLSLGNIQSDGE---------LDEFDARVHRLLGLAGD-----------
DNLJ_HALHL       ---EAVVHDTPMLSLDNAFEADD---------LVDFDRRIRDRLGVAS------------
DNLJ_NATPD       ---ETVEHVAPMRSIESSVEVDD---------IRDFDTRIQERLAAAGYE----------
DNLJ_HALWD       ---ETVEHVTSMLSIDQSTAVDS---------VRDFDERVRDVV----------------
DNLJ_SALRD       ---GTVTHPAPMLSLKAVYEEDE---------VRNFAETCREELG----R----------
DNLJ_LISW6       ---TKVAHDTPMLSLANAFNRDD---------LADFDRRIRDKVGDD-------------
DNLJ_STAS1       ---EKVNHDTPMLSLGNAFNEED---------LRKFDQRIRDNIGN--------------
DNLJ_GEOSE       ---RKVAHRVPMMSLANAFGEGD---------LRDFDRRVRQEVGE--------------
DNLJ_ENTFA       ---EKAPHDIPMYSLNDGFSKED---------IFAFDERVRKAIGKP-------------
DNLJ_STRS2       ---EKYSHVYPLFSLQDAFSREE---------LEAFDQRVRKEFPQ--------------
DNLJ_LACS1       ---TKVSHDIPMLSLGDVFSKEE---------LIEFLERLENSVEQK-------------
DNLJ_LACPL       ---DKVTHEIPMLSLGDVFSQAE---------LQEFVDRLEQNVGHP-------------
DNLJ_OENOB       -GLQKVVHPVPMLSLGDVFSIQE---------LLDWDLVTTKNAGSQ-------------
DNLJ_LEUMM       --LQKVVHPAPMLSLGDVFSLDE---------LNDWDARTTKSLGNQ-------------
DNLJ_PEDPA       ---TKVTHTEPMLSMGDVFSRDE---------LVEFDNRIQKNVGHP-------------
DNLJ_LACDB       ---PKVEHPVPMLSMGDVFSKEE---------LAEFDQRVQKAIGHP-------------
DNLJ_SYMTH       ---AKVPHQPPMYSLDNAFSEAD---------LRDFDRRVREGLGGEP------------
DNLJ_MOOTA       ---NQVRHPQVLLSLNDAFNEGD---------LLEFDRRVRDLAGRP-------------
DNLJ_DESHY       ---PKVRHAEALLSLDNAFDAGD---------LLEFDRRVRALVAE--------------
DNLJ_CARHZ       ---REVAHLKPMYSLDNAFGPED---------LKEFDRRVRSLLPGQE------------
DNLJ_HUNT2       ---KKVVHAVQMQSLSDVFSREE---------LLAFDRRVREAVG-DD------------
DNLJ_CALS8       ---KEVVHRVPLLSLSNVFSEGE---------LYDFDRRLRELLGTDD------------
DNLJ_CALS4       ---EPFTHIVPMLSLANAFTAEE---------IKEFDRRVKEAVG--E------------
DNLJ_CLOD6       ---NQIVHKTPMLSLSNAFSEQD---------LRDFDKRVQEYVG-EN------------
DNLJ_SYNWW       ---SPVRHRFPLLSLDNAFSYQD---------LLEFDRRIGRVAR--T------------
DNLJ_THEMA       ---KTVKHSVPMLSLDNTYNEEE---------ILEFDRRVKKALQEAE------------
DNLJ_AQUAE       ---PTVKHYTPMLSLDNAYSEDE---------LREFDRRVRQITGLEV------------
DNLJ_SOLUE       ---IKVRHSSPMLSLDNALNEAE---------LRDFDRRVRDLLGGAA------------
DNLJ_KORVE       ---VKVAHSAPMLSLDNAYNEEE---------LRDWARRVEELSGKAE------------
DNLJ_SYNE7       ---ESVQHRIPLYSLENAFDAEE---------LRSWDQRWRKLAPDVPADA---------
DNLJ_SYNJA       ---PTVSHRIPLYSLENAFNLEE---------LKEWQERLWRVLGRTPEEGE--------
DNLJ_SYNY3       ---RSVAHNIPLYSLENAFNVQE---------LQQWQERWQRIAPTIEKAE---------
DNLJ_GLOVI       ---VSVTHRVPMFSLENAFSQAE---------LEKWGERLLRAIGPG-------------
DNLJ_PROMT       ---KNVEHNIPLLSLDNAFNLNE---------VEAWYGRISKLISSENKNIK--------
DNLJ_PROMA       ---ESIKHRIPLQSLDNAFNFDE---------LNYWHSRMQKHLKSHS------------
DNLJ_PARD8       ---EQVVHKYPMLSLGNTYSEDE---------IRDFYDRTVRSLN---------------
DNLJ_PORGI       ---ASVRHDRPMLSLSNTYNYDE---------IGDFYRRVSEGLQG--------------
DNLJ_GRAFK       ---ETVVHENRMYSLSNSYSKEE---------LEEWEARLKKIVE---------------
DNLJ_CYTH3       ---ASISHKYPMLSLSNTYSEEE---------IREFDERVQKAVG---------------
DNLJ_PELLD       ---PPVEHREPMLSLSNTYSIGE---------VEEFSARVGRLLEAEGI-----------
DNLJ_CHLPN       ---SVVSHKEPMLSIANSYSKEE---------LSEFFSRVEKSLGT--------------
DNLJ_CHLMU       ---PVVPHSHPMVSIANVYSLEE---------LEEFFSRTEKLLGY--------------
DNLJ_PARUW       ---KTVAHRTPMLSLANTYSKEE---------IEDFIKRLQKLVGKR-------------
DNLJ_RHOMR       ----KVRHPEPLLSLNNAFGEED---------VRVWYERCCRMLAERLG-----------
DNLJ_RUBXD       ----EVRHAVPMLSLQNARRVEE---------LREWDARVRRLLGPE-------------
DNLJ_ROSS1       ----KVQHVVPMLSLANASDEAE---------VRAWYDRVVRLLGND-------------
DNLJ_THEFI       ----PVRHPTRMYSLDNAFTYEE---------VLAFEERLERALG---------------
DNLJ_DEIRA       ----PVTHPTQMTSLDNVFDDDE---------LRDWQEKLARSLGLPL------------
DNLJ_DEHMC       ----IVNHPYPLLSLANAFSDTE---------LEAWYQRVKKLLGNI-------------
DNLJ_DESAG       ----PREHSLRMYSLDNAFGIEE---------FREFVERVVRLEPDAP------------
DNLJ1_DESVV      ----KQAHTMRMYSLDNAFSRDE---------WGAFIQRMYNTLPETP------------
DNLJ_LAWIP       ----EQPHRQRMYSLDNVFSNDE---------WEGFLKRLANALPEVP------------
DNLJ_RHOBA       ----QVPHRVPMLSIDNTYSREE---------LAAAMERIEKSLEGES------------
DNLJ2_STRCO      -AEGDVPHTVPMLSLDNVFSPEE---------FTVWTASLARRIDREV------------
DNLJ1_NOCFA      VLHAPVRHSRPMLSLEKATTPEQ---------VAAFFERFPGQP----------------
DNLJ_PSYIN       ----TVPLPKKMLSTDKAYSFEE---------IKKWIDRLLKAAIEVGVSE---------
DNLJ_DESPS       ----TVELPMRMLSTDKAYDLES---------IRRWGRRIEKAAQEKGIDF---------
DNLJ_RUTMC       ----KVLLPEAMLSIDKAYSWDE---------ISKWIKRLEKSAMQISLDL---------
DNLJ_VESOH       ----KVLLPELMLSIDKAYSWNE---------MSKWIERLEKSGMLIGLDL---------
DNLJ_DESAL       ----EVRHPAPMLSTEKAYDKQS---------LERFVERVYKEAAQIGV-----------
                            : *                                              

DNLJ_TREDE       ------------------------------------------------------------
DNLJ_TREPA       ------------------------------------------------------------
DNLJ_THEFY       ------------------------------------------------------------
DNLJ_FRACC       ------------------------------------------------------------
DNLJ_SACEN       ------------------------------------------------------------
DNLJ_NOCSJ       ------------------------------------------------------------
DNLJ_ARTS2       ------------------------------------------------------------
DNLJ_CUTAK       ------------------------------------------------------------
DNLJ_CORJK       ------------------------------------------------------------
DNLJ_LEIXX       ------------------------------------------------------------
DNLJ_BIFLO       ------------------------------------------------------------
DNLJ_TROWT       ------------------------------------------------------------
DNLJ_RHORT       ------------------------------------------------------------
DNLJ_MAGSA       ------------------------------------------------------------
DNLJ_CHESB       ------------------------------------------------------------
DNLJ_BRADU       ------------------------------------------------------------
DNLJ_RHILO       ------------------------------------------------------------
DNLJ_BARBK       ------------------------------------------------------------
DNLJ_PARDP       ------------------------------------------------------------
DNLJ_MARMM       ------------------------------------------------------------
DNLJ_HYPNA       ------------------------------------------------------------
DNLJ_CAUVC       ------------------------------------------------------------
DNLJ_SPHAL       ------------------------------------------------------------
DNLJ_ZYMMO       ------------------------------------------------------------
DNLJ_RHOPB       ------------------------------------------------------------
DNLJ_GLUOX       ------------------------------------------------------------
DNLJ_PELPD       ------------------------------------------------------------
DNLJ_RICTY       ------------------------------------------------------------
DNLJ_ORITB       ------------------------------------------------------------
DNLJ_WOLTR       ------------------------------------------------------------
DNLJ_EHRRW       ------------------------------------------------------------
DNLJ_ANAPZ       ------------------------------------------------------------
DNLJ_NEOSM       ------------------------------------------------------------
DNLJ_PELUB       ------------------------------------------------------------
DNLJ_SPICI       ------------------------------------------------------------
DNLJ_MESFL       ------------------------------------------------------------
DNLJ_UREPA       ------------------------------------------------------------
DNLJ_MYCPE       ------------------------------------------------------------
DNLJ_MYCPN       ------------------------------------------------------------
DNLJ_MYCGA       ------------------------------------------------------------
DNLJ_MYCMO       ------------------------------------------------------------
DNLJ_MYCS5       ------------------------------------------------------------
DNLJ_MYCPU       ------------------------------------------------------------
DNLJ_MYCH7       ------------------------------------------------------------
DNLJ_FUSNN       ------------------------------------------------------------
DNLJ_LEPIC       ------------------------------------------------------------
DNLJ_BORBU       ------------------------------------------------------------
DNLJ_ONYPE       ------------------------------------------------------------
DNLJ_NITSB       ------------------------------------------------------------
DNLJ_SULDN       ------------------------------------------------------------
DNLJ_CAMHC       ------------------------------------------------------------
DNLJ_CAMJJ       ------------------------------------------------------------
DNLJ_WOLSU       ------------------------------------------------------------
DNLJ_HELHP       ------------------------------------------------------------
DNLJ_HELAH       ------------------------------------------------------------
DNLJ_CLOTE       ------------------------------------------------------------
DNLJ1_CLOAB      ------------------------------------------------------------
DNLJ_MARHV       ------------------------------------------------------------
DNLJ_ALCBS       ------------------------------------------------------------
DNLJ_IDILO       ------------------------------------------------------------
DNLJ_COLP3       ------------------------------------------------------------
DNLJ_SHEAM       ------------------------------------------------------------
DNLJ_SACD2       ------------------------------------------------------------
DNLJ_CHRSD       ------------------------------------------------------------
DNLJ_LEGPA       ------------------------------------------------------------
DNLJ_MAGMM       GLSDLGALVGRPGALEGVARDVTQRLNQTLSFVEPLQPPDTKSLLSSGRKAADILRRLRL
DNLJ_NITMU       ------------------------------------------------------------
DNLJ_JANMA       ------------------------------------------------------------
DNLJ_METCA       ------------------------------------------------------------
DNLJ_NITOC       ------------------------------------------------------------
DNLJ_COXBU       ------------------------------------------------------------
DNLJ_PSYCK       ------------------------------------------------------------
DNLJ_HYDCU       ------------------------------------------------------------
DNLJ_FRATN       ------------------------------------------------------------
DNLJ_DICNV       ------------------------------------------------------------
DNLJ_SODGM       ------------------------------------------------------------
DNLJ_BAUCH       ------------------------------------------------------------
DNLJ_BUCBP       ------------------------------------------------------------
DNLJ_BUCCC       ------------------------------------------------------------
DNLJ_BUCAI       ------------------------------------------------------------
DNLJ_WIGBR       ------------------------------------------------------------
DNLJ_BLOPB       ------------------------------------------------------------
DNLJ_BLOFL       ------------------------------------------------------------
DNLJ_BORA1       ------------------------------------------------------------
DNLJ_PSESM       ------------------------------------------------------------
DNLJ_RALSO       ------------------------------------------------------------
DNLJ_XYLFT       ------------------------------------------------------------
DNLJ_NEIG1       ------------------------------------------------------------
DNLJ_BDEBA       ------------------------------------------------------------
DNLJ_GEOSL       ------------------------------------------------------------
DNLJ_PELCD       ------------------------------------------------------------
DNLJ_SYNAS       ------------------------------------------------------------
DNLJ_SYNFM       ------------------------------------------------------------
DNLJ_MYXXD       ------------------------------------------------------------
DNLJ_ANADF       ------------------------------------------------------------
DNLJ_HALHL       ------------------------------------------------------------
DNLJ_NATPD       ------------------------------------------------------------
DNLJ_HALWD       ------------------------------------------------------------
DNLJ_SALRD       ------------------------------------------------------------
DNLJ_LISW6       ------------------------------------------------------------
DNLJ_STAS1       ------------------------------------------------------------
DNLJ_GEOSE       ------------------------------------------------------------
DNLJ_ENTFA       ------------------------------------------------------------
DNLJ_STRS2       ------------------------------------------------------------
DNLJ_LACS1       ------------------------------------------------------------
DNLJ_LACPL       ------------------------------------------------------------
DNLJ_OENOB       ------------------------------------------------------------
DNLJ_LEUMM       ------------------------------------------------------------
DNLJ_PEDPA       ------------------------------------------------------------
DNLJ_LACDB       ------------------------------------------------------------
DNLJ_SYMTH       ------------------------------------------------------------
DNLJ_MOOTA       ------------------------------------------------------------
DNLJ_DESHY       ------------------------------------------------------------
DNLJ_CARHZ       ------------------------------------------------------------
DNLJ_HUNT2       ------------------------------------------------------------
DNLJ_CALS8       ------------------------------------------------------------
DNLJ_CALS4       ------------------------------------------------------------
DNLJ_CLOD6       ------------------------------------------------------------
DNLJ_SYNWW       ------------------------------------------------------------
DNLJ_THEMA       ------------------------------------------------------------
DNLJ_AQUAE       ------------------------------------------------------------
DNLJ_SOLUE       ------------------------------------------------------------
DNLJ_KORVE       ------------------------------------------------------------
DNLJ_SYNE7       ------------------------------------------------------------
DNLJ_SYNJA       ------------------------------------------------------------
DNLJ_SYNY3       ------------------------------------------------------------
DNLJ_GLOVI       ------------------------------------------------------------
DNLJ_PROMT       ------------------------------------------------------------
DNLJ_PROMA       ------------------------------------------------------------
DNLJ_PARD8       ------------------------------------------------------------
DNLJ_PORGI       ------------------------------------------------------------
DNLJ_GRAFK       ------------------------------------------------------------
DNLJ_CYTH3       ------------------------------------------------------------
DNLJ_PELLD       ------------------------------------------------------------
DNLJ_CHLPN       ------------------------------------------------------------
DNLJ_CHLMU       ------------------------------------------------------------
DNLJ_PARUW       ------------------------------------------------------------
DNLJ_RHOMR       ------------------------------------------------------------
DNLJ_RUBXD       ------------------------------------------------------------
DNLJ_ROSS1       ------------------------------------------------------------
DNLJ_THEFI       ------------------------------------------------------------
DNLJ_DEIRA       ------------------------------------------------------------
DNLJ_DEHMC       ------------------------------------------------------------
DNLJ_DESAG       ------------------------------------------------------------
DNLJ1_DESVV      ------------------------------------------------------------
DNLJ_LAWIP       ------------------------------------------------------------
DNLJ_RHOBA       ------------------------------------------------------------
DNLJ2_STRCO      ------------------------------------------------------------
DNLJ1_NOCFA      ------------------------------------------------------------
DNLJ_PSYIN       ------------------------------------------------------------
DNLJ_DESPS       ------------------------------------------------------------
DNLJ_RUTMC       ------------------------------------------------------------
DNLJ_VESOH       ------------------------------------------------------------
DNLJ_DESAL       ------------------------------------------------------------
                                                                             

DNLJ_TREDE       ---------EYIVQYKMDGASLELQYEEG-HFVRAVTRGDGKIGDDITENVLKMKGLIKD
DNLJ_TREPA       ---------AFLVQHKLDGVSLELQYERG-HFCCALTRGNGIVGDDVTANVRGMRGFVPT
DNLJ_THEFY       ----EVPVDAFLCELKIDGLAVALVYEKG-RLVRAATRGDGRIGEDITLNIRTIDT----
DNLJ_FRACC       ----ESEVDAWLCELKIDGLAVDLVYEDG-YLVRAATRGDGRTGEDITPNIRTLAS----
DNLJ_SACEN       ---EVGSSAHYLCELKIDGLAINLLYRDG-KLERALTRGDGRTGEDVTLNVRTMDD----
DNLJ_NOCSJ       ---DGVEDPALLCELKVDGLAINLLYEEG-RLVRALTRGDGTTGEDVTSNVKTITS----
DNLJ_ARTS2       ---NGTAGPAWLTELKIDGLAVNLLYRDG-KLVRAATRGDGYTGEDITHNVLTIKE----
DNLJ_CUTAK       ---AVGKIPNFLCELKIDGLAVDLVYRDG-QLVSGATRGDGRIGEDVTANVRTIAA----
DNLJ_CORJK       --------KTYLTELKIDGASINLLYIDG-QLELALTRGDGTTGEDITHNARTLDD----
DNLJ_LEIXX       ---DAGRRVDYLCELKIDGLAINLRYENG-VLVTAATRGDGVVGEDVTENIRHIPA----
DNLJ_BIFLO       ----ESKPLPMSCEVKIDGLALNLIYRNG-VLEQGLTRGDGVTGEDITLNVRTIGS----
DNLJ_TROWT       ----EGDQCTFVCELKIDGVGVSLRYANG-YLISAATRGDGAIGEDITQNMLYVPS----
DNLJ_RHORT       -----ETTISYVAEPKIDGLSFSARYENG-VYRRAATRGDGTTGEDITANLATLTD--LP
DNLJ_MAGSA       -----EAPLAYVAEPKIDGLSINLRYEGG-RFVSAATRGDGAEGEDVTRNLETFPA--TQ
DNLJ_CHESB       -----HAPIAMTAEPKIDGLSLSIRYENG-RLVSAATRGDGQVGENVTANARAVAD--IP
DNLJ_BRADU       -----DDKIDFSAEPKIDGLSMSLRYEGG-ELVTAATRGDGAEGEDVTANIRTLED--VP
DNLJ_RHILO       -----DLDIAFTAEPKIDGLSASLRYENG-VFVQGATRGDGAVGEDITANLRTIAD--IP
DNLJ_BARBK       -----TKTLEMTAEPKIDGLSLSLRYEKG-KLVCAATRGDGYVGENVTVNARTLSD--IP
DNLJ_PARDP       -----GAPLEVTAEPKIDGLSLSLRYEGG-RLVQAATRGDGAVGENVTANARTIAD--IP
DNLJ_MARMM       -----SDVVAVTAEPKIDGLSASLRYVGG-KLVHGATRGDGQTGEDVTQNLLTLDD--IP
DNLJ_HYPNA       -----EETLAFTAEPKIDGLSLSLTYENG-KLMRAATRGDGQTGEDVTANARTLGD--IP
DNLJ_CAUVC       -----SETVAYTAEPKIDGLSASLRYEKG-VLVQGATRGDGRVGEDVTANLRTIAD--IP
DNLJ_SPHAL       -----GEPLAFTAEDKIDGLSCSLRYEKG-VLVQAATRGDGTVGEDVTPNVRTIAD--IP
DNLJ_ZYMMO       -----NQAVICTVEPKIDGLSCSLRYEKG-ILTQAVTRGDGVIGEDVTPNVRVIDD--IP
DNLJ_RHOPB       -----EQIPAIVAEPKIDGLSLSLRYEHG-KLVRAATRGDGFTGEDVTANVRTIKD--IP
DNLJ_GLUOX       ----GLQALQFVAEPKIDGLSISLTYEHG-HFVRGTTRGDGIEGEDVTANLLTLKD--IP
DNLJ_PELPD       ----DAISIDIVAEPKIDGLSCSIRYEKH-QLVRAATRGDGLEGEDITVNVHSISE--IP
DNLJ_RICTY       -----FTP--IFCEPKIDGLSFSAIYKHG-LFITGATRGDGYVGEDITINIKTIKN--FP
DNLJ_ORITB       -----CPK--IVCEYKIDGLSFNARYEYG-VLTLASTRGDGQIGENITENLKTIQS--FP
DNLJ_WOLTR       -----IE---VFCEPKIDGLSFSAVYEDG-RFVKAATRGDGFIGEDVTRNVATIKG--FP
DNLJ_EHRRW       -----NESLCFSCELKIDGLSFSIIYKNG-KLFQASTRGNGYFGENITNNVKTIEN--LP
DNLJ_ANAPZ       -----EVSITIACEPKIDGLSFAALYEKG-SLIRVATRGNGHLGEDITNTAKVIRK--LP
DNLJ_NEOSM       -----ALE--FLCEPKIDGVSFSARYVNG-KLVSCATRGDGKIGENIIDNMKVING--FP
DNLJ_PELUB       -----VNTIEYSAEPKIDGISASLIYIDG-KLTKGLSRGDGNEGEDITQNLKTIKD--IP
DNLJ_SPICI       ------PEIEYTCELKIDGLSISLVYDNH-VLVMGATRGDGLTGEDVTINIKQIKS--IP
DNLJ_MESFL       ------ENNEYTAELKIDGLSISLIYKDG-VLQKGVTRGDGKVGENVTTNVKTIKS--IP
DNLJ_UREPA       ------L-KGYVVEPKIDGLSISIIYKNA-KLHQAITRGDGINGEDVTSNILTIKD--IP
DNLJ_MYCPE       ------SDFSYVVEPKIDGLSISVKYKDG-NLIQAVTRGDGEIGEDVTQNIKTIKS--LP
DNLJ_MYCPN       ------Q-NRFVVEPKIDGVSISLTYENG-LLTRALTRGDGLVGEDVLSNVKTIKS--IP
DNLJ_MYCGA       ------EDNPYVLEPKIDGLSISLIYLDG-VLSEALTRGDGVFGESVIANIKTIKT--IP
DNLJ_MYCMO       ------PNY--FLELKIDGLSISLKYDNG-NLIQALTRGDGISGEDVTENVFQIQD--IP
DNLJ_MYCS5       ------ENFGFSLEPKIDGLSISIHYDNG-KFIKAITRGDGTTGEDVSENVFQIRD--VP
DNLJ_MYCPU       ------NHQ-YILQEKIDGVSISLYYENG-ILTKALTRGDGIYGENVTHNALNIKD--IP
DNLJ_MYCH7       ------VTF--FVEPKIDGIALSLFYQNG-NLIKALTRGDGVFGENVLVNALKINDEFIP
DNLJ_FUSNN       ------QELKYCLEVKLDGLSISLTYRQG-KLVRAVTRGDGFIGEDVTENILEIAS--IV
DNLJ_LEPIC       ------GLY--SVEWKIDGASIVLYYENG-ILKNGVTRGSGGIGDDVTDNIRTIRN--IP
DNLJ_BORBU       ------NSFNISVEPKIDGCSIVLYYKDG-VLEKALTRGNGKFGNDVTINVRTIRY--IP
DNLJ_ONYPE       ------PTFSLLTELKIDGVAISLKYQKG-ILVQALTRGNGIWGEDITKNAQTIKT--IP
DNLJ_NITSB       -------DLQFYIEPKFDGASLNLIYENG-LLKSAATRGDGEVGEDVTANAKTIPS--IP
DNLJ_SULDN       -------NISFYCEPKYDGASLNLIYENG-ELSQAITRGDGEVGELITQNVKTIRS--VP
DNLJ_CAMHC       ----------FFVEPKFDGASLNLTYENG-VLISAGTRGNGETGENVTQNVKVINS--IP
DNLJ_CAMJJ       ----------FFIEPKFDGASLNLLYENG-KLVSGATRGDGEVGEDITLNVFEIEN--IP
DNLJ_WOLSU       --------ATFVCDPKFDGASLNLLYEEG-RLVRAATRGDGLIGEDVTQNARTIPS--IP
DNLJ_HELHP       --------ATFTCSPKFDGASLNLLYQEG-KLVSATTRGDGVIGELVTHNAKTIQS--IP
DNLJ_HELAH       --------ASFVCSPKLDGVSLNLLYQKG-KLMKATTRGNGLEGELVTTNAKHVAN--IS
DNLJ_CLOTE       ----TLPMPTYILTKKFDGLTVNCTYDESGILVKGATRGTGIIGEDITSQVKTIKC--LP
DNLJ1_CLOAB      ----KLPSPQFVVTQKLDGLTINCSYNES-RLIKSATRGTGEIGEDITEQSKTILN--LP
DNLJ_MARHV       -------AIEYVCEPKLDGLAVSLHYENG-TLTRAATRGDGYTGEDITANIRTIPS----
DNLJ_ALCBS       -------IIDYVAEPKLDGLAVSLLYENG-ELVRAATRGDGQTGENITVNARTIRS----
DNLJ_IDILO       -------TVTFCCEPKLDGAAVSLLYENG-LLVRGATRGDGQSGEDITENVKTIRN----
DNLJ_COLP3       -------AIVFCAEPKLDGLAVSLRYEHG-QLIQAATRGDGSVGENITTNIRTIKS----
DNLJ_SHEAM       ---------VYCAEPKLDGLAVSLIYRNG-VLERAATRGDGAVGEDISVNMRTIKS----
DNLJ_SACD2       -------SLEYSCEPKFDGIAASLLYENG-RLKTAATRGDGTVGEDITQNMRTIGS----
DNLJ_CHRSD       -------TLAFCCEPKLDGLAVALVYENG-RLVQGATRGDGRTGEDVTLNLRTIRS----
DNLJ_LEGPA       -----NQQLVFACEPKLDGLAVNMTYEGG-ILTHAATRGDGAVGENITANIKTIAS----
DNLJ_MAGMM       WAAEQPQRVEYVAEPKLDGLAFSLTYAEG-VLVRAATRGDGQEGEDVTAHARTIQD----
DNLJ_NITMU       --------VEYAVEPKFDGLAISLCYENG-MLVSGATRGDGYIGEDVTLNLKTIRS----
DNLJ_JANMA       --------IEYATELKFDGLAINLRYEDG-ILVEAATRGDGATGENVTTNIRTVRA----
DNLJ_METCA       --------LEYVAEPKLDGLAVNLLYQDG-VLVRAATRGDGEVGEDVTHNVRAVRA----
DNLJ_NITOC       --------VDYAAEPKLDGLAVSLLYQDG-VLVQGATRGDGITGEDITHNIRTIPT----
DNLJ_COXBU       -------PFEYVCEPKMDGVALSLLYENG-ELIRAATRGDGYTGENVTQNTRTIAS----
DNLJ_PSYCK       -------SPEYEMELKLDGLAVSLKYAYG-KFVQAVTRGDGQTGEDITQNAKTIRN----
DNLJ_HYDCU       -------SLAFSAEPKMDGLAINIRYENG-QLVQATTRGDGQVGEDVTHNIRPIYS----
DNLJ_FRATN       ---------ELECEPKMDGLAISIFYKNG-KFDYAVTRGDGIQGEKVSENVKTIRN----
DNLJ_DICNV       -------AISLIAEPKFDGLAINLRYENG-ILQRASTRGDGITGEDVTQNVRTIST----
DNLJ_SODGM       --------MTYCCELKLDGLAVSLLYENG-ELVRAATRGDGATGEDITANVRTIRT----
DNLJ_BAUCH       --------LTYCCELKFDGIAVSLLYKHG-KLIRAATRGDGHIGEDVTDNIRTICS----
DNLJ_BUCBP       -------KIFFCSELKFDGVAINLIYING-LLFRAVTRGNGYEGEDVTSNVNMISS----
DNLJ_BUCCC       -------VITYFCDFKFDGLAVNLFYKNG-ILISASTRGNGSVGENITKNILMISS----
DNLJ_BUCAI       -------PLSFCCELKLDGVAISIIYEEG-IFVRAATRGDGFEGENITSNARMIDS----
DNLJ_WIGBR       -------KRYYCCELKIDGLAINLIYKNG-ILDSASTRGDGLQGEDVTKNALEIKS----
DNLJ_BLOPB       -------VMSYCCELKIDGVAVSLLYKEG-KLIYAATRGDGKIGEDVTENISTIRA----
DNLJ_BLOFL       -----QNLIVYCCELKIDGVALSILYKQG-KLVHAATRGDGKIGENVTKNVNAIDS----
DNLJ_BORA1       -----AEQAHYFCELKLDGLAISLRYENG-ELVQAATRGDGQEGEDVTANIRTIRA----
DNLJ_PSESM       -----GGKVQYSCEPKLDGLAVSLLYRDG-ALVRGATRGDGTTGEDISVNVRTVRN----
DNLJ_RALSO       --------VEYAAELKFDGLAINLRYEKG-FLVQAATRGDGATGEDVTQNIRTIRQ----
DNLJ_XYLFT       ----------FSAEPKLDGLAISLRYQNG-IFIQGATRGDGVTGEDVTANLRTLPT----
DNLJ_NEIG1       ----------YVIEPKFDGLAISLLYRDG-VLVQAATRGDGTTGEDVTRNVKTVSN----
DNLJ_BDEBA       -------PVEYLCELKFDGLSMELIYENG-QLVRAITRGDGTVGEDVTHNIKTIKS----
DNLJ_GEOSL       ------VEIDYVCEPKMDGLAVELVYERG-ILTVGSTRGDGVVGENVTHNLKTVRG----
DNLJ_PELCD       ------APVRYVCELKMDGVAVELVYRDG-ILSVGSTRGDGTTGEGITENLRTIPS----
DNLJ_SYNAS       ------ERLSFVVEPKIDGVAVNLIYSSG-VLTTGATRGDGAKGEDVTQNIRTLHT----
DNLJ_SYNFM       ------GDVDFMAEPKMDGLAVELVYENG-ELTGAGTRGDGYVGEDVTRNAKTIRA----
DNLJ_MYXXD       --------IAYVCEPKLDGLAIALRYEKG-AFVQGATRGDGTTGEDVTSNLRTIRS----
DNLJ_ANADF       ------VQVGYVAEPKLDGLAVELVYEGG-RLVQGSTRGDGVNGEDVTANLRTVGR----
DNLJ_HALHL       --------VVYTGEPKLDGISLSLTYQDG-ELVRAGTRGDGHTGEDVTANVRTLRS----
DNLJ_NATPD       ------GPVRYLCEPKFDGLSVELVYEEG-ELSRAATRGDGQEGDDVTANVRTIRS----
DNLJ_HALWD       ------GDLEYICEPKFDGLSVEVIYEDG-EYIRAATRGDGNRGDDVTAQVETVGA----
DNLJ_SALRD       ------ETVTYIAEPKFDGLAVELIYEDG-RLVQGATRGDGETGEEITANVKTIKG----
DNLJ_LISW6       --------IAYMCELKIDGLAVSLQYENG-KYKQGATRGDGTVGEDITANLRTIRS----
DNLJ_STAS1       --------VEYMCELKIDGLAVSLKYENG-RFVQGLTRGDGTTGEDITENLKTIHA----
DNLJ_GEOSE       --------AAYVCELKIDGLAVSVRYEDG-YFVQGATRGDGTTGEDITENLKTIRS----
DNLJ_ENTFA       --------VAYCCELKIDGLAISLRYENG-VFVRGATRGDGTVGENITENLRTVRS----
DNLJ_STRS2       --------ATYICELKIDGLSISLTYEAG-NLVVGATRGDGSVGENITENLKRVAD----
DNLJ_LACS1       --------LDYSCELKIDGLAISLTYENG-KFIKGSTRGNGVIGEDITENLKTIKA----
DNLJ_LACPL       --------VDYNCELKIDGLALSLRYEDG-VLVQGSTRGNGTVGEDITANIKTIKS----
DNLJ_OENOB       --------QKYNLELKIDGLAISLRYENG-RLIQASTRGDGSIGENVTDNVKTITE----
DNLJ_LEUMM       --------APYNLELKIDGLAVALTYVDG-QLVQASTRGNGIVGEDVTANVKTIKA----
DNLJ_PEDPA       --------VDYNVELKIDGLAISLIYQDG-ELIQGSTRGDGNIGEDITKNLKTIKS----
DNLJ_LACDB       --------VAYNVELKIDGLSLSLEYEEG-RLKRASTRGNGQVGEDVTKNVKYIKD----
DNLJ_SYMTH       --------VSYVCELKIDGLSISLRYEDG-LFVQGATRGDGETGEDVTENLRTIGS----
DNLJ_MOOTA       --------VEYVIEAKIDGLAVALTYRDG-LFTLGATRGDGQVGEEVTANLKTIPA----
DNLJ_DESHY       --------VEYVVELKIDGLTVALTYEDG-ALVRGATRGDGEVGEEITANLKTIPA----
DNLJ_CARHZ       --------VEYEVELKIDGLAISLVYENG-VLVRGATRGNGTTGEDITANVKTIKA----
DNLJ_HUNT2       --------VEYVVEKKIDGLSVSLVYENG-VFTRGATRGDGLVGEDVTQNLKTIRT----
DNLJ_CALS8       --------FNYVVEYKIDGLSVALEYENG-LFVRGATRGDGNVGEDVTENLKTIRS----
DNLJ_CALS4       --------VEYVVEPKIDGLSVELVYENG-MFTVGSTRGDGIVGENVTPNLKTIKS----
DNLJ_CLOD6       --------VEYVVEFKIDGLSVGLTYNNG-EFEKGATRGDGVVGEDISQNLMTVKS----
DNLJ_SYNWW       --------LSYMAELKIDGVSIALVYENG-VLLNAATRGDGLVGEDVTANIRTIKT----
DNLJ_THEMA       --------VEYVAELKIDGVSIALRYENG-RFVLGATRGDGIEGEDVSENVKTVRS----
DNLJ_AQUAE       --------VEYAVEPKLDGAGIALVYEND-LFVRGATRGDGEYGEDITNNLKTIKT----
DNLJ_SOLUE       --------FRYVTELKMDGLSMAAHYNNG-KFTEAVTRGDGTTGEDVTENARTIRS----
DNLJ_KORVE       --------IEYECELKLDGLSMALRYQDA-RFVLAVTRGDGSIGEDVTLNLRTVKS----
DNLJ_SYNE7       ---------GYVCELKIDGAAIALSYENG-LLVRGATRGDGTRGEEITANLRTIKS----
DNLJ_SYNJA       --------LEYVCELKIDGAALALTYVDG-LLQRGATRGDGQSGEDITPNIRAIPS----
DNLJ_SYNY3       ----------YVCELKIDGSAIALTYENG-LLVRGVTRGDGTTGEEISQNIKTIRS----
DNLJ_GLOVI       --------LEFICELKIDGSATALSYEDG-VLVRGATRGDGVEGEEITQNLRTIRA----
DNLJ_PROMT       ----KVYDPELICELKIDGNAISLRYENG-ILTRATTRGDGKTGEDITTNIRTIST----
DNLJ_PROMA       ---------AMVCELKIDGNALALSYVNG-VLTRGATRGDGAEGEEITANVKTIVS----
DNLJ_PARD8       ------EPFEIVAELKYDGTSISLTYEKG-RLTRAVTRGDGTRGDDVTANIKTIRS----
DNLJ_PORGI       ------APFEIVAELKFDGLSISLIYEDG-MLVRAVTRGDGIMGDDVTANVRTIRS----
DNLJ_GRAFK       ------GKIQYVCELKYDGASISLTYENG-ILKRAVTRGDGFQGDDVTNNIKTIRS----
DNLJ_CYTH3       ------HAVEYVCEMKFDGVAISITYKNG-MIAQAVTRGDGVRGDDVTNNIKTIKS----
DNLJ_PELLD       ------RDRDMVAELKFDGVAVSLLYRDG-VLVRGATRGNGRRGDDITVNLRTVPT----
DNLJ_CHLPN       -------SPRYTVELKIDGIAVAIRYEDR-VLVQALSRGNGKQGEDITSNIRTIRS----
DNLJ_CHLMU       -------FPTYSLELKIDGIAVAIRYENR-TFAQALSRGNGVKGEDITANVSTIRS----
DNLJ_PARUW       -------QVEFSVELKMDGIAITAIYEQG-IFKRGITRGNGKRGDDITTNMRMIEN----
DNLJ_RHOMR       ----QPVQPAVTAELKIDGLAMALTYENG-VLSVGATRGDGIEGENVTQNVRTIPA----
DNLJ_RUBXD       ----EEGRLRYVTELKIDGLAVSLRYENG-RLVRGATRGNGFVGEDVTRQLRTIRS----
DNLJ_ROSS1       ------ARVAFVVEPKIDGLAVTLIYRNG-ILVRGATRGDGETGEDVTANLRTIPG----
DNLJ_THEFI       ----RKRPFLYTVEHKVDGLSVNLYYEEG-VLVFGATRGDGEVGEEVTQNLLTIPT----
DNLJ_DEIRA       ----DTDDFTFTGELKIDGLSVNLYYLDG-ELQWAATRGNGRVGEIVTAQVLTIPD----
DNLJ_DEHMC       -------SFQIDCEPKMDGLAVALTYRNG-KFATGATRGDGFQGENITRNLRTIHS----
DNLJ_DESAG       --------LEFWVDPKMDGLAMELVYENG-VFLLAVTRGDGSMGEDVTHTMRTVRN----
DNLJ1_DESVV      --------SSFWCDPKMDGLALEVIYENG-VFTSALTRGNGAEGEVVTAAMRTVRN----
DNLJ_LAWIP       --------FSFWCDPKMDGLALELIYEKG-QLTSALTRGDGDIGEVVTEAVRTISN----
DNLJ_RHOBA       --------VAWTMEYKIDGVAGSIRYENG-ELTLALTRGNGQVGDDITHNVRTIRELPRS
DNLJ2_STRCO      --------TRFSVGPKLDGLAVAARYREG-RLTRLITRGDGTAGEDVSHAIGTVEG----
DNLJ1_NOCFA      ----------VVVMPKLDGLSLALVYEDG-RLVRAVTRGDGTTGDDVTMLVRALVD----
DNLJ_PSYIN       ------SEIQIKVTPKLDGYAAY---DDG---ISLYTRGDGARGQDITRAFNKGLQVA--
DNLJ_DESPS       ------TSLVFRGTPKLDGFAAY---DDG---RRLYTRGDGKKGTDVSRAFARGLQVS--
DNLJ_RUTMC       ------SAIQIKATPKLDGFSGF---DDG---SRLYTRGDGKKGSDISRVFERGLCVF--
DNLJ_VESOH       ------NAIQIKATPKLDGFAGF---DDG---NRLYTRGDGKKGSDISRVFKRGLCVF--
DNLJ_DESAL       ------TDVLFQVTPKLDGLAAR---DDG---QILATRGNGYAGYDITNALEKGVIP---
                                * **                 :** *  *  :             

DNLJ_TREDE       ITVNAGPAY-----------------GTKPFSGGIRCEVIMLRSIHQKYFKDK-------
DNLJ_TREPA       LTAEWGPC------------------GNLPFTGGVRGEVIMHKDIHRSHYPTH-------
DNLJ_THEFY       ----VPLRLDESRY-------------PAPELLEVRGEVFLPVKAFEQLNSRLADEG---
DNLJ_FRACC       ----VPVRLRGPR---------------VPGLLEVRGEVFFPTAKFAELNAGLVAVG---
DNLJ_SACEN       ----VPDQLTGTDEY------------PVPALVEIRGEVFFRVDEFAQLNASLVEAG---
DNLJ_NOCSJ       ----VPHRLTGTDEF------------PVPALVEVRGEVFLPVEAFERLNESLLEAG---
DNLJ_ARTS2       ----IPQQLTGGN---------------YPAEMEVRGEVFIPSKAFAEYNEALIEAG---
DNLJ_CUTAK       ----IPRKLTGDD---------------VPRLLEVRGEVFFPVADFTDLNAALIEAG---
DNLJ_CORJK       ----IPDTLHGTDEF------------PVPELVEIRGEVFIDVEDFAAMNAQRQAEG---
DNLJ_LEIXX       ----ITQRLSGAG--------------PFPPVVEVRGEVFFPVAKFEELNANQQAAG---
DNLJ_BIFLO       ----IPANLGGPKE-------------DVPDFVEIRGEVFMRWDDFHTLNNEQEDAG---
DNLJ_TROWT       ----IPPRI------------------ALPGIFEIRGEAFIKRDEFDRINQLSLERS---
DNLJ_RHORT       QRLTGDG--------------------PVPEVLEVRGEVFMTKADFRALNQRQIDAGA--
DNLJ_MAGSA       LPRTLGP--------------------DAPAVIEIRGEVYMTKADFLALNQRQEAAGE--
DNLJ_CHESB       NVLSG----------------------DFPEILEVRGEVYMTHRDFLALNERQRAEGK--
DNLJ_BRADU       QKLKGR---------------------NVPDICEVRGEVYMTKKAFLALNERQKAAGD--
DNLJ_RHILO       AKLKGS---------------------GWPDVIEIRGEVYMTYAEFEALKARSAAAGG--
DNLJ_BARBK       QVLQG----------------------DFPDILEVRGEVYMRHSDFQDLNVDQQEKGK--
DNLJ_PARDP       GQLSGD---------------------GYPEVLEIRGECYMSHEDFEKLN---QSETG--
DNLJ_MARMM       DTLPPG---------------------DWPDVVEVRGEVYMSHADFAALNERQIEAGK--
DNLJ_HYPNA       VKLKGK---------------------GWPERIEVRGEVYMAKSAFADLNAREAEAGR--
DNLJ_CAUVC       HRLKGS---------------------GWPDVIEVRGEVYVELAAFAAFNKAAEEAGQ--
DNLJ_SPHAL       QNLKGD----------------------IPDIFEIRGEVYMAKADFAALNARLLAEADDP
DNLJ_ZYMMO       KTLKGD---------------------NWPEIIEIRGEVYMAKSDFAALNARQTEENK--
DNLJ_RHOPB       HALAVA---------------------EPPAACELRGEVYMLKSDFLALNQRQETAGE--
DNLJ_GLUOX       RELPGE----------------------APERVEIRGEVFLSKSSFLTLNEQQVARGA--
DNLJ_PELPD       KILPLD----------------------APEVIEIRGEVYMSNSDFKQYTAQQNKIGE--
DNLJ_RICTY       HKI---D--------------------NAPEFLEVRGEIYIEKQDFVNLNKEQEAQNR--
DNLJ_ORITB       QTL---P--------------------ITDKVFEVRGEIYITNNDFRVLNIQQQKLGK--
DNLJ_WOLTR       RFL---Q--------------------DVQDRLEVRGEIYINNSDFLKLNKDNE------
DNLJ_EHRRW       HTI---Q--------------------NAPDFLEVRGEVYIDRNDFIQLNNEGKN-----
DNLJ_ANAPZ       HKI---A--------------------NAPEVLEVRGEIYMHHSDFEKL-KDVCN-----
DNLJ_NEOSM       IEI---M--------------------DVPDLLEVRGEVFLDHDTFQTLEG---------
DNLJ_PELUB       LEITK-S--------------------NFPKEIDIRGEVFIENNDFKKIKDK--------
DNLJ_SPICI       LRI-DQ------------------------PTLIVRGEVYLSVEEFNKINEERVKN----
DNLJ_MESFL       LSIPSK------------------------DEIEIRGEVFLGKKEFAKINEERLLN----
DNLJ_UREPA       HYIDQKY---------------------KDYEIEVRGEVYMAFHDFYEMNDNLEES----
DNLJ_MYCPE       LNIEY------------------------DKDLEIRGEVFLTKKDFEKINSDPN-L----
DNLJ_MYCPN       LTIPFH------------------------KQVEIRGEIFVDKKTFAQINENLA------
DNLJ_MYCGA       LKINTTI-----------------------KKIVIRGEVYVSNQDFEAINASRD-E----
DNLJ_MYCMO       KQIKYS------------------------KPIEIRGEIYLSKSTFYEINECQKSQ----
DNLJ_MYCS5       KQISYL------------------------KPLEVRGEIYMKKSTWKSLNEDIKNQYFQT
DNLJ_MYCPU       KTINIK------------------------ENIELRGEIFFSLKLFESLKNEFLDK----
DNLJ_MYCH7       KKINYL------------------------EDLEVRGEIYIDNSTFASLQLETKKFKNP-
DNLJ_FUSNN       KTLPQA------------------------IDMEIRGEVVLPLASFEKLNNERLEK----
DNLJ_LEPIC       LRLPEP------------------------ITVYLRGEVFMTFKDFEEFNALSSGK----
DNLJ_BORBU       LFLDEK------------------------VDLVLRGEVYITKENFLKINKFLEKP----
DNLJ_ONYPE       LRLKED------------------------LDLEVRGEIYLSHPAFEKLNAQRKQEN---
DNLJ_NITSB       LGIDYK------------------------GLIEIRGEVVIRKDDFEKLNHERALK----
DNLJ_SULDN       LSIEHK------------------------EKIEIRGEVVIFKDEFEKINQTRLKD----
DNLJ_CAMHC       LQIDYK------------------------EKIEIRGEVVIAKSDFDALNDERANS----
DNLJ_CAMJJ       KNIAYK------------------------ERIEIRGEVVILKDDFEKINEKRALL----
DNLJ_WOLSU       LSIPLL------------------------ERIEIRGEVVIPKEDFEKLQEERLRE----
DNLJ_HELHP       LEINYK------------------------EEIEIRGEVVIAKEDFEYINQDRLSE----
DNLJ_HELAH       HTIPYN------------------------EEIEIRGEVIISKEDFNALNEERLNA----
DNLJ_CLOTE       LRIANN------------------------NLIEVRGEAIMTKEAFDKYNEK--------
DNLJ1_CLOAB      NAINYS------------------------GEIDVHGEALMTKNALEQYNSNLKV-----
DNLJ_MARHV       ----VPLKLRG---------------SGYPDLVEVRGEVYMPRAGFEKLNERLAEQG---
DNLJ_ALCBS       ----VPLKLRG---------------NDVPKRLEVRGEVVMPHAGFEELNARQQEAG---
DNLJ_IDILO       ----VPLKLSG----------------DVPERLEVRGEVVMPLGAFERFNEQARQRE---
DNLJ_COLP3       ----IPLKLMGTPG------------KDFPDIVEVRGEVFMPKASFDALNTLAKKRG---
DNLJ_SHEAM       ----VPLRLQG---------------DDIPALVEVRGEVFMPRAAFEALNDRARAKG---
DNLJ_SACD2       ----VPLKLEG---------------NNIPAVLEVRGEVYMPKAGFLRINEEALAKN---
DNLJ_CHRSD       ----IPLKLRG---------------DSIPPLIEVRGEVYMRHSGFEALNDRARENG---
DNLJ_LEGPA       ----VPLRLRVS---------------NPPKLIEVRGEVYIPKADFEAYNARARELG---
DNLJ_MAGMM       ----VPLRLQGA---------------GYPALLEVRGEVYMPLATFEKLNAEARERG---
DNLJ_NITMU       ----IPLGLRAGDG-----------SAEVPAFLEVRGEVLMLKADFERLNRQQREKN---
DNLJ_JANMA       ----IPLRLHT---------------ATPPKVLDVRGEVMMYKADLAKLNARQRDAG---
DNLJ_METCA       ----IPLRLKG---------------EDFPDRFEARGEVFMPKRGFLALNERARRSG---
DNLJ_NITOC       ----VSLRLRG---------------EKIPSLLEVRGEVYMPRQGFEQFNREQIAKG---
DNLJ_COXBU       ----VPLQLRG---------------NDYPELVEIRGEVLMPREGFAKFNREAEKRG---
DNLJ_PSYCK       ----LPLWIPA---------------ASDIELLEVRGEVLMPKAGFERLNRLAEEKG---
DNLJ_HYDCU       ----VPLKLFGN---------------NWPEVVEVRGEVFMSKSAFEQLNEHQQEIG---
DNLJ_FRATN       ----VPLKLNTS---------------NPPEELEVRGEIILDKQSFLSLNEYMQTHE---
DNLJ_DICNV       ----IPLRLNTH---------------TPPDVIEIRGEIYMPKKAFYALNEQAAANG---
DNLJ_SODGM       ----IPLRLQD--------------HDNLPRLLEIRGEVFMSEAGFLRLNETAKREG---
DNLJ_BAUCH       ----IPLQLKD--------------DGHIPRLIEIRGEVIMSEDAFRHLNETAKKNK---
DNLJ_BUCBP       ----VPKKLI---------------GIDIPETLEVRGEIFMLKSDFKKLNVRLTKFK---
DNLJ_BUCCC       ----IPKKIA---------------GSNIPKKIEIRGEIFMRKSDFFILNQSCKLSG---
DNLJ_BUCAI       ----IPLKLK---------------GIDIPKRLEIRGEVFMLKSNFIKLNKKYKLNQ---
DNLJ_WIGBR       ----IPHILKK-------------NNLSFPKKIEIRGEVFIKLSTFNKINKMLKSKR---
DNLJ_BLOPB       ----VPMCLKIDSN----------KYGKLPYLLEIRGEVFISKLCFLELNKITIQQG---
DNLJ_BLOFL       ----IPKNLKKNNN------------EILPDLLEIRGEIFISKLSFSKLNQEMLSSG---
DNLJ_BORA1       ----IPLQLRA----------------GAPAVLEVRGEVLMNRADFEKLNQKQAARG---
DNLJ_PSESM       ----IPLKLQGK---------------GWPELLEVRGEVFMSKAGFERLNASQLEVG---
DNLJ_RALSO       ----IPLGLRPVG-------------GAVPDVLEVRGEVYMRRDDFERLNARQRERG---
DNLJ_XYLFT       ----IPQRLQS---------------DTWPTVLEVRGEVYMPRPDFEAYNTQARLRG---
DNLJ_NEIG1       ----IPLRLHG---------------ENVPELIEVRGEVLMLKADFAALNQRQTENG---
DNLJ_BDEBA       ----IPLKLSHK---------------NPPPLLEVRGEVLMFKEDFARLNETQQENG---
DNLJ_GEOSL       ----IPLRL---------------RCEQPPELLEVRGEVYLPLAAFQRLNAQREEEG---
DNLJ_PELCD       ----IPLVL---------------SGE-APALLEVRGEVYIDLDDFQKLNHEREEEG---
DNLJ_SYNAS       ----IPLKIQNG------------SDERLPEQIEIRGEIYMETAAFRKLNERRLAAG---
DNLJ_SYNFM       ----IPLKLYAGA-----------GGASPPARIAVRGEVYMDRKDFAALNRSREQAG---
DNLJ_MYXXD       ----LPMSLFPQD------------DVKVPDVLEVRGEVFIRKKDFQKLNEKREEEG---
DNLJ_ANADF       ----TRANRGVPER----------LAGEVPPRVEVRGEVLLFKEHFEAMNRQILRAG---
DNLJ_HALHL       ----VPLRLRGDG---------------YPGRLEVRGEVVIRKEDFERLNQARLDAG---
DNLJ_NATPD       ----VPLTLDGD----------------CPSFLAVRGEIFMPKDAFQEYNRERLERG---
DNLJ_HALWD       ----VPLKLHGD----------------YPSYLAVRGEVYMPKAGFREYNRERIECD---
DNLJ_SALRD       ----VPLRLRDDA-------------RPVPDRLVVRGEAYMRKDEFNAFNRRREEEG---
DNLJ_LISW6       ----IPMKLQK------------------DFSIEVRGEAFMPKRSFQKLNEIREEEG---
DNLJ_STAS1       ----IPLKINE------------------SRTFEVRGEAYMPRKSFVNLNEAKAANE---
DNLJ_GEOSE       ----LPLRLKE------------------PVSLEARGEAFMPKASFLRLNEERKARG---
DNLJ_ENTFA       ----VPMRLTE------------------PISVEVRGECYMPKQSFVALNEEREENG---
DNLJ_STRS2       ----VPLTLPE------------------AVDITVRGECYMPKASFDRVNKQRQEAG---
DNLJ_LACS1       ----IPMELNE------------------PVSIEVRGECYMPKKSFVELNTKREAEG---
DNLJ_LACPL       ----IPQRLTR------------------PLTIDVRGECYMPKAAFAALNERREAAG---
DNLJ_OENOB       ----IPKVLNE------------------PLTIEVRGEIYMRKEAFADLNQQRDEEG---
DNLJ_LEUMM       ----IPKKLTE------------------PLTIEVRGEIYMPKASFAALNKQREADG---
DNLJ_PEDPA       ----VPQKLTR------------------PLSIEVRGECFMPKASFAKLNAQQLEDG---
DNLJ_LACDB       ----VPQKLPK------------------AITTEVRGECYMSKEAFAKLNQERDEAG---
DNLJ_SYMTH       ----IPLRLDGTEAPV-------------PPRLIVRGEVYMTKQVLEELNAALAAEG---
DNLJ_MOOTA       ----LPLRLRRP-----------------LPFLVVRGEVYMPKVAFTALNAAREEAG---
DNLJ_DESHY       ----IPLRLRKQ-----------------ADRLDVRGEGYMPKGSFLRLNQEREEAG---
DNLJ_CARHZ       ----IPLKLRNP-----------------IPLLEVRGEAYMPKESFARLNEQREERG---
DNLJ_HUNT2       ----IPLRLKRD-----------------LPLLEVRGEVFISKKDFIKINEEQEAAG---
DNLJ_CALS8       ----IPLKLKDD-----------------INIV-VRGEVFMPKDEFIKLNQEREENE---
DNLJ_CALS4       ----IPLRLKDS-----------------VNLV-VRGEVFMPKASFAKLNEERAERG---
DNLJ_CLOD6       ----IPLKINDK-----------------KELI-VRGEVYISKDNFRKVNEQQEEQE---
DNLJ_SYNWW       ----IPLRLRHS-----------------LPRLEVRGEVFMPKQEFIRLNEEKEEKG---
DNLJ_THEMA       ----IPLRLRKP------------------VTIEVRGEIYMPVDEFKRLNDEREEEG---
DNLJ_AQUAE       ----IPLKAEFSRFG--------------IKLAEIRGEVVIRKDEFQKLNKERMEEG---
DNLJ_SOLUE       ----LPLRVKTK-----------------LPAFEVRGETVMSRRAFERLNTDRDEKG---
DNLJ_KORVE       ----VPLGVSSATLKKTHM----------LGDFEVRGEVIFPTKSFEKMNEDREKQG---
DNLJ_SYNE7       ----IPLRLQTDQPPEWL---------------EVRGEAFLSLTRFKQLNTEREKHG---
DNLJ_SYNJA       ----IPLRLATAAPPPVL---------------EVRGEAYLPIAEFERINRERCSAG---
DNLJ_SYNY3       ----IPVKLNLDNPPPTV---------------EVRGEAFLPLEEFNRINHEREAQG---
DNLJ_GLOVI       ----IPLKLLGGEVPAVL---------------EVRGEAFIPRDEFERINQERQAAG---
DNLJ_PROMT       ----IPLRLLLENPPLWV---------------EIRGEAFMPNNIFNKLNIERKNND---
DNLJ_PROMA       ----IPLSLHLQNPPAWV---------------EIRGEAFIPNKVFISLNKERLKEE---
DNLJ_PARD8       ----VPLRLRGSDFPEEF---------------EIRGEVLLPWAEFDRLNKEREEQE---
DNLJ_PORGI       ----VPLRLRGDDYPRML---------------EVRGEILLPFKEFDRINAQREAEG---
DNLJ_GRAFK       ----VPLKLK-DEFPHKF---------------DIRGEIVLPYEGFAKMNAERVEMG---
DNLJ_CYTH3       ----IPLKIQSATFPEEF---------------EVRGEVYLPYEMFERINQEREDIG---
DNLJ_PELLD       ----VPLRLQTLDTPFSLGE---------GREVEVRGEVFMRKEDFTALNDTRPE-----
DNLJ_CHLPN       ----LPLRLP-EDAPEFI---------------EVRGEVFFSYSTFQIINEKQQQLE---
DNLJ_CHLMU       ----LPMTLP-QDAPEEV---------------EVRGEVFLSYQAFEKLNICQREQG---
DNLJ_PARUW       ----LPLQLSGENLPDFL---------------EIRGEVFMPRQVFLQLNEQKLQDG---
DNLJ_RHOMR       ----IPLRIPVDPA-----------VGPPPTRLEVRGEVYMRKRDFERLNEQLQARG---
DNLJ_RUBXD       ----VPDRLDDD----------------PPGVLEPRGEVYIKLKDFEEFNRRRQERG---
DNLJ_ROSS1       ----IPLRLGAFASNPEGQTNGAPVQAVIPPLIEVRGEVYMRIADFLRLNEQLAASG---
DNLJ_THEFI       ----IPRRLKGV-----------------PDRLEVRGEVYMPIEAFLRLNEELEERG---
DNLJ_DEIRA       ----IPQKLEGL-----------------KGELEVRGEVYLSRADFAAFNAQAEELG---
DNLJ_DEHMC       ----IPLNAEPN----------------APPVFEVRGEVYLSKNGFAKLNRERADKG---
DNLJ_DESAG       ----VRMRLNPEI--------------EAPVRLEVRGEVIITRADFEALNARQQQKG---
DNLJ1_DESVV      ----LPLRLRGN---------------NVPHRLEVRGEVVIAKADFEQLNARQSAVG---
DNLJ_LAWIP       ----IPKRLKHSI--------------NAPELLEIRGEVVISRADFKKLNKEQEKKK---
DNLJ_RHOBA       IADAALAHPEVAGG-------------NVPEVLEVRGELYMTDADLADLNVRQTDAG---
DNLJ2_STRCO      ----LPGTLAE------------------PVTVEVRGEILMTTAQFEHANEVRIRHG---
DNLJ1_NOCFA      ---GVPEQIDV------------------PGRVEVRGEAVMLRSTFLAYNAAHPDKP---
DNLJ_PSYIN       ---------------------------NNGDRGLGPGEIVIKKSYFDTVLSDKFENS---
DNLJ_DESPS       ---------------------------RGGSRGLGAGEIVVNKDYFTEHLAQFFDNS---
DNLJ_RUTMC       ---------------------------NDAERGLGAGEIVIKKSYFKKYLAHSFEYP---
DNLJ_VESOH       ---------------------------KDSGRGLGAGEIVVKKSYFEKYLVHSFEYP---
DNLJ_DESAL       ----------------------------QGGRGLGLGEIVAVQSYFQENLADRFEHP---
                                                      *                      

DNLJ_TREDE       -----------------------------ANCRNAANGLMKKKNG-----ELCEH-----
DNLJ_TREPA       -----------------------------ANCRNTVNGILKRKDG-----RGRTH-----
DNLJ_THEFY       -------------------------KPPFANPRNAAAGSLRQKDP---RVTASRP-----
DNLJ_FRACC       -------------------------GKPFANPRNAAAGSLRQKDP---RVTATRP-----
DNLJ_SACEN       -------------------------KPPFANPRNSAAGSLRQKDP---RVTKSRP-----
DNLJ_NOCSJ       -------------------------KAPFANPRNSAAGSLRQKDP---RITASRA-----
DNLJ_ARTS2       -------------------------KAPLANPRNAAAGSLRQKDP---AETAKRP-----
DNLJ_CUTAK       -------------------------KNPFANPRNAAAGSLRQKDS---RVTASRP-----
DNLJ_CORJK       -------------------------LKMFANPRNAAAGAMRQKNS---ADTAKRP-----
DNLJ_LEIXX       -------------------------ERVFANARNAASGSLRQKAEG--KNPAQRRLMRDR
DNLJ_BIFLO       -------------------------RAPFANPRNAAAGSLRQKDP---RITATRR-----
DNLJ_TROWT       -------------------------KQ-FANPRNFVSGCIRTKTPNMRYLESISFYAHGF
DNLJ_RHORT       --------------------------KPFANPRNAAAGSLRQLDP---EITRSRS-----
DNLJ_MAGSA       --------------------------KLFANPRNAAAGSLRQLDP---KVTASRP-----
DNLJ_CHESB       --------------------------QTYVNPRNTAAGSLRQLDA---SITAARP-----
DNLJ_BRADU       --------------------------TIFANPRNSAAGSLRQKDP---TITASRP-----
DNLJ_RHILO       --------------------------QDYVNPRNTAAGSLRQKDA---SVTASRN-----
DNLJ_BARBK       --------------------------LVFANPRNAAAGSLRQLDT---RMTARRK-----
DNLJ_PARDP       --------------------------RVFANPRNAAAGSLRQLDP---SVTAARP-----
DNLJ_MARMM       --------------------------DAYKNPRNAAAGSLRQIDP---KMTSQRP-----
DNLJ_HYPNA       --------------------------KVFANPRNAAAGSLRQLDV---EITKSRP-----
DNLJ_CAUVC       --------------------------RTYANPRNFAAGSLRQIDP---KISAQRP-----
DNLJ_SPHAL       DKA-----------------------RQFANPRNAAAGSLRQKDA---SVTASRP-----
DNLJ_ZYMMO       --------------------------KLFANPRNAAAGSLRQLDP---NITARRS-----
DNLJ_RHOPB       --------------------------PPFANPRNSAAGSLRQKDV---AITASRP-----
DNLJ_GLUOX       --------------------------KPFANPRNAAAGSLRQLDA---EITRSRP-----
DNLJ_PELPD       --------------------------KPPENPRNAAAGSLRQLDP---SVTASRP-----
DNLJ_RICTY       --------------------------GKFANPRNAAAGSIRQLDV---AITAQRP-----
DNLJ_ORITB       --------------------------ALFSNPRNAAAGSIRQLDP---AITAQRP-----
DNLJ_WOLTR       ----------------------------FANPRNAAAGSLKQLDV---SITANRP-----
DNLJ_EHRRW       ----------------------------FANPRNAAAGSIRQLDP---TITAQRK-----
DNLJ_ANAPZ       ----------------------------FANPRNAAAGSIRQLNP---KIAEERN-----
DNLJ_NEOSM       ----------------------------FSNPRNAAAGSLRQLNP---EITNERN-----
DNLJ_PELUB       ----------------------------FANPRNAASGSLRQKNS---LITAKIP-----
DNLJ_SPICI       ------------------------GEFKFANPRNAAAGTLRQLDS---TIVAKRK-----
DNLJ_MESFL       ------------------------GDQLFANPRNAAAGTLRQLDS---KIVAERN-----
DNLJ_UREPA       -------------------------DKKFANPRNAAAGTLRSLDN---SIVAERK-----
DNLJ_MYCPE       -------------------------TKKFANARNAASGSLRNLDS---NITAKRN-----
DNLJ_MYCPN       --------------------------KPFANARNLAAGTLRNLNS---EVSAKRK-----
DNLJ_MYCGA       -------------------------DKKFANSRNYASGSLRNIDV---SEVAKRK-----
DNLJ_MYCMO       ------------------------NLTIFANPRNAASGSLRQLDS---SIVKERK-----
DNLJ_MYCS5       NIEKIFSYMQALPKSKSWSNLKIKTPIFFKNARNAAAGTLRQKDP---KIVKSRN-----
DNLJ_MYCPU       --------------------QDGTKNKKWNTPRNKASGILKSLKT---TDESS-W-----
DNLJ_MYCH7       ------------------RNAASGILRRYKNHKPKIDAKSIKFLE---EESDFRY-----
DNLJ_FUSNN       ------------------------GEELFANPRNAASGTLRQLDS---KIVKDRG-----
DNLJ_LEPIC       ----------------------------YANPRNLSAGSIKQKNS---SDTAKRP-----
DNLJ_BORBU       ----------------------------YTNSRNLASGILRRVDS---REVANFP-----
DNLJ_ONYPE       -------------------------KPLFSNPRNAASGTLRQLNS---AIVAQRN-----
DNLJ_NITSB       ------------------------GESTFANPRNAAAGSLRQLDP---KVTAQRK-----
DNLJ_SULDN       ------------------------GEALFANPRNAAAGSLRQLDS---SITASRN-----
DNLJ_CAMHC       ------------------------GENLFANPRNAAAGSLRQLDS---AVVKSRH-----
DNLJ_CAMJJ       ------------------------NQSLFANPRNAASGSLRQLDT---SITKERN-----
DNLJ_WOLSU       ------------------------NESPFANPRNAAAGSLRQLDP---AITAKRK-----
DNLJ_HELHP       ------------------------NLSLFANPRNAAAGSLRQLDA---KITAKRK-----
DNLJ_HELAH       ------------------------NEPLFANPRNAASGSLRQLDS---KITKKRK-----
DNLJ_CLOTE       ------------------------AEIPLKNLRNGAAGALRNLDV---RETAKRN-----
DNLJ1_CLOAB      ------------------------NETPLKNLRNGAAGALRNLNI---KETARRK-----
DNLJ_MARHV       -------------------------EKTFVNPRNAAAGSLRQKKS---TVTARRP-----
DNLJ_ALCBS       -------------------------LKLFANPRNAAAGSLRQLDS---RITASRP-----
DNLJ_IDILO       -------------------------EKVFANPRNAAAGSLRQLDS---RITAKRP-----
DNLJ_COLP3       -------------------------EKGFANPRNAAAGSLRQLDS---KITAKRN-----
DNLJ_SHEAM       -------------------------DKLFVNPRNAAAGSLRQLDS---KITAERS-----
DNLJ_SACD2       -------------------------EKTFVNPRNAAAGSLRQLNP---QITAKRP-----
DNLJ_CHRSD       -------------------------DKVFANPRNAAAGSLRQLDS---SIAAARP-----
DNLJ_LEGPA       -------------------------EKTFANPRNAAAGSLRQLNP---EISASRP-----
DNLJ_MAGMM       -------------------------EKTFANPRNAAAGSLRQLDP---KITASRG-----
DNLJ_NITMU       -------------------------EKTFINPRNAAAGSLRQLDP---CITANRN-----
DNLJ_JANMA       -------------------------GKEFANPRNAAAGSLRQLDS---RITAQRT-----
DNLJ_METCA       -------------------------EKTFVNPRNAAAGSLRQLDA---RVTASRP-----
DNLJ_NITOC       -------------------------EKPFVNPRNAAAGSLRQLDP---RITANRP-----
DNLJ_COXBU       -------------------------DKTFANPRNAASGSLRQLDP---RITAKRP-----
DNLJ_PSYCK       -------------------------DKTFANPRNAAAGSLRQLDP---AIAASRP-----
DNLJ_HYDCU       -------------------------GKIFANPRNAAAGSLRQLDS---KVAAKRH-----
DNLJ_FRATN       -------------------------NKTFANPRNAAAGSIRMLDS---KVVAKRP-----
DNLJ_DICNV       -------------------------EKIFANPRNAASGSLRQLDP---RITARRQ-----
DNLJ_SODGM       -------------------------SKVFANPRNAAAGSLRQLDP---SITARRP-----
DNLJ_BAUCH       -------------------------SKRFANPRNAAAGSLRQVDP---SITATRL-----
DNLJ_BUCBP       -------------------------KKLFSNSRNAASGSLRHKNA---KVTELRS-----
DNLJ_BUCCC       -------------------------KKEFSNPRNAAAGSVRQLNP---EIVKKRK-----
DNLJ_BUCAI       -------------------------NKYFSNPRNAAAGSLRHIDP---NITAERK-----
DNLJ_WIGBR       -------------------------KKLFSNARNMASGSLRQINP---KITKNRS-----
DNLJ_BLOPB       -------------------------NKPFSNARNAASGSLRQLDP---SVTATRP-----
DNLJ_BLOFL       -------------------------KKVFSNARNAASGSLRQLDP---HVTELRS-----
DNLJ_BORA1       -------------------------EKIFVNPRNAAAGSLRQLDP---RVTAQRP-----
DNLJ_PSESM       -------------------------GKTFANPRNAAAGSLRQLDS---KITANRP-----
DNLJ_RALSO       -------------------------DKTFVNPRNTAAGAVRQLDP---KMAAERP-----
DNLJ_XYLFT       -------------------------WKVLANPRNGAAGSLRQLDP---HITAQRP-----
DNLJ_NEIG1       -------------------------QKPFANPRNAAAGSLRQLDS---RITAQRK-----
DNLJ_BDEBA       -------------------------QQTFANPRNAAAGTVRQLDS---RIAASRP-----
DNLJ_GEOSL       -------------------------EPPFANPRNAAAGSIRQLDS---RITARRP-----
DNLJ_PELCD       -------------------------LQVFANPRNAAAGSLRQLDS---AVTAKRP-----
DNLJ_SYNAS       -------------------------EPPFANPRNAAAGSLRQLDA---SITARRP-----
DNLJ_SYNFM       -------------------------EPLFANPRNAAAGSLRQLDP---SVTAARS-----
DNLJ_MYXXD       -------------------------EPLFANPRNAAAGSLRQLDP---RMTAARP-----
DNLJ_ANADF       -------------------------DEPFANPRNAAAGSLRQLDW---RVTARRP-----
DNLJ_HALHL       -------------------------ERPFANPRNAAAGSLRQLDP---RITARRP-----
DNLJ_NATPD       -------------------------EEPFSNPRNAAAGTLRQLDP---SVTAERP-----
DNLJ_HALWD       -------------------------EKPFANPRNAAAGTLRQLDP---GVVAERP-----
DNLJ_SALRD       -------------------------KKVFANPRNAAAGSLRQLDS---NITARRP-----
DNLJ_LISW6       -------------------------QMLFANPRNAAAGSLRQLDT---KIAASRN-----
DNLJ_STAS1       -------------------------EQPFANPRNAAAGSLRQLDS---KLAAKRK-----
DNLJ_GEOSE       -------------------------EELFANPRNAAAGSLRQLDP---KVAASRQ-----
DNLJ_ENTFA       -------------------------QDIFANPRNAAAGSLRQLDT---KIVAKRN-----
DNLJ_STRS2       -------------------------EAEFVNPRNAAAGTLRQLDT---GVVAQRG-----
DNLJ_LACS1       -------------------------QAVFANPRNAAAGSLRQLDT---KITASRN-----
DNLJ_LACPL       -------------------------EPVFANPRNAAAGTLRQLDS---RVVAERQ-----
DNLJ_OENOB       -------------------------KTIFANPRNAAAGSLRQLDP---KITAKRH-----
DNLJ_LEUMM       -------------------------LEPFANPRNAAAGSLRQLNV---KITKSRN-----
DNLJ_PEDPA       -------------------------KPVFANPRNAAAGSLRQLNT---NVTKKRD-----
DNLJ_LACDB       -------------------------ESIFANPRNAAAGSLRQLDP---KVTKKRQ-----
DNLJ_SYMTH       -------------------------KPLLQNPRNAAAGGLRQKDP---RKTRERR-----
DNLJ_MOOTA       -------------------------EPLFANPRNAAAGSLRQLDP---KITASRS-----
DNLJ_DESHY       -------------------------QPLFANPRNAAAGSLRQLDS---RITAQRK-----
DNLJ_CARHZ       -------------------------EPLFANPRNAAAGSLRQLDP---KVTAERD-----
DNLJ_HUNT2       -------------------------QQLFANPRNAAAGSLRQLDP---KVTSQRK-----
DNLJ_CALS8       -------------------------EPLFANPRNAAAGSLRQLDP---RITAQRK-----
DNLJ_CALS4       -------------------------ESLFANPRNAAAGSVRQLDP---KVTAKRD-----
DNLJ_CLOD6       -------------------------QPLFANPRNLAAGSLRQLDP---KLTAKRP-----
DNLJ_SYNWW       -------------------------ERVFANPRNAAAGSLRQLDP---RVTAGRA-----
DNLJ_THEMA       -------------------------LPPFANPRNAAAGTLRQLNT---ALVAARR-----
DNLJ_AQUAE       -------------------------LPPFANPRNAAAGSIRQKDP---KEVAKRN-----
DNLJ_SOLUE       -------------------------LSRFANPRNAAAGSLRQLEP---QVTASRR-----
DNLJ_KORVE       -------------------------LAKFANPRNAAAGAVRVLEP---NITAQRR-----
DNLJ_SYNE7       -------------------------EALFANPRNAAAGTLRQLDP---RIVAERQ-----
DNLJ_SYNJA       -------------------------DPPFANPRNCAAGTLRQLDS---RVVAARK-----
DNLJ_SYNY3       -------------------------ESLFANPRNAAAGTLRQLDP---KIVHQRR-----
DNLJ_GLOVI       -------------------------EKLFANPRNACAGTLRQLDS---RVVASRR-----
DNLJ_PROMT       -------------------------QPLFANPRNSCAGTLRQLDP---KIVASRK-----
DNLJ_PROMA       -------------------------KQLFANPRNACSGTLRQLDS---RIVASRH-----
DNLJ_PARD8       -------------------------EPLFANPRNAASGTLKQQNP---AIVASRK-----
DNLJ_PORGI       -------------------------EPLFANPRNAASGTIKQLDP---HIVAGRN-----
DNLJ_GRAFK       -------------------------EEPYANPRNTASGSLKLQDS---AEVARRP-----
DNLJ_CYTH3       -------------------------EAALANPRNAASGTVKMQDS---GIVAKRA-----
DNLJ_PELLD       -------------------------EDRFANPRNATAGTLKLQDS---AEVAVRR-----
DNLJ_CHLPN       -------------------------KTIFANPRNAAGGTLKLLSP---QEVAKRK-----
DNLJ_CHLMU       -------------------------KLEFANPRNAAGGTLKLLSS---REAAKRN-----
DNLJ_PARUW       -------------------------EVLWANPRNAAAGSLKLLDP---KMVAERR-----
DNLJ_RHOMR       -------------------------ERPFANPRNAAAGSVRQLNP---QVTALRP-----
DNLJ_RUBXD       -------------------------ERPFANPRNLAAGSVRQLDP---RVTARRP-----
DNLJ_ROSS1       -------------------------EKVAANPRNAAAGSLRQKDP---AITARRP-----
DNLJ_THEFI       -------------------------EKVFKNPRNAAAGSLRQKDP---RVTAKRG-----
DNLJ_DEIRA       -------------------------TPLLKNPRNGAAGALRQKDP---EVTRTRH-----
DNLJ_DEHMC       -------------------------LPLFANPRNAAAGSLRQLDP---SVTAERP-----
DNLJ_DESAG       -------------------------GKLFANPRNAAAGSVRQLDS---SVAAARP-----
DNLJ1_DESVV      -------------------------GKVFANPRNAAAGSVRQLDT---SITAGRP-----
DNLJ_LAWIP       -------------------------KKLFANPRNAASGSVRQLDP---TITASRP-----
DNLJ_RHOBA       -------------------------HEPFKNTRNVTAGTIRLLDP---KIAASRN-----
DNLJ2_STRCO      -------------------------GQPFANPRNAAAGTLRAKER-----AYTVP-----
DNLJ1_NOCFA      ----------------------------LINPRNAAAGTLRAKDP---ATVAERR-----
DNLJ_PSYIN       --------------------------------RNIQAAIIAEKKVDESIQKAIDV-----
DNLJ_DESPS       --------------------------------RNFQASLIKEKTLALPVVKAIEA-----
DNLJ_RUTMC       --------------------------------RNFQASLIKEKALDEQAQKAIID-----
DNLJ_VESOH       --------------------------------RNFQSSLIKEKALDEQAQKAIID-----
DNLJ_DESAL       --------------------------------RNMVVGIISSDVLNISAKQALED-----
                                                 :    .                      

DNLJ_TREDE       ---LNLFAYDAVQGSIGRP------------------FTGDAPFKTESEKLVWLKKAGFN
DNLJ_TREPA       ---LHIVCYDAVPGTPGKP------------------FTGSLPFADETEKLAWLARQGFV
DNLJ_THEFY       ---LSMLVHGIGAHRGVT-------------------ITHQSQSYELLAAWGLP----VS
DNLJ_FRACC       ---LEMIVHGLGAQRGFE-------------------VTSQSAAYARFAELGLP----VA
DNLJ_SACEN       ---LRMICHGLGKREGFE-------------------PKQQSESYAALRAWGLR----VS
DNLJ_NOCSJ       ---LGMVCHGIGERRGFE-------------------PQAQSHAYDALAAWGLP----TS
DNLJ_ARTS2       ---LRMYVHGIGAREGLR-------------------TVSQSDTYRQLAEWGLP----TS
DNLJ_CUTAK       ---LSMIVHGIGVLEGHD-------------------FPSQGHAYDKLAQWGLP----VS
DNLJ_CORJK       ---LKLICHGIGAREGFS-------------------PASQHDAYRAIAAWGLP----VS
DNLJ_LEIXX       LGRLRMLVHGIGAWPNPP-------------------VATQSGVYELLRSWGLP----TS
DNLJ_BIFLO       ---LSFYAHGLGQLTWGPDHPRGT----------HDVVADQSQAYDLYTKWGVP----VS
DNLJ_TROWT       TQVYGYTSGGMNLHSDITASGGVK----------TEIEHGMFSAYSRLSECKIP----VN
DNLJ_RHORT       ---LSLFAYASGEVKGLE-------------------VESHHAFLERLKTWGFP--VNPQ
DNLJ_MAGSA       ---LSLFAYAMGEASAPP-------------------AASHWEYLERLKAWGFV--VNPL
DNLJ_CHESB       ---LKFFAYAWGEVSEMP-------------------SQTQMGMVEALKSYGFR--TNKL
DNLJ_BRADU       ---LGFFAYAWGEMSAMP-------------------EETQTGMIHWFERCGFK--TNPL
DNLJ_RHILO       ---LKFFAYAWGFTTADP-------------------APTQYESVQKFADWGFK--ISPL
DNLJ_BARBK       ---LKFFAYGWGEVSEMP-------------------AKSQMEMVKKLKEYGFV--INPL
DNLJ_PARDP       ---LRFFAYAWGEVSASF-------------------AGTQMEAVRRMQAFGFQ--TNPL
DNLJ_MARMM       ---LRFFAYAWGEVSEPL-------------------SDTQMGAVARFGEMGFP--VNDL
DNLJ_HYPNA       ---LRFFAYAWAAASEPF-------------------AQTQFEAVKAFADWGFV--TNSR
DNLJ_CAUVC       ---LRFFGYAWGLVSEGF-------------------ADSQWGALERLAEWGFV--TTAP
DNLJ_SPHAL       ---LRFLAHGWGEVSALP-------------------ADTQYAVMKAIESWGVP--VSPL
DNLJ_ZYMMO       ---LRFLAHGWGEATSLP-------------------ADTQYGMMKVIESYGLS--VSNL
DNLJ_RHOPB       ---LKFFAYAWGEFSDLP-------------------EATQYGMLGWLKRAGFT--VNPL
DNLJ_GLUOX       ---LSLFAYAQGYTSSPV-------------------ATTHWDYLEKLRSWGFT--VNPL
DNLJ_PELPD       ---LRFFAYAWGEISNSF-------------------AKSQWDALQTLRGWGFK--VCDD
DNLJ_RICTY       ---LKYFIYS-GGVTEKNL------------------ASTQEQLLAKLKALSFS--VNEI
DNLJ_ORITB       ---LKYFVYALGEVTNHHF------------------ASTQFELLQKLSQLKFS--VNTD
DNLJ_WOLTR       ---LKYFAYSLIGGK----------------------EKSQSEVLNRLESLGFC--VNEH
DNLJ_EHRRW       ---LKYCMYTIVNSN----------------------CLTQTESLNLLNSWGFC--TNEH
DNLJ_ANAPZ       ---LRYVAYCIVNSA----------------------LASQEAILKQLAEWGFC--THTE
DNLJ_NEOSM       ---LQYFAYSASKIDG---------------------IEHQEDVLHFLSGRGFM--TNPL
DNLJ_PELUB       ---LKFIAYTYGYEKKMN-------------------IKNQTSFLENLKLWGFK--TNPF
DNLJ_SPICI       ---LNAFLYY-YVNALQDG------------------IQSQYEALQRLEQLKFK--INPE
DNLJ_MESFL       ---LDAYLYY-YFNE-NNP------------------INTQFDSINQIKNLGLK--INKE
DNLJ_UREPA       ---LSAFMYY-LVNAQELG------------------IKTHYESIQFLRDNKFK--VSDL
DNLJ_MYCPE       ---LSALFYY-VPKATELK------------------IAKQYDVLSWLDKQLIP--ISRE
DNLJ_MYCPN       ---LKAFFYF-VPNALTLG------------------CRSQSAVLAQLKQWNFP--VSKA
DNLJ_MYCGA       ---LNAFFYY-IPNAYELG------------------FETQYQVIQQLKEWGFN--VAKE
DNLJ_MYCMO       ---LNSFFYS-VTNPLDHK------------------IKNFNDQELFLKENNFQ--VPSL
DNLJ_MYCS5       ---LSSLFYE-IVSPLEHN------------------LKTQMEVLAFLKEQNFE--VNEF
DNLJ_MYCPU       ---LSCFIYE-VVSPENFN------------------LKTQKQLFDFLKIQGFN--LPKF
DNLJ_MYCH7       ---LKSFFYT-LVNPEKHK------------------INSQFDSINFLRNLGFQ--VNPF
DNLJ_FUSNN       ---LDAYFYF-LVEADKLG------------------LKSHSESIKFLESMGIK--TTGI
DNLJ_LEPIC       ---LRIFTYDATFPNMEKK------------------FKTHQEIFSKLEKLTFP--VPPN
DNLJ_BORBU       ---LNIFIYD--FLNAGLE------------------FKTNDLATARLKKLGFK--VNPL
DNLJ_ONYPE       ---LSIFVYG--ISDPYLT------------------KPTQKETLVFLTALGFT--TNPH
DNLJ_NITSB       ---LYFYPWD-IGYNT-LN------------------FKYQHEKMDFVYQQGFI--KPFK
DNLJ_SULDN       ---LVFLPYG-VGENF-LE------------------HKLLSQKMEYIYSLGFK--KPPF
DNLJ_CAMHC       ---LKFFPWD-VGENS-LN------------------FKKHSEIMEFVRNLGFL--KDDF
DNLJ_CAMJJ       ---LKFYPWG-VGENT-LN------------------FTKHSEVMQFIRELGFL--KDDF
DNLJ_WOLSU       ---LRFIPWG-VGAHP-FK------------------TGSFFEIMKSLESYGFI--RSPE
DNLJ_HELHP       ---LRFMPWG-IGAGL-IR------------------FESFYEAFNTITRLGFA--PVPF
DNLJ_HELAH       ---LQFIPWG-VGKHS-LN------------------FLSFKECLDFIVSLGFS--AIKH
DNLJ_CLOTE       ---LSAFFYD-IGYSEGNE------------------FKTYMEMIGFLISMGFP--VDPY
DNLJ1_CLOAB      ---LVAQFYD-LSYTD-KK------------------LKKYSEILLFLKSQGFN--ITEY
DNLJ_MARHV       ---LELCAYSMAVTDESVL------------------PETHWDSLQLVRDWG----FRIN
DNLJ_ALCBS       ---LEFYAYSMAQLEGWEH------------------PPTHSAMLDALRDWG----LRVN
DNLJ_IDILO       ---LHFYAYSLGLISETTQ-----------------LPDSHHQRLLQLKDWG----LPVN
DNLJ_COLP3       ---LAFYAYSLGFVGKLSDGGAESTDL-----TNDFFANSHHERLCQLKRLG----LPMC
DNLJ_SHEAM       ---LAFYAYALGVVQDDNG-------------ADLVLAPTHKGQLERLTAFG----LPVS
DNLJ_SACD2       ---LVFCAYNVGVVEGGEL------------------PATHYETLTQLFEWG----FLVS
DNLJ_CHRSD       ---LEFCAYQVARLEGEDD------------------AHSHSDYLKRLRTLG----FRTS
DNLJ_LEGPA       ---LAIYCYSIGACEDYKL------------------PNSHLEQLNLLKEFG----FRVS
DNLJ_MAGMM       ---LRMFCYGTGYVEGGTL------------------ADRYAEILAALKGWG----LRVS
DNLJ_NITMU       ---LRFFAYGIGVCEGGNVPH-----------------DTHSHLLDYLSSLR----FPVM
DNLJ_JANMA       ---LRFFAYGIGMLEGAEMP------------------PSHSALLDWYAELG----LPVC
DNLJ_METCA       ---LSFYAYGIGAFPDARLP------------------ATQHELLESLQRWG----LPVS
DNLJ_NITOC       ---LALFCYGVGQVEGGILP------------------DRHSEILFQLKQWG----LRIL
DNLJ_COXBU       ---LIFYGYLIGLLKGKDF------------------PKNHCDVLKWFKDWG----IPVI
DNLJ_PSYCK       ---LAFYCYSVNQGLPEHI-------------------KTQSAALAWLKTIG----FTVS
DNLJ_HYDCU       ---LSFFLYGWGELSDDWQLP-----------------QYYSEMIEQLVEWG----LPAN
DNLJ_FRATN       ---LKLYSYGIGYFSKDFVHP-----------------ETQFELMQLLQSFG----FTIS
DNLJ_DICNV       ---LAFFAYGYGEIT-NYQLP-----------------ETYEALLEQYRAWH----IPVC
DNLJ_SODGM       ---LTFYCYGVGLL-EDGELP-----------------ESHWERLQQFKAWG----VPVS
DNLJ_BAUCH       ---LSFFCYGVGRI-DSKKIP-----------------AAHLELLQQFKIWG----LPVS
DNLJ_BUCBP       ---LTFYCYGCGYC-SYENFT-----------------DSHFLRLKKLKSWG----FPIS
DNLJ_BUCCC       ---LNFFVYGFGLF-DYNKKI-----------------DSHYQRLLQIKKWG----FPLY
DNLJ_BUCAI       ---LIFSCHGCDFFVKTNKEL-----------------TTHYQRLMKCLSWG----IPVN
DNLJ_WIGBR       ---LSFYGYGIGYV-NEKKYY-----------------YDQHDALKLINSWG----IPIE
DNLJ_BLOPB       ---LSFYCYGISNYCGEKELP-----------------DSHWERLQLCENWG----LPIN
DNLJ_BLOFL       ---LVFCCYGISYYAGLKQLP-----------------NSHWGRLKLCNRWG----LSIN
DNLJ_BORA1       ---LRFFAYSWGEVQGLSRDDAPAFDEASPGLVSTLPRDTHGGMLDWLAGLG----LPVN
DNLJ_PSESM       ---LEFCCYGLGQTSAEIAD-------------------THIGVLETLKKWG----MPVS
DNLJ_RALSO       ---LSFFAYGLGEAAGWSGMP-----------------DTHSGMLDALVAYG----FPVS
DNLJ_XYLFT       ---LSFYAYGIGEVTDDVAF------------------HRHSEILASLRAWG----FPVS
DNLJ_NEIG1       ---LHFFPYSVARQQGGLIA------------------EEHIQELAYFQALG----FSLP
DNLJ_BDEBA       ---LRFFGYALGAVEGETF-------------------NTQKNIQEYFNDHGIPTVLPYK
DNLJ_GEOSL       ---LAIFCYAPGEVRG-------------------ASFAAQTEFLDRIGEWG----LPVN
DNLJ_PELCD       ---LKIFCYGIGQLSG-------------------EHPASHHSLLKCMHRWG----LRVN
DNLJ_SYNAS       ---LKMFCYAVGIVRG-------------------RAFTYHHDVLHALKKWG----FSVN
DNLJ_SYNFM       ---LKAFFYGVGEVSG-------------------YRFKTQAQTLEQLRRWG----LPVN
DNLJ_MYXXD       ---LSVFLYEC-VPGE-----------------GVPVFKTHIEKLEYLKTLG----LPI-
DNLJ_ANADF       ---LSFIAYEALVPGAEPGGAR----------AGPWAWRTHAEKLEALARWG----FET-
DNLJ_HALHL       ---LTLFTFGVGDPLA-------------------LGVESHWQVLECLAGWG----FRT-
DNLJ_NATPD       ---LDCFVFDILDDGG-------------------RGFETRMAEHEAVESWG----FQV-
DNLJ_HALWD       ---LSCFFYDILDATE-------------------LP-PDQWTTLNDLQSWG----LRT-
DNLJ_SALRD       ---LRIYFYEIAPVDG-------------------RDFATHAEVLEALPEWG----LRVC
DNLJ_LISW6       ---LDIFLYAV--ADFG-----------------EMGVTTHSEGLDMLETLGLK----VN
DNLJ_STAS1       ---LSVFLYSV--NDFT-----------------QFNADTQSEALDELDQLGFK----TN
DNLJ_GEOSE       ---LDLFVYGL--ADAE-----------------ALGIASHSEALDYLQALGFK----VN
DNLJ_ENTFA       ---LNTFLYTV--ADFG-----------------PMKAKTQFEALEELSAIGFR----TN
DNLJ_STRS2       ---LATFLYQE--AS-------------------PSEATSQSQVLEKLDALGFV----TN
DNLJ_LACS1       ---LSTFIYYL--MEPE-----------------KLGIKTQTEALNKLESWGFK----VN
DNLJ_LACPL       ---LSTFMYNI--ADYE-----------------PLTARTQSDMLTEFADLGFA----IN
DNLJ_OENOB       ---LSSFIYYT--AQND-----------------VLGVNTQSDVLERFRQLGFP----VN
DNLJ_LEUMM       ---LAAFVYYT--AEPE-----------------MLGVTTQSGALERFAELGLP----TD
DNLJ_PEDPA       ---LDTFIYTV--VDSN-----------------QLGAKTQHQAIQMMAELGFN----TN
DNLJ_LACDB       ---LSTFIYTW--INP------------------PAGIDSQHQAICEMAKLGFH----TN
DNLJ_SYMTH       ---LDAFLYQV--VDAE-----------------ALGIADHWSALQRLQAWRFK----VN
DNLJ_MOOTA       ---LSLFVYQV--ISLT-----------------GAEVATQAGALDFLAELGFP----VN
DNLJ_DESHY       ---LGYFAYQV--LTPE-----------------EGELASQTAVLDYLKEQGFS----VN
DNLJ_CARHZ       ---LSAFMYAI--GEVQ-----------------GYEPKTQAELMEWLSELGFK----VN
DNLJ_HUNT2       ---LDIFVFNI--QRIE-----------------GQSFKTHSETLEFLKELGFK----TS
DNLJ_CALS8       ---LDIFVFNV--QWCE------------------KELKTHDEALRYLKYLGFK----VS
DNLJ_CALS4       ---LDIFIFNL--QRIE-----------------GRDFKTHVEALEFLKEQGFK----VI
DNLJ_CLOD6       ---LDIFVFNM--ENIE-----------------EYDLESHSESLEYLEKLGFS----VS
DNLJ_SYNWW       ---LSAFVYDI--IYME-----------------GQTLAEQQEAWHFMQELGLP----VN
DNLJ_THEMA       ---LDSFIYYV--VHPE-----------------NYGLKTQWEALQFLKELGFK----VN
DNLJ_AQUAE       ---LEAIVYHLSYVEPP-----------------ETEPPTHYESLKMLHTLGFKT---LF
DNLJ_SOLUE       ---LEYYTYFL--LTEG-----------------RPAYESHWEALTALKQMGFK----VN
DNLJ_KORVE       ---LDFYAYFL--LVDG-----------------RVHIDRQSEALDTLEKLGFK----VN
DNLJ_SYNE7       ---LDFFAYSIQGPNDWANLD-------------------QAASLDCLQSLGFR----VE
DNLJ_SYNJA       ---LSFFAYALHWPEGWPSGDP---------------PQTQWECLQRLKDLGLP----VN
DNLJ_SYNY3       ---LQFFAYTLHLPG---QEDK---------------IQSQWQALEYLKKAGFM----VN
DNLJ_GLOVI       ---LGFFAYTAHYGRA----------------------ESQWEALAELESHGFR----VN
DNLJ_PROMT       ---LDFFAYSLYFPENWEPTDNN-----------FKKPISQSESLEFLKNIGFK----VN
DNLJ_PROMA       ---LDFFAYTIHLPDDWIPGETD-----------PKKPKGQWEALLWLKAAGFR----VN
DNLJ_PARD8       ---LDAYFYYLLGENL--------------------PAEGHYENLQAARAWGFK----IP
DNLJ_PORGI       ---LDAYFYYLYSDEP--------------------LAENHYDRLMQARQWGFK----VS
DNLJ_GRAFK       ---LECLLYSITGENT--------------------GVASQFEGLEKARKWGFK----VP
DNLJ_CYTH3       ---LDCFIYSLLQDSN--------------------KQPTHAAALAQLKEWGFR----VS
DNLJ_PELLD       ---LWFVAYYLDGIQD--------------------PDTPHFHRLQLLETAGFF----TG
DNLJ_CHLPN       ---LEISIYNLIAPG---------------------DNDSHYENLQRCLEWGFP----VS
DNLJ_CHLMU       ---LDLSIYGLITNR---------------------EEHSHFENLGLCAHWGFP----IA
DNLJ_PARUW       ---LAVVFYGLAEDSSA-------------------SIKKQAEVPSFFRSIGLP----AL
DNLJ_RHOMR       ---LSFFAYGIGPVEGA------------------EVPDSQYEVLQWLGRLGFP----VN
DNLJ_RUBXD       ---LTIYLYGVG--EGY------------------ENFESHSEALAALRRYGLR----VN
DNLJ_ROSS1       ---LRFFAYGIGQIEGV------------------QV-QTQWETLNLLRTLGFP----VN
DNLJ_THEFI       ---LRATFYALGLGLEE------------------SGLKSQYELLLWLKEKGFP----VE
DNLJ_DEIRA       ---LKAILYAVGKR-DG------------------VPARTQWEVLEWLSAQGFP----TS
DNLJ_DEHMC       ---LDIFIYALGYSEDS------------------LLPDSHWQILDYFSKIGFR----IN
DNLJ_DESAG       ---LRFMAYGVGQVVWADG---------------RQRWRTQYDIMRGLQELGFA----VP
DNLJ1_DESVV      ---LQFLAYGVGQVVLDGG---------------TAPWTTHSDLMARLREWGFD----SP
DNLJ_LAWIP       ---LRFLAYGIGEIQPS-----------------SLKWNTYHELMSYLKEYGFE----TP
DNLJ_RHOBA       ---IRFFCHGSGELVGVRA-------------------SDHMTFLQHVQALGIP-----I
DNLJ2_STRCO      ---MTFFGYGLLALPGTDAALAG-----------RLEELPYSELMETAAGLGVHT-SAGT
DNLJ1_NOCFA      ---LRFFGFDLDTAEGG----------------------AAADLGEGLRALGIA------
DNLJ_PSYIN       -------------------------------------GACVFFPFLSLENWIGH------
DNLJ_DESPS       -------------------------------------GAAIFFPFSMLPDWRGS------
DNLJ_RUTMC       -------------------------------------KAALFIPFIKLPTWSGL------
DNLJ_VESOH       -------------------------------------KGALFVPFIKLPIWSGS------
DNLJ_DESAL       -------------------------------------KQVHFVPYATLNKWEGS------
                                                                             

DNLJ_TREDE       CVEVKYCKSIAEVIEYRAHVMDIRPSLDYDIDGLVIKNDTIDPED---MKRARPEKQIAF
DNLJ_TREPA       TVHSHRCANAQEVVALRSEIMRTRELLPYSIDGLVVKSTDLDFQD---AQLPRPKKQIAF
DNLJ_THEFY       DRIRVVSTLDEVREYIAYYAEHRHD-PEYEIDGVVVKVDDVSLQRRLGSTSRAPRWAIAY
DNLJ_FRACC       THFEVLATVPGVLDYVHRWGDARHD-VVHEIDGVVVKVDSFALQRRLGSTSKSPRWAVAY
DNLJ_SACEN       PHTKVLSTVDEVLEHIDYWGKHRNS-AEHEIDGVVVKVDEVSLQRRLGATSRAPRWSIAY
DNLJ_NOCSJ       DQVRVVSTLKGVEGYIENAGARRHTIVPYEIDGVVVKVDDVALQRRLGSTSRAPRWAIAF
DNLJ_ARTS2       PYFEVLGSLKDILDFIKRYGDKRHS-LTHEIDGIVVKVDDFATQRALGYTSRVPRWAVAY
DNLJ_CUTAK       PYFKIVEHVDEVHEFVTRWGESRDE-ASHQIDGVVVKVDDVSLQRKLGATSRAPRWAIAY
DNLJ_CORJK       PYTKQVHSAKEVQQQVEYWGNHRHD-AAHEMDGLVVKVDSLEEQLELGHTSRAPRWAIAY
DNLJ_LEIXX       AHGRVFGTVQEAADFIGRSAERRDT-VEHEIDGVVIKVDELVLHDELGATSRAPRWAIAY
DNLJ_BIFLO       PHNRAVTSFQEILDMIEYYGEHRGD-IEHALDGIVVKVDDLGLQRTLGATSRAPRWAIAY
DNLJ_TROWT       SYNRLCTNFSEIESYIENIRLNRQC-VPYAIDGIVVKIDSLQKQALLGSTTKAPRWAVAY
DNLJ_RHORT       TR-PCQGVEDLIEATHALALQ--RAALDYDIDGVVYKVDRVDWQKRLGFVSRAPRWAIAR
DNLJ_MAGSA       IR-RCDGVAGLLSAYESLGEA--RATLAYDIDGIVYKVDDIELQRRLGFVSRSPRWAIAH
DNLJ_CHESB       MC-LCETARELLEHYHAIEER--RATLGYDIDGVVYKVNDLALQQRLGYVSRSPRWAIAH
DNLJ_BRADU       TR-LCHSVEELIAFHQRIEEE--RAELDYDIDGVVYKVDRIDWQERLGFVSRTPRWGIAH
DNLJ_RHILO       MV-RAKSVEELVAQYHLIEEQ--RSSLGYDIDGVVYKVDQLELQRRWGFVTGEPRWAVAH
DNLJ_BARBK       TK-VFKAVEDLISYYHFIEEG--RQHLDYDIDGVVYKVNDLLLQTRLGNVSRSPRWAIAH
DNLJ_PARDP       TR-ICASVSEMLSAWAEIEQM--RATLGYDIDGVVYKVNDLAYQARLGMRSTTPRWALAH
DNLJ_MARMM       MA-RCETVEALLAVYRDIEAR--RAGLGYDIDGVVYKADRLDWQERLGFVARAPRWAIAH
DNLJ_HYPNA       MI-RIKTVEEVLSYYQEIEAE--RASLEYDIDGVVYKVDRLDWQQRLGFVSRAPRWAIAH
DNLJ_CAUVC       PAQRVLNAQGLLDIYAQFEVL--RPTLGFDIDGVVYKVDDLELQRRLGFVSRSPRWAIAR
DNLJ_SPHAL       LK-RCDGVADLLDHYRMIEAE--RAELPYDIDGVVYKVDRLDWQARLGFVARAPRWAIAH
DNLJ_ZYMMO       LA-RADDIGQMLDFYQKIEAE--RADLDFDIDGVVYKLDQLDWQQRFGFSARAPRFALAH
DNLJ_RHOPB       IT-LCKSVDDALAFYRKIGEE--RATLPYDIDGVVYKVDRLDWQERLGFAGRAPRWAIAH
DNLJ_GLUOX       SQ-MIAHARDIPAYVEKLARE--RSELDYDIDGIVFKLDDLSLQDRLGFAGRAPRWAIAW
DNLJ_PELPD       IR-LLYSSDELNSYFEEMQER--RSELDFTIDGIVYKLNSLSLQERVGQTNRAPRWAAAQ
DNLJ_RICTY       SK-LASSEEEIFAFYEYLKTN--RHNLPYEIDGVVYKLNNFAMQNRMGFIARSPRFAIAH
DNLJ_ORITB       YI-LSDNLHSMIEFYNNVATE--RNNLAFEIDGVVYKVNDFALQERLGATSTSPRFAIAY
DNLJ_WOLTR       RS-LTNNLSGMLEFYNKVYNC--RYSLDYDIDGIVYKVNDLILQSRLGSTHKAPRSALAY
DNLJ_EHRRW       TI-STDNFEEAINFYNKMYNN--RSNISYDIDGIIYKINNIKLQHILGTTSKSPRWAIAY
DNLJ_ANAPZ       VL-FADNMDDALSFHTRMYNT--RSTLGYDIDGIVYKVNDTHLQKLLGSTSKYPRWATAH
DNLJ_NEOSM       RL-ASSKVPEIMSFYDSVYRR--RSQIKYDIDGLVYKVNDLKLHARLGTLSDAPRWAIAH
DNLJ_PELUB       NK-KIIGVKNLMLNHKELEEK--RKELAFDIDGIVYKVNDFDLQKRLGFAANAPRWAIAH
DNLJ_SPICI       YRYCSNIAAVWAYIQEYEPK---RNQLGYEIDGIVIKVNNLNLYNRIGYTAKNPKWAIAY
DNLJ_MESFL       TKICKTLEEVKLYIEYYTEK---RNELDYEIDGIVFKLNDKKLQEEVGYTAKTPKWAIAY
DNLJ_UREPA       IVKVDTINEVINQIDCYTKV---RDKLSYMIDGIVIKINNLEVYDEIGYTSKFPKWAIAY
DNLJ_MYCPE       IRHCNNIQGVIERISELTDT---RDQFKYDIDGIVIKVNDFNHYEEIGYTSKFPKWAIAY
DNLJ_MYCPN       VASFDRPEALIEYLEQFDQT---RDQLNFQVDGLVVKLDNFHFYDQLGFTSKFPRWALAY
DNLJ_MYCGA       IKLFSNIKELYTSLKELENN---KNKLDYRIDGAVIKYNNFKDYEIIGYTSKFPKWAIAY
DNLJ_MYCMO       NKFVDTIEKAYEFIKDFEKNN-YREKLNYEIDGIVVKVDDFSLYDILGQTSKFPRSMIAF
DNLJ_MYCS5       QKLAKNDQEIMFEINEFSK---IKNNFEFDCDGFVIKFNLIDKWEQIGFTSKFPKWAIAY
DNLJ_MYCPU       EFIE-NENLIENFITNFKFE---DDQRDYEIDGLVIKLNDLSLYDLLGKTSKFFHHSIAY
DNLJ_MYCH7       QKKCSDLKDVFNFISIIKQK---RDFLNYNIDGVVVKVNEFSIYEKLGSTSKFPHSAIAF
DNLJ_FUSNN       FELLETSKDIEKRINYWEKE---RESLPYETDGLVIKVDEINLWDEIGYTSKTPRWAIAY
DNLJ_LEPIC       TAFVSG----SKIAKTIQEFKKQKDSLGFPTDGLVIKLNDISKRDALGYTSHSPRWARAY
DNLJ_BORBU       IRFFDLKNSIGEVLNYIADITKKRDSFEYEIDGVVLKVSDFALRERLGYTAHHPKWAMAY
DNLJ_ONYPE       YYCVSN---FENLLSVIEKYKTIKEQLTYDTDGIVIKINELAFHSLIGATAKAPRWATAY
DNLJ_NITSB       RAICENEEEIQQLYEEFSKE---RDKLPVMLDGMVVKVDEIALHEILGYTVKYPRWMVAY
DNLJ_SULDN       CATCKDFNEIEAVYQEMSRN---RDSYPMMLDGMVVKVDEIAAQIDMGYTVKNPRFSVAY
DNLJ_CAMHC       VRVCASLTDLRKAYVDLHEM---RERKDILMDGMVIRINELTKCENMGYTIKFPRFMVAY
DNLJ_CAMJJ       IKLCANLDEVLKAYDELLAL---REKKPMMMDGMVVRIDDLALCEELGYTVKFPKFMAAF
DNLJ_WOLSU       RTRCHNIHEIERVYALLVSE---RSTHPVMLDGMVVRVDEIAYQRELGYTIKAPRFACAY
DNLJ_HELHP       LSYCESIESIQNAYNVLFSQ---RNNYPIMLDGMVIMLDKIASQQQLGWTIKSPRFACAY
DNLJ_HELAH       LSLNKNHQEIEANYHTLIQE---RERFFALLDGMVIVVNELNIQKELGYTQKSPKFACAY
DNLJ_CLOTE       IKECKDIVEIKDEIKYIEDI---RNELNYDIDGIVIAINHIKTREVLGYTVKFPRWAIAY
DNLJ1_CLOAB      -NICNNFDEINQAIDNIGEV---RSSLQYDIDGVVIRLNDIETSRLMGYTIKCPKYAIAY
DNLJ_MARHV       PEMRKAEGVEA-CLDAYNELMAKRDSLPYEIDGIVFKVNRLDLQQELGFVSRAPRWAIAH
DNLJ_ALCBS       PEIRVCHGVEA-LLRFYQGILEKREHLDYDIDGVVYKVNRFDWQDDLGFVSRAPRWAIAH
DNLJ_IDILO       IEIKTVDSVQG-CDDYYEAILARRDTLNYDIDGVVFKVDSIRLQQDLGFVARAPRWAIAR
DNLJ_COLP3       PEVRLLESEQA-CDAFYQDILAKRSALSYEIDGTVLKVDEISLQKRLGFVARAPRWAIAY
DNLJ_SHEAM       KEVKLCEGLAE-VMAYYADILKRRDELAFEIDGVVIKVNDIEAQQQLGFVARAPRWAIAF
DNLJ_SACD2       EERRIAKGIEE-CEAYYHYLEAKRESLAYDIDGIVFKVNAFDLQERLGFVSRAPRWAIAH
DNLJ_CHRSD       PLLDVVKGERG-VIDFCHRLGEQRNGLDYDIDGAVIKVDSLRDQRELGFVSRAPRWAIAY
DNLJ_LEGPA       PETRRAIGVEG-CLDYYQYMLAKRNQLPFEIDGVVYKIDSISLQQQLGYVSRAPRFACAH
DNLJ_MAGMM       PEAERVEGAQG-CLAYTERLGEKRETLPYEIDGAVLKVDSQRLRERLGFVARAPRWAMAF
DNLJ_NITMU       RERRTVTGVAG-LLEYHHEINGLREQLSYDIDGTVYKVNELEYQEKLGFVSRAPRFALAH
DNLJ_JANMA       AERAVVKGAAG-LLEFYKAVGQKRPTLPYEIDGVVYKVNRVEQQQQLGFVSRAPRYAIAH
DNLJ_METCA       PEYRVVRGAAG-CLEYYRSLGERRHDLPYDIDGVVYKVDDLKAQAGLGFVSRAPRWAIAH
DNLJ_NITOC       PYSEVVEELAG-CEKYYQHLLDLRDKLPYEIDGVVFKVDYLDQQQILGSLARAPRWALAY
DNLJ_COXBU       SEIKVVGGIEG-CLDYYEHLVKTREKMPFDIDGIVIKVNSLQVQAELGFVSRAPRWAIAY
DNLJ_PSYCK       A-VEVVQNPRE-AQAYYESVKETRGDLPFEIDGMVIKVNSLALQQQLGFLSREPRWATAY
DNLJ_HYDCU       PQSEIISGLEG-MFAYYEKIQAKRSELPYEIDGIVYKLNDIKLQQQLGFTARAPRWAIAR
DNLJ_FRATN       DNMFLAKNFSE-VEEYHHKMSHQRADLAYDIDGLVFKVNNIKLQDIIGYTARGPKWAVAY
DNLJ_DICNV       SLHQKAATLPE-ALAAYQQFAKQREQLPFDIDGVVFKVNRFADQQRAGFLARAPRWAIAW
DNLJ_SODGM       DRVRRCTGSAA-VLDFYRQVHEARLSLGFDIDGVVIKVDSLALQQRLGFVARAPRWAIAY
DNLJ_BAUCH       NYRRYCVGHQE-VLDFYSYVSKVRSKLGFNIDGIVIKVNALVQQQQLGFVARAPRWAIAY
DNLJ_BUCBP       DYNFLHSSYDE-ILRFYNFIQNERYFLNFNIDGIVIKVDSICLQKSLSTTSKAPRWAVAY
DNLJ_BUCCC       KNYCVCKNKKE-VIHFYHYANKIRSQLDFEIDGIVIKLDSIKLQNNLGCIEKYPKWAIAL
DNLJ_BUCAI       KEIVICSSDIE-IIQFYKKIAQKRNFLDFDIDGIVIKVNSLELQKKIGSTTKSPRWAIAF
DNLJ_WIGBR       KNTELCKSLNE-VKNFYEKSIKIRDYLDFNIDGIVVKVNSMKLQKKLGCSSKYPRWAIAY
DNLJ_BLOPB       NYIRLISGVNK-VLEYYSYIKTIRSNLEFNIDGIVIKVNSCAYQSKLGCGSRAPHWALAY
DNLJ_BLOFL       NYIQIVSGIDP-VLEYYNYVRKIRSELEYQIDGIVIKIDNCIYQDQLGCGFRAPNWAVAY
DNLJ_BORA1       VRFNHKAQGAEGLLAFYRRIGAERGSLPYDIDGLVYKVDALAAQRVLGYVARAPRWALAH
DNLJ_PSESM       RELKL-ADGVEECLAYYRDIGERRLSLTYEIDGVVFKVNNLAAQRELGFRAREPRWAIAH
DNLJ_RALSO       K-ERAAVKGGEGLVQFHAAIGAKRDSLPFDIDGVVYKVNSLALQRELGFRTREPRWAVAH
DNLJ_XYLFT       P-LVELVYGSEGLLNYYRRMETIRDTLPFDIDGIVYKLDDLSGQHEMGFVARAPRWAIAH
DNLJ_NEIG1       NGNFGCFKNIGEVLAFYEHMQQKRPELPYEIDGTVVKVNSLAQQHELGFISRAPRWAVAH
DNLJ_BDEBA       EDLLVVAKGPEEVVKYYHHIEKVRPKLPFDIDGVVIKVNSLRLQEDLGLVARSPRWATAA
DNLJ_GEOSL       -PLIRPVKGVAEILAYYREMTERRDSLPYEIDGVVVKVDSFALQRELGEKSRSPRWAVAV
DNLJ_PELCD       LEHSRTLEGIEQVTDYFRQLQQRRDELPYEIDGMVVKVDDLALQRELGEKTRTPRWAIAC
DNLJ_SYNAS       -PFIRQVEGIEKCIEFYRELQDLRNELPYEIDGMVIKVDDLSLQTRLGAVSRSPRWAVAC
DNLJ_SYNFM       -PLSRVCPSIEDAVSFYNEIAAGRDALPFEIDGVVVKVNSIEWQEMLGEKSRSPRWAIAY
DNLJ_MYXXD       NQ-YRRAEGLEGVRQAYDASLKGRHELPFEVDGMVVKVDDEDQRKRLGQVSKSPRWAVAY
DNLJ_ANADF       NAENERCEGIAAVKAYRDRMAERRFALPYDTDGVVVKVDDLDWRRRLGAASKFPRWAVAF
DNLJ_HALHL       TAPLEHLEGVSACQAYRDRLIEERDALPFEIDGAVFKVDDLAVREQLGFTARAPRWALAF
DNLJ_NATPD       DDHTARVDDIEAAIAFREEMLDGRASLDYEIDGIVIKLDRKDACALLGATARAPRWAYAY
DNLJ_HALWD       NDRISRVDSIDDAIAYRDQLKAARAELNYEIDGTVIKVNDRGNREILGATSRSVRWAFAY
DNLJ_SALRD       EDHIRRCDGIDAALAHHAALVDRRDDLPYEIDGLVIKVNDFDGHETLGVRDRDPRWAAAY
DNLJ_LISW6       KERRLCNNLEEVYAYIDEWT-EKRAELAYDIDGIVLKLNDLEQQRQMGTTVKSPRWSIAY
DNLJ_STAS1       QERQRVQTIEEVMTYIDKWT-KQRENLPYDIDGIVIKVNALEQQETLGFTQKSPRWAIAY
DNLJ_GEOSE       PERRRCANIDEVIAFVSEWH-DKRPQLPYEIDGIVIKVDSFAQQRALGATAKSPRWAIAY
DNLJ_ENTFA       PERQLCQSIDEVWAYIEEYH-EKRSTLPYEIDGIVIKVNEFALQDELGFTVKAPRWAIAY
DNLJ_STRS2       HEYCLAESIDDTWDFIEKIA-ERRDDLPYEIDGVVIKVNDLAIQEELGFTVKAPRWAVAY
DNLJ_LACS1       NESKQVKTKEEIFAYIDKAT-DQRANLPYDIDGIVLKAESFAVQSQVGNTVKVPRWAIAY
DNLJ_LACPL       PDFKVAHSMADVFSYIDHYQ-NERPELAYGIDGIVIKANPLPLQRSLGATVKVPRWAIAF
DNLJ_OENOB       SSNKVIDRMTEVKDYIDEYT-IKRDNLPYGIDGVVVKVNDLDVENELGNTVKIPRWSIAY
DNLJ_LEUMM       THNRVINKMADIADYIDEYT-SERESLSYGIDGVVVKVNQLDLQFDLGNTVKIPRWAIAY
DNLJ_PEDPA       PTQEVCANLDEVWDYIAKYE-GQREDLPYGIDGIVLKVNDLSLQQELGHTVKIPRWEIAY
DNLJ_LACDB       ENGRRLENLADVYDYIDEFT-KKRDSLPYVIDGIVLKVDDLALQADLGNTVKVPRWEIAY
DNLJ_SYMTH       PHRHLAHTIDEVLDWVAGWQ-ARRHELPYEIDGLVIKVNDLAQQRRLGFTSKFPRWAIAY
DNLJ_MOOTA       PYRVVAPDIQAVLEEVKAWTPERRASLPYEIDGLVIKVNDLALHSVLGATAKAPRWAMAY
DNLJ_DESHY       PEYRVFSAIEEVIAYCGEMV-EKRHNYPYDIDGLVIKVNDIAQQRELGFTAKSPRWAIAY
DNLJ_CARHZ       PYREVFNNIDDVINYCQSWH-EKRFSLPYVIDGLVIKVNSLAQQEALGFTAKSPRWAIAY
DNLJ_HUNT2       PGYKVCKDINAVWEEINRIG-EERGEIDFEIDGAVVKVNSLEQREILGSTIKAPRWAVAY
DNLJ_CALS8       PDYVVCSNIKEAYEAIKKVE-EKRGLLPFEIDGAVVKLNQLALRDVAGSTAKSPRWAVAY
DNLJ_CALS4       PLIKKCTTIEEVIKAIEELG-EMKDSLPYDIDGAVIKVNELDKREILGQTAKDYRWAIAF
DNLJ_CLOD6       QSYKVCKSIDEVIEHIEYWT-DNRGNLDYEIDGMVIKVNNIKQRDEMGYTAKSPRWAIAY
DNLJ_SYNWW       PEVRFCADINAVLAFTEEYA-EKRHELPYEIDGVVVKLNTLAEREELGATARSPRWAMAY
DNLJ_THEMA       PHSRLCKNIQEVIDYWKEWK-ERKRELDYWVDGVVVKVNRFDFQRILGETSKAPRWAIAF
DNLJ_AQUAE       KDTKVCKGIDEVIEYCKEWE-KKRDSYPYEIDGMVVKVNDRRLWKVLGYTSHHPRWAIAY
DNLJ_SOLUE       DKSRPCDSIDEVLAFCAHWE-GERENLPYEIDGVVVKVDSVEQQRRLGFTAKAPRWAIAY
DNLJ_KORVE       SNRAVFKSIDDVLKFIHKKE-EDREKLPYEIDGVVIKVNSTALWQRLGFTGKAPRWAIAY
DNLJ_SYNE7       PHRQTCPTLAEVEQYFSDWD-ARRRDLPYLTDGVVVKLQSRRLQDELGFTQKFPRWAIAL
DNLJ_SYNJA       PLSQVCRGLEEVVQFYERW---RQAQLPYACDGVVVKLNSLRLQEEAGFTQKFPRWAIAL
DNLJ_SYNY3       PHCQLCKGLDEVVAYFEDWE-GARQRLPYMTDGVVVKINQYPLQRELGFTQKFPRWAIAL
DNLJ_GLOVI       PHRSLCRDLAEVRTFCEHWE-NHRHELPYDTDGVVVKVNAFDHQREVGFTSKFPRWAIAF
DNLJ_PROMT       TTYETTKTLNEANKYYKYWE-VKKDFLAYATDGIVVKIDKFEIQNLLGATNKAPRWAIAV
DNLJ_PROMA       PNAKLISQPDQVEKFCIDWE-KRRHQLPYTTDGIVIKIDDFKLQKTLGITQKAPRWAIAL
DNLJ_PARD8       DVIRKCQSLQDIFDYIAYWD-VERKNLPVATDGIVLKVNSLRQQRNLGFTSKSPRWAIAY
DNLJ_PORGI       DAVTLCCSKEEVYAFIDRFD-TERLTLPVATDGIVLKVNAPAQQDLLGFTAKSPRWAIAY
DNLJ_GRAFK       AESELKDSIEEVLHYINYWD-EHRHDLPYETDGVVVKVNNFHQQEELGHTAKSPRWAIAY
DNLJ_CYTH3       DSYKVCKNVDEIIQYINHWS-EERFKLPLATDGIVIKVNDLRLQSELGMTAKSPRWAIAY
DNLJ_PELLD       GHYRLCKGMQEIAAFIARWN-EERWHLPYETDGVVLKLNDVRQWKTLGATSKSPRWAIAY
DNLJ_CHLPN       GKPRLCSTPEEVISVLKTIE-TERASLPMEIDGAVIKVDSLASQRVLGATGKHYRWALAY
DNLJ_CHLMU       GMPKQCRTKEEVIERIREVE-GMRSRLPMAIDGVVVKVDSVAEQHRLGLTSKHYRWAIAY
DNLJ_PARUW       EHHAYCQNIEQIWKFAEEIR-SLRTILPYDIDGIVIKLNDFKDQKRLGVTGKSPRWAIAY
DNLJ_RHOMR       EHARRFEHLDDVLEYCRYWT-EHRDELDYEIDGVVLKIDHRPWQALLGAISNAPRWAVAY
DNLJ_RUBXD       PHTVH-GDIDSVIEECGRWA-KKREALDFQVDGVVVKVDSREQQERLGAVQKAPRWAIAY
DNLJ_ROSS1       RDARRFERLDDALAYCREWM-TRRDELEYEVDGVVIKIDSLAQQAQLGVVGRDPRWAIAF
DNLJ_THEFI       HGYEKALGAEGVEEVYRRFL-AQRHALPFEADGVVVKLDDLALWRELGYTARAPRFALAY
DNLJ_DEIRA       RSSEHLRGIAAAADYHARMI-RAHADFEFDADGTVLKLDSLSQQEEAGFTSRAPRWAIAY
DNLJ_DEHMC       PLNRLVNTMEEAKEYYRQMA-ANRASLPYEADGVVFKVDSVSLQHRLGDVGREPRWAIAY
DNLJ_DESAG       SQGRLCAAPAD-VEAAFTELSAARHELPFEIDGVVAKLNDLDLQEALGFTARAPRWAIAL
DNLJ1_DESVV      PEGRLCTSPDE-VWAYYEMLGARRESLAIEIDGVVAKVDDTEAQEALGFTARAPRWALAL
DNLJ_LAWIP       PKGKLCISSTE-VQSYYTRLQAQRYSLRYEIDGIVMKLDDIQSQEKLGYTSRAPRFAIAW
DNLJ_RHOBA       APDVVRFENKEDALQAIAKLELEMPDLPFEIDGIVFKVDSFEQREKLGVRSKSPRWVIAY
DNLJ2_STRCO      AVPDVVVGTPEQVVARVQEIAALRAELPFGIDGIVVKADLAADRRAAGSGSRAPRWAIAY
DNLJ1_NOCFA      GAAMRMCADAEQAQAAITDIERGRNDLDYDIDGAVLRLADRDAYAAAGTRSNSPRGALAF
DNLJ_PSYIN       --------YTEILVDFESIVEKMWSAVDYDIDGVVLEVTNETLKEHMGATRHHHRWQIAF
DNLJ_DESPS       --------WLELLQEFEEIVEGLWQKVPYEIDGVVFEIIDEGLREVMGATRHHHRWQIAF
DNLJ_RUTMC       --------VAELVAKFDQIVAQVLVMVDFDVDGVVFEAINTDLKTQMGANRKFHRWQIAF
DNLJ_VESOH       --------MTELVAKFEEIVSQVLVMVDFDVDGVVFEVINIDLKTQMGANRKFHRWQIAF
DNLJ_DESAL       --------GKELLENSEKITQDLIQATDYPMDGMVASVMNQDVRDHMGATSHHYRWQIAI
                                                ** :                   .   * 

DNLJ_TREDE       KFSLEEAVTVLKEIEWSESG-ATYTPIALIEPVRLAGTTVKRASLANPNIIKALN-----
DNLJ_TREPA       KFSTQEAITTLRDVQWQTSG-VTYTPIGITDPVRLAGTTVKRANLCNPNMLTKLC-----
DNLJ_THEFY       KYPPEEVTTKLLDIKTSVGRTGRVTPYAVLEPVKVAGSEVEFATLHNAQEVARKG-----
DNLJ_FRACC       KYPPEEVTTKLRDIRVNVGRTGRVTPFGELEPVLVAGSTVGLATLHNIDEVGRKG-----
DNLJ_SACEN       KYPPEQATTRLLDIQVAVGRTGRVTPYAVMEPVKVAGSTVARATLHNADQVRHKG-----
DNLJ_NOCSJ       KYPPEEVNAKLLEIRVNVGRTGRVTPYAVMEPTKVAGSTVENATLHNFYEVERKD-----
DNLJ_ARTS2       KYPPEEVHTKLLDIAVNVGRTGRVTPFGIMEPVKVAGSTVGMATLHNQDVVKAKG-----
DNLJ_CUTAK       KYPPEEVNTELLDIRVNVGRTGRVTPYGVMRPVTVAGSTVEMATLHNAFEVKRKG-----
DNLJ_CORJK       KYPPEEAMTTLHNIRVGIGRTGRATPYAVMAPKYVAGSTVSMATLHNPTEAHRKG-----
DNLJ_LEIXX       KYPPEQVNTKLLDIVVSVGRTGRATPFAVMEKVKVAGSEVRQATLHNQDVVKAKG-----
DNLJ_BIFLO       KYPPEEVNTELLNITVQVGRTGRVTPVAVLKPVYVAGSTVARTTLHNGFEVKRKG-----
DNLJ_TROWT       KFPSESTVTRLLDIEVSVGRTGRVTPYAVLQPIQLDGSEVSRATLHNQKVIGDKD-----
DNLJ_RHORT       KFPAERAQTTVKAIQIQVGRTGTLTPVAILEPVTVGGVVVGRATLHNEDEIARKD-----
DNLJ_MAGSA       KFPAEQATTLLEAIDIQVGRTGALTPVARLTPVNVGGVVVSNATLHNEDEIARKD-----
DNLJ_CHESB       KFAAEKAFTILRDIDIQVGRTGALTPVARLEPVTVGGVVVTNATLHNAEEIERLG-----
DNLJ_BRADU       KFPAEQAMTVLRDIEIQVGRTGSFTPVGKLEPVGVGGVIVQNVTLHNEDYIKGIGNKGEV
DNLJ_RHILO       KFPAEQAMTTVQKIDIQVGRTGTLAPVARLAPVTVGGVVVENVTLHNEDYIKGFDSNGLP
DNLJ_BARBK       KFPAEKAMALLENIDIQIGRTGALTPVARLAPITVGGVVVTNASLHNEDYIKGLGSKSES
DNLJ_PARDP       KFPAERAWTRLEAIDIQVGRTGALSPVARLHPVTVGGVVVSNATLHNEDYIAGRGADGSE
DNLJ_MARMM       KFPAEQATTILEAIDIQVGRTGALTPVARLTPVTVGGVVVTNATLHNQDEIERKD-----
DNLJ_HYPNA       KFPAEKAVTTLLGIDIQVGRTGSLTPVARLEPVTVGGVVVSNATLHNEDEIARLG-----
DNLJ_CAUVC       KFPAQRARTVLEAIDLQVGRTGAITPVARLKPVTVGGVSVTNATLHNGDEIARLD-----
DNLJ_SPHAL       KFPAERAQTTLEAIDIQVGRTGKLTPVGRLTPVTVGGVVVSNVTLHNRDEIARLG-----
DNLJ_ZYMMO       KFPAEKAQTTLLDIEIQVGRTGVLTPVAKLEPVTVGGVVVSSATLHNSDEIERLG-----
DNLJ_RHOPB       KFAAEQATTILNGIEIQVGRTGALTPVARLAPVTVGGVVVQNATLHNEDYIKSLD-----
DNLJ_GLUOX       KFPAEQAITRLREIEIQVGRTGALTPVAHLEPVNVGGVIVSRATLHNEDEIARKD-----
DNLJ_PELPD       KFPPEKRETLLQNITISVGRSGALTPVAELLPVRLLGTTVSNATLHNQDEVECKD-----
DNLJ_RICTY       KFPAIIGQTKLLSITVQVGRTGMLTPVAELDPLEIGGVVVSRATLHNFQDIARKD-----
DNLJ_ORITB       KFPALIGRTKITNITLQVGKTGAVTPVALLIPINIAGVTISRATLHNKQEIESKD-----
DNLJ_WOLTR       KFSAVYAKTKLNKIFIQVGRTGVLTPVADLIPVNIGGVLVSRANLHNQDEIKRKD-----
DNLJ_EHRRW       KFPAIEGKTKLNKISIQVGRTGVLTPIAELAPINIGGVVITRASLHNKSEIERKD-----
DNLJ_ANAPZ       KFPSTEAITKLRDISVQVGRTGVITPIAELEPINIGGTLVSRASLHNLNEIARKD-----
DNLJ_NEOSM       KFPSHRAKTILEKIKLSVGRTGIITPVAHLKPITIGGVVISRASLYNEDELERKD-----
DNLJ_PELUB       KFSANSSISEIMNIEIQIGRTGALTPVAKIKPVNIGGVIVSNATLHNEDEIVRKD-----
DNLJ_SPICI       KFPAEVVVTKLLNIFPSVGRTGRITYNAVLEPIRIVGTIVRAATLHNADFITERD-----
DNLJ_MESFL       KFPAEVKQTKLLDIFPTVGRTGKITYNAKLEPVQIAGTTVSAASLNNAEYIMAKD-----
DNLJ_UREPA       KFPANVVSSQLLEIINDVGRTGKISYVAKIKPILLDGSMVEYATLHNFDFIKEKD-----
DNLJ_MYCPE       KFPAVVKQTKLNSIDVTVGRTGRINYIANLDEILLEGSQVKKATLHNYDYIKDHE-----
DNLJ_MYCPN       KFKPKFVQTKLRGVLVTVGRTGKINYTAQLDPVNLEGTVVSAATLHNFDYIKEKD-----
DNLJ_MYCGA       KFAPTQVQTQLKDIILNVGRTGKLTFVAQLAPIELEGSIITYATLHNLEYINDLD-----
DNLJ_MYCMO       KFSDISIETKLIDIFISVGRTGKITYNAILEPVIINGTLVSAATLHNYEYVESLK-----
DNLJ_MYCS5       KYMLEEANTKILNIVAQVGRTGNITYIAQFMPVELNNTTVQNATLHNYEFIKKNN-----
DNLJ_MYCPU       KFRKKFVMTKIEDIFVTVGRTGLITYNAKLQEVVLNGSKIKAATLHNYEYIKNIK-----
DNLJ_MYCH7       KFEDDIAKTKLLAIFATIGRTGKVTYNAKIEPVTLAGSKISSAILPNYSYIENLK-----
DNLJ_FUSNN       KFPAHQVSTVLNDVTWQVGRTGKLTPVAELQEVELSGSKVKRASLHNISEIQRKD-----
DNLJ_LEPIC       KFDAIMKESKIVDITYAVGRTGKITPRAEIEPISLAGTTVTFATLHNQDYIDELG-----
DNLJ_BORBU       KFEALSGFSRVNSIVVQVGRSGKITPVANIDKVFVSGAFITSATLHNQDYIRSIG-----
DNLJ_ONYPE       KFATITSQSIVQNIIFQVGRTGVITPVCKIMPVMVDGSLVSKVVLHNYDYICKKD-----
DNLJ_NITSB       KFPAVEKMTRIIDIVPQVGRTGVITPVAILEPVEIEGVVVERATLHNYAEIERKD-----
DNLJ_SULDN       KFPAVEKITTIKEIILQVGRTGAVTPVAIVEPTNIDGVVVERATLHNFDEIQRKD-----
DNLJ_CAMHC       KFPPVEKATKLIDINLQVGRTGVITPVGVLEPVNIDGATVRNATLHNFDEIARLG-----
DNLJ_CAMJJ       KFPALEKTTRLIGVNLQVGRSGVITPVAVLEPVNLDGVVVKSATLHNFDEIARLD-----
DNLJ_WOLSU       KFPAIEKKARLLSITLQVGRSGVVTPVANLEPVEIEGAMISRATLHNFDEIKRLD-----
DNLJ_HELHP       KFPAVEKSSKILSVSLQVGRTGIITPVAELKPVEIEGAMISRATLHNFSEIERKD-----
DNLJ_HELAH       KFPALEKHTKIVGVINQVGRSGAITPVALLEPVEIAGAIITKATLHNYSEIEKKN-----
DNLJ_CLOTE       KFEAEEATTKLIDVEWNVGRSGRVTPTALLESVELGGATIKRATLNNMDDIIRKK-----
DNLJ1_CLOAB      KFKAKETTTKLIDVEWNVGRSGRINPTAILEPVELAGVIVKRATLNNMDDIKRKK-----
DNLJ_MARHV       KFPAQEELTIIEDVEFQVGRTGAVTPVARLKPVFVGGVTVSNATLHNMDEIRRLD-----
DNLJ_ALCBS       KFPAQEELTVLNGVDWQVGRTGALTPVARLEPVHVGGVIVSNATLHNIDEIQRLD-----
DNLJ_IDILO       KFPAQEQLTTITGVDFQVGRTGAITPVARLEPVNVGGVTVSNATLHNADEIERLG-----
DNLJ_COLP3       KFPAEEELTCVEDVEFQVGRTGAITPVARLKPVFVGGVTVSNATLHNQDEITRLG-----
DNLJ_SHEAM       KFPAQEEMTVLEGVDFQVGRTGAVTPVARLKPVFVGGVTVSNATLHNGDEIARLG-----
DNLJ_SACD2       KFPAQEALTVLHDVEFQVGRTGAITPVAKLQPIFVGGVTVSNATLHNKDEIERLG-----
DNLJ_CHRSD       KYPAQEQTTTLNDVVFQVGRVGTLTPVAKLEPVQVAGVTVANATLHNMDEIERLG-----
DNLJ_LEGPA       KFPATEEMTRLIAVDFQVGRTGAVTPVARLEPVSVGGVTVSNATLHNFDEITRKD-----
DNLJ_MAGMM       KFPATEESTTVQAIDLQVGRTGVITPVARLEPVAVGGVTVTNATLHNFLELARKD-----
DNLJ_NITMU       KFPAQEATTELLGIDVQVGRTGALTPVARLKPVFVGGATVTNATLHNEDEIRRKD-----
DNLJ_JANMA       KFPAEEALTTVQGIEVQVGRTGAITPVARLAPVLVGGVTVTNATLHNEDEVRRKD-----
DNLJ_METCA       KFPAEEARTRVVGIDVQVGRTGVLTPVARLEPVFVGGVTVTNATLHNADEIRRKD-----
DNLJ_NITOC       KFPAQEELTQILDIEVQVGRTGALTPVARLQPVFVGGVTVSKATLHNEGEIQRKD-----
DNLJ_COXBU       KFPAQEKMTVVKAIEFQVGRTGAVTPVARLEPVSVSGVTVSNATLHNFDELYRKD-----
DNLJ_PSYCK       KFPAETVMTRLHAIEWQVGRTGAITPVGKLEPVKVGGVTVSNVTLHNFGEIQRLD-----
DNLJ_HYDCU       KFPAEEVWTKLLDIEVQVGRTGAITPVARLQPVSVGGVIVSNATLHNMDEIKRKD-----
DNLJ_FRATN       KFPAEEVESEVLNVEFQVGRTGAITPVARLKPVAVGGVIVSNATLHNINEIKRKD-----
DNLJ_DICNV       KFPALEKTTRIEAIELQVGRTGAVTPVARLQPVTIAGVVVRSASLHNAREIARKD-----
DNLJ_SODGM       KFPAQEQLTRVRDVEFQVGRTGAITPVARLEPVLVSGAMVSNATLHNADEVERLG-----
DNLJ_BAUCH       KLPANEQLTEIQNIDFQVGRTGIITPVARLKPVYISGAYISNASLHSFAEIKRLG-----
DNLJ_BUCBP       KFSDKIKITTIMNILYQVGRTGVITPVAQVTPIYISGVLIKKVSLHNFNEIRRLN-----
DNLJ_BUCCC       KFFSLDKETKIFKISFKVGRTGIITPVAYFFPINLFGVSISKASLYNIKTIKLLD-----
DNLJ_BUCAI       KFSPKERITTLNDVKFQVGRTGVITPVAYFNPVYISGVMISKASLHNKNEIERLN-----
DNLJ_WIGBR       KFSSEEKCTKILGVNFNVGRTGVITPVAKLKPVYFMGTIIKYSSLHNKDIIDKLG-----
DNLJ_BLOPB       KFPSEVSSAKVDNVIFQVGRTGIITPIAYLEPIVISDVTIRKVNMHNINEVKRLG-----
DNLJ_BLOFL       KFPAELKLTKLNDVVFKVGRTGLITPIAYINPVVIGNVIIKKVNMHNVNEVKRLN-----
DNLJ_BORA1       KFPAEEATTELLDIEVQVGRTGAITPVARLKPVFVGGVTVTNATLHNEDEIRRKD-----
DNLJ_PSESM       KFPAMEELTELLDVEFQVGRTGAVTPVARLKPVKVAGVMVANATLHNMDEVARLG-----
DNLJ_RALSO       KYPAQEALTTVESIGVQVGRTGAITPVARLVPVFVGGVTVTNATLHNEDEVRRKD-----
DNLJ_XYLFT       KFPAQEQTTTVEAIEIQIGRTGAATPVARLTPVQVAGVTVTSVTLHNADQIARLD-----
DNLJ_NEIG1       KFPAEEALTIVEAIDVQIGRTGAVTPVARLQPVFVGGVTVTNATLHNQDEVSRKD-----
DNLJ_BDEBA       KFKPEQAQTTVEDIVVQVGRTGALTPVAIMKPVKVGGVTVTNATLHNQDEITRKD-----
DNLJ_GEOSL       KFPPRQAVTVVEDIVPSVGRTGVITPTANLRPVEVSGVTVSRATLHNWEEMERKD-----
DNLJ_PELCD       KFPPRQAVTVVEDIVLQVGRTGAITPVAQLKPVEVSGVTVSRASLHNWDEIARLD-----
DNLJ_SYNAS       KFAATQATTVIRDIIVNVGRTGTLTPVALMTPVKVGGVTVSRATLHNQDEIDKKD-----
DNLJ_SYNFM       KFSPHQARTRVLDIKVQVGRTGVLTPVAELEPVTVGGVTVRRATLHNQDEVERKD-----
DNLJ_MYXXD       KFPPEEESTEVMDIGIQVGRTGALTPVAHLKPVKVGGVTVARATLHNEDELRRKD-----
DNLJ_ANADF       KYPPQEEATRIRRIWASVGRTGILTPVVDFEPVRLSGAMVSRATLHNEDEMRRKD-----
DNLJ_HALHL       KLPAREATTVVEAIVPSVGRTGKITPLARLQPVEVSGVTVARASLHNADELARMD-----
DNLJ_NATPD       KFPARTEETTVRDIVLQVGRTGRLTPVALLDPVEVSGVEVSRATLHNPQQIAELG-----
DNLJ_HALWD       KFPPRAEITHITDIVVQVGRTGRLTPVALLDPVDVGGVTVSRASLHNPEEIKRLS-----
DNLJ_SALRD       KFPPRRATTSIEDLFVQVGRTGRITPVAVLAPVEVGGVEVTRASLHNQNEIDRKD-----
DNLJ_LISW6       KFPAEEVPTKLLDIELNVGRTGVITPTAVLEPVRVAGTTVSRASLHNEDLITEKD-----
DNLJ_STAS1       KFPAEEVVTELLDIELSIGRTGVVTPTAVLEPVRVAGTTVSRASLHNEDLIHDKD-----
DNLJ_GEOSE       KFPAEEVVTTLIGIEVNVGRTGVVTPTAILEPVRVAGTTVQRATLHNEDFIREKD-----
DNLJ_ENTFA       KFPPEEAETVVEDIEWTIGRTGVVTPTAVMAPVRVAGTTVSRASLHNADFIQMKD-----
DNLJ_STRS2       KFPAEEKEAEILSVDWTVGRTGVVTPTANLSPVQLAGTTVSRATLHNVDYIAEKD-----
DNLJ_LACS1       KFPPDEQETKVLDIEWTVGRTGVVTPTAVMEPVTLAGTTVARASLHNPDYLKEKD-----
DNLJ_LACPL       KFPPDEQPTLLKDVEWTVGRTGVVTPTAVMEPVQLAGTTVARASLHNPDYVAAKD-----
DNLJ_OENOB       KFPPEEALTVVRDITWTVGRTGVVTPTAIMDPVFLAGTKVKRASLHNPDYLQEKD-----
DNLJ_LEUMM       KFPPEEALTIVCDIEWTVGRTGAVTPTAVMDPVLLAGTTVQRASLHNPDYLREKD-----
DNLJ_PEDPA       KFPPEEAATVVRDIEWTVGRTGVVTPTAVMDPVQLAGTTVSRATLNNVDQLTAKD-----
DNLJ_LACDB       KFPPEEEETVVREIEWTVGRTGVVTPTAVMDPVRLAGSTVARASLHNPDLLAKLD-----
DNLJ_SYMTH       KFPAEERETTVVGISLEVGRTGVVTPSADLAPVRIAGTTVKRATLHNEDYIREKD-----
DNLJ_MOOTA       KFPAEQATARVEGIILRVGRTGVLTPTAVLTPVRLAGTTVSRATLHNEDYIREKD-----
DNLJ_DESHY       KFPAEQVETVVEDIVIRVGRTGVLTPTAYLTPVFVAGSTVGRATLHNLDNIRAKD-----
DNLJ_CARHZ       KFPAEIAETRLKDIIVRVGRTGVLTPTAIFEPVSLAGTTVTRASLHNEDYIREKD-----
DNLJ_HUNT2       KYPAEVKETVVKKITVNVGRTGVLTPIAIFDPVRLAGSTVSRATLHNMDYIKEKD-----
DNLJ_CALS8       KFPPEKKETKLIDIEVNVGRTGILTPTAVLEPVRISGSVVSRATLHNMDYIRQKD-----
DNLJ_CALS4       KYPAEMKKTKIVDIVVQVGRTGALTPTAVLEPVVISGSVVSRATLHNEDYIKEKD-----
DNLJ_CLOD6       KFPAEKKKTKIVDIIVEVGRTGTITPSAILEPVRLAGTTVSRATLHNEDYIREKD-----
DNLJ_SYNWW       KFPAEEKETRLLGVEINVGRTGIIAPTALLEPVFLAGTTVSRASMHNFDLIKEKD-----
DNLJ_THEMA       KFPAEQARTRVLDVTIQVGRTGVLTPVAELEPVQLAGTIVKRASLHNFEYIREKD-----
DNLJ_AQUAE       KFKPRRAVTKLVDVVFQVGRTGTITPVGKLEPVELGGVTVSSVSLFNEDFIREKD-----
DNLJ_SOLUE       KYPARQATTMIEGIDVQVGRTGALTPVANLKPVVVGGVTVSRATLHNEDEIERLG-----
DNLJ_KORVE       KYAARAAVTQVEDILVQVGRTGKLTPVAALKPVPIGGTTVSRATLHNMDEIDRLG-----
DNLJ_SYNE7       KYPADEAPTQLQHVTVQVGRTGALTPVAEFSPVALAGTTVSRATLHNADRLRELD-----
DNLJ_SYNJA       KYPAQEVPTRIRAIVASVGRTGAVTPVAELEPVLLAGTTVSRASLHNADRLEELD-----
DNLJ_SYNY3       KYPAEETPTVVKAIEVNVGRTGAVTPLAVMEPVQLAGTTVQRATLHNQDRIQELD-----
DNLJ_GLOVI       KYPAEEKSTVVEAIAVQVGRTGALTPVAELQPVAVAGTTVSRATLHNQDRIESLD-----
DNLJ_PROMT       KYPAEEKATKLRKIIFQVGRSGAVTPVAEFESIELAGTSVNRATLHNAKRLASLD-----
DNLJ_PROMA       KYPAEEAPTQLNKLIFQTGRTGTVTPVAEFNPIPLGGTLVSKATLHNANRLSELD-----
DNLJ_PARD8       KFQAERAETRLNSVSFQVGRTGTVTPVANLEPVLLAGTVVKRASLHNADIIEGLD-----
DNLJ_PORGI       KYQAERVRTRLQHVSYQVGRTGAVTPVANLDPVLISGTVVRRASLHNADFIAEKD-----
DNLJ_GRAFK       KFKAEQESTKLNKITYQVGRTGAITPVANLDAVQLAGTVVRRASLHNADQIEKLD-----
DNLJ_CYTH3       KFKAEEASTPILSVEYQVGRTGAVTPVANLAPVHLAGTTVKRATLHNANEMERLN-----
DNLJ_PELLD       KYPAQQATTVLRDVVFQVGRLGTITPVAELEPVRLAGSTVSRSTLHNFDEMRRLG-----
DNLJ_CHLPN       KYAPEEAETLLEDILVQVGRTGVLTPVAKLTPVLLSGSLVSRASLYNEDEIHRKD-----
DNLJ_CHLMU       KYAPERAETILQDITVQVGKTGILTPVAELTPVLLSGSRVSRASLYNEDEIEKKD-----
DNLJ_PARUW       KFAAEQAKTRIIDITVQIGRTGVLTPVAELEPIFLSGSTIARASLYNQEEVQRKD-----
DNLJ_RHOMR       KFPAREAITRLLDIMVSVGRTGVVKPVAVLEPVEVGGVTVSQATLHNEDYVRSRD-----
DNLJ_RUBXD       KFEPLAGRTRLRDIVVTVGRTGALTPQAVLEPVNVGGVTISRATLHNEDYIKEKG-----
DNLJ_ROSS1       KFPAREAVSRLIDIVVNVGRTGVITPNAVIEPVNIGGVTVRNASLHNADYIAERD-----
DNLJ_THEFI       KFPAEEKETRLLDVVFQVGRTGRVTPVGVLEPVFIEGSEVSRVTLHNESYIEELD-----
DNLJ_DEIRA       KFPVEEVETVLESITVNVGRTGKLAPLAHLSPRLIEGSTVSKATLHNEDYIRDMD-----
DNLJ_DEHMC       KFPAEQVMTRLKKIGISVGRTGTLNPFAVLEPVNVGGVVVKQAALHNEDDILRKD-----
DNLJ_DESAG       KFPAHQARTRLKDIRIQVGRTGVMTPVAELEPVTVGGVTVSSATLHNEDEIRAKG-----
DNLJ1_DESVV      KFPAMQVRTRLQDIRVQVGRTGVLTPVAILEPVRVGGVEVSRATLHNAYEIEDKG-----
DNLJ_LAWIP       KFPATQVQTRLLQIHIQVGRTGVLTPVAELEPINVGGATISRATLHNEDEIKNKD-----
DNLJ_RHOBA       KFERYEAITTLEAIDVQVGKTGTITPVAYLTPVDIADTTVSRASLHNADEIERLD-----
DNLJ2_STRCO      KLPAVEKITRLLEVEWNVGRTGIIAPRGVLEPVVIEGSTITYATLHNPADITRRG-----
DNLJ1_NOCFA      KFAAEEKTTVLEAVTWDVGKTGKIVPVARLEPVFVGGTTVTKATLANQQVIRARD-----
DNLJ_PSYIN       KVNAESAEVKVLNVTPQTSRTGRVTPVAELEPTKLSGATISRATVHHYNMVKTNG-----
DNLJ_DESPS       KKNTEIAEVTVLRVRPQTSRLGRVNPVAEVEPTRLSGALIQRVTAHHYAMVRDRG-----
DNLJ_RUTMC       KENKDKAHVKVLNVIPQVGRSGKITPVVELEPTLLSGATIMRATGHNYGLVKEQG-----
DNLJ_VESOH       KENKDIVQVKVLNVMPQVGRSGKITPVAEVEPTLLSGATIVRVTGHHYGLVKEQG-----
DNLJ_DESAL       KAKGETGVTTVNAITWQVGRTGNVTPVLEVEPLKLSGATIRRVTAHNAGRIREKG-----
                 *         :  :    .               . .  :                    

DNLJ_TREDE       ------LKIG------SRVVVTKRGEIIPKIEALAENPPN--------------------
DNLJ_TREPA       ------LKIG------SHVLISKRGEIIPKIEALVSTPAH--------------------
DNLJ_THEFY       ------VLIG------DTVVVRKAGDIIPEVVGPVVEKRTGT------------------
DNLJ_FRACC       ------VLIG------DTVVLRKAGDVIPEIVGPVVDLREGS------------------
DNLJ_SACEN       ------VLIG------DRVVIRKAGDVIPEVLGPVVDVRDGS------------------
DNLJ_NOCSJ       ------VRPGGPGDPGDTVILRKAGDVIPEILGPVLALRPEG------------------
DNLJ_ARTS2       ------VKIG------DIVVLRKAGDVIPEIVGPVLALRDQQD-----------------
DNLJ_CUTAK       ------VLIG------DTVVLRKAGDVIPEILGPVVELRNGT------------------
DNLJ_CORJK       ------VLLG------DTITIRKAGEVIPEVLGPVEDKRTGA------------------
DNLJ_LEIXX       ------VLIG------DTVVLRKAGDVIPEVLGPVVELRDGT------------------
DNLJ_BIFLO       ------ILIG------DTVVVRKAGDVIPELVGPVLERRKGRE-----------------
DNLJ_TROWT       ------LLIG------DYVRIRKAGDIVPEVLCALPEKRDGS------------------
DNLJ_RHORT       ------VRIG------DMVTIQRAGDVIPQVVEVLLDQRP--------------------
DNLJ_MAGSA       ------VRIG------DTVIVQRAGDVIPQIVGVVPG-KP--------------------
DNLJ_CHESB       ------IKIG------DTVQVQRAGDVIPQILGYAEDRRP--------------------
DNLJ_BRADU       LREGRDIRIG------DTVVIQRAGDVIPQVVDVVLDKRP--------------------
DNLJ_RHILO       IRDGIDVRIG------DTVVIQRAGDVIPQIVSVVIDKRP--------------------
DNLJ_BARBK       IREGRDIRIG------DTVIVQRAGDVIPQIIDVIIEKRP--------------------
DNLJ_PARDP       IRGGKDIRIG------DWVEVYRAGDVIPKVADVDLAKRP--------------------
DNLJ_MARMM       ------IRVG------DTVVIQRAGDVIPQVVRVVDPDRP--------------------
DNLJ_HYPNA       ------VKPG------DKVEIQRAGDVIPQVLRVVEP-----------------------
DNLJ_CAUVC       ------VRVG------DTVVIQRAGDVIPQIVEVALDARP--D-----------------
DNLJ_SPHAL       ------VRPG------DRIIVQRAGDVIPQVVENLTRD----------------------
DNLJ_ZYMMO       ------VRPG------DRVLVQRAGDVIPQIVENLTPD----------------------
DNLJ_RHOPB       ------IHIG------DTVVVQRAGDVIPQIVSVVRDKRP--------------------
DNLJ_GLUOX       ------VRVG------DLVRLQRAGDVIPQILGPVPSEEP--------------------
DNLJ_PELPD       ------FRID------DTIVVQRAGDVIPQVVSVVIEKRL--------------------
DNLJ_RICTY       ------VRIK------DYVFLQRAGDVIPQITGVDISKR--S------------------
DNLJ_ORITB       ------IRIG------DYVFLHRAGDVIPKINGVDLSARD-A------------------
DNLJ_WOLTR       ------VREG------DIVTIKRAGDVIPQIVRVDKGSR--H------------------
DNLJ_EHRRW       ------IREG------DYVIVKRAGDVIPQVVDVDKSLR--T------------------
DNLJ_ANAPZ       ------IRIG------DSVIVKRAGEVIPQVVGVDHTARCNS------------------
DNLJ_NEOSM       ------IREG------DLVIVERAGDVIPKVLEVDISYR---------------------
DNLJ_PELUB       ------IRVG------DTVTVERAGDVIPHVVSVDLKKR--K------------------
DNLJ_SPICI       ------IRIG------DNVQVKKAGDIIPEVINYVAARRQKN------------------
DNLJ_MESFL       ------LRIN------SIVKVKKAGDIIPEVISAIKDEKFDL------------------
DNLJ_UREPA       ------IRIN------DEIKIYKAGDVIPYVDGVDLSKRLAN------------------
DNLJ_MYCPE       ------IMLN------DIVEIYKAGEIIPKIIRSIKEKRDGS------------------
DNLJ_MYCPN       ------IRLN------DTVIIYKAGEIIPKVLEVCLPLRTAA------------------
DNLJ_MYCGA       ------IRIN------DYVYLIKAAEIIPKVIGVNLDKRPNN------------------
DNLJ_MYCMO       ------LNKN------DNVKIIKAGEIIPKVVSLSK---KNS------------------
DNLJ_MYCS5       ------INIG------DEITIIKSGEIIPKVISIYK---KNT------------------
DNLJ_MYCPU       ------INIG------DKVYIEKAGEIIPRVVKLVSP--KND------------------
DNLJ_MYCH7       ------LNLN------TEVYIKKAGEIIPQIIGSVH---NYP------------------
DNLJ_FUSNN       ------IRIG------DRVFIEKAAEIIPQVVKAIKEERTGN------------------
DNLJ_LEPIC       ------VGIG------AIVRVAKRGEIIPAVEEVVTP-GKEV------------------
DNLJ_BORBU       ------LNVG------DVVKVSRRGDVIPAVEMVINKFSTGF------------------
DNLJ_ONYPE       ------IRIK------DHVIVHKAGSVIPEILEVIKSKRTDL------------------
DNLJ_NITSB       ------IRIG------DMVIVIRSGDVIPEVTKVLTQYRTGK------------------
DNLJ_SULDN       ------IRIN------DHVIILRSGDVIPKIIKVLTHERDGS------------------
DNLJ_CAMHC       ------LMKG------DIVSIIRSGDVIPKITGVFGARRNGS------------------
DNLJ_CAMJJ       ------VKIN------DFVSVIRSGDVIPKITKVFKDRREGL------------------
DNLJ_WOLSU       ------VREG------DWVSLIRSGDVIPKIIQPFAHLRSGE------------------
DNLJ_HELHP       ------IRLG------DEVIIIRSGDVIPKIIKPLVALRDGT------------------
DNLJ_HELAH       ------IMLN------DRVVVIRSGDVIPKIIKPLESYRDGS------------------
DNLJ_CLOTE       ------VRLG------AEVFIRRSNDVIPEIMGVVES-SLEN------------------
DNLJ1_CLOAB      ------IKKG------ARVFLRRSNDVIPEIMGVTEE-TEGE------------------
DNLJ_MARHV       ------VHIG------DTVFIRRAGDVIPQVVKVV-PEKRP-------------------
DNLJ_ALCBS       ------IRIG------DTVVVYRAGDVIPKVVRAL-PERRP-------------------
DNLJ_IDILO       ------VRIG------DCVSIRRAGDVIPQVVSVI-KDKRP-------------------
DNLJ_COLP3       ------LKVN------DFVVIRRAGDVIPQIVSVV-LDKRP-------------------
DNLJ_SHEAM       ------VKIG------DTVIIRRAGDVIPQIVAVV-PERRP-------------------
DNLJ_SACD2       ------IRVG------DTVIVRRAGDVIPQIVSIV-ESKRP-------------------
DNLJ_CHRSD       ------VRIG------DTVIVRRAGDVIPQIVGVV-ESQRP-------------------
DNLJ_LEGPA       ------IRIG------DTVIIRRAGDVIPEVVSVI-LEKRP-------------------
DNLJ_MAGMM       ------VRVG------DRVIVRRAGDVIPEVVRVI-PRESH-------------------
DNLJ_NITMU       ------VMIG------DRVTVRRAGDVIPEVVAVQ-KESRP-------------------
DNLJ_JANMA       ------IQIG------DTVIVRRAGDVIPEVVAYV-PEKRP-------------------
DNLJ_METCA       ------VRPG------DTVIVRRAGDVIPEIVRVV-PELRK-------------------
DNLJ_NITOC       ------IRIG------DTVYVRRAGDVIPEIVKVI-MERRL-------------------
DNLJ_COXBU       ------VRVG------DTVIVRRAGDVIPEVVGPI-LAKRP-------------------
DNLJ_PSYCK       ------VRAG------DMVSVHRAGDVIPKVTRVW-TDQRP-------------------
DNLJ_HYDCU       ------VRIG------DTVIVRRAGDVIPEVVGPI-LTQRP-------------------
DNLJ_FRATN       ------IRVG------DRVIVRRAGDVIPEVVKSL-PQYRK-------------------
DNLJ_DICNV       ------IRVG------DTIFIRRAGDVIPEVVSVV-LEKRL-------------------
DNLJ_SODGM       ------LMIG------DTVIVRRAGDVIPQIVGVV-TSERP-------------------
DNLJ_BAUCH       ------LRIG------DTVVIRLAGNIIPQIVNVV-VSKRS-------------------
DNLJ_BUCBP       ------LNIG------DSVFIKRSGDVIPHIIEVA-SKCKL-------------------
DNLJ_BUCCC       ------IRLH------DYVTVYRAGDVIPKIRNVL-IHKRN-------------------
DNLJ_BUCAI       ------LHFN------DTITICRSGDVIPRLLNVI-EIRRC-------------------
DNLJ_WIGBR       ------IMIN------DTVCLKKSGDVIPKISRVI-FEKR--------------------
DNLJ_BLOPB       ------LMIG------DTVRIQRSGDVIPKIVEVI-LSERT-------------------
DNLJ_BLOFL       ------LMIG------DTVIVQRSGDVIPKILKII-LENRV-------------------
DNLJ_BORA1       ------VRIG------DRVIVRRAGDVIPEVVGPV-LEKRS-------------------
DNLJ_PSESM       ------LMIG------DTVIIRRAGDVIPQVVQVV-VERRP-------------------
DNLJ_RALSO       ------VRVG------DTVIVRRAGDVIPEVVAVV-LERRPMEDVPGSDLFNPTQQ----
DNLJ_XYLFT       ------VRIG------DTVIVRRAGDVIPEVVAVI-TDSRP-------------------
DNLJ_NEIG1       ------VRVG------DTVVVRRAGDVIPEVVRVI-FERRPMQETAVAVSDGIGHQQDDL
DNLJ_BDEBA       ------IRIG------DTVIIQRAGDVIPEVVEVVNPDKRP-------------------
DNLJ_GEOSL       ------IRIG------DTVVIERAGDVIPAVVKVL-TEKRS-------------------
DNLJ_PELCD       ------VLIG------DTVVVERAGDVIPDVVKVL-TEHRN-------------------
DNLJ_SYNAS       ------IRIG------DTVLVQRAGDVIPEVVKVI-VSNRS-------------------
DNLJ_SYNFM       ------IRVR------DQVMVRRAGDVIPEVVEVI-GEART-------------------
DNLJ_MYXXD       ------VRKG------DTVFVRRAGDVIPEIVSVV-LSKRP-------------------
DNLJ_ANADF       ------VLEG------DWILVRRAGEVIPEVVMPL-KERRT-------------------
DNLJ_HALHL       ------VREG------DTVMVRRAGDVIPQITDVV-LAKRP-------------------
DNLJ_NATPD       ------VGIG------DRVTLKRAGDVIPYIEAVV-DSER--------------------
DNLJ_HALWD       ------VNSG------DEVRVRRAGDVIPEVAEVT-QKRA--------------------
DNLJ_SALRD       ------IRIG------DTVLIERAGDVIPQVVKVI-EDERD-------------------
DNLJ_LISW6       ------IRIG------DTVLIKKAGDIIPEVIKSI-TEERS-------------------
DNLJ_STAS1       ------IRIG------DSVVIKKAGDIIPEVIKSV-LDRRP-------------------
DNLJ_GEOSE       ------IRIG------DAVIIKKAGDIIPEVVGVV-VDRRD-------------------
DNLJ_ENTFA       ------IRLN------DHVIIYKAGDIIPEVAQVL-VEKRA-------------------
DNLJ_STRS2       ------IRIG------DTVIVYKAGDIIPAVLKV--VDKYR-------------------
DNLJ_LACS1       ------IRIG------DTVKLHKAGDIIPEISEVV-LAKRT-------------------
DNLJ_LACPL       ------VRIG------DTVLLHKAGDIIPEISSVD-LAKRP-------------------
DNLJ_OENOB       ------VRIG------DTVTLHKAGDIIPEVGQVI-LKKRP-------------------
DNLJ_LEUMM       ------IQIG------DTVTLHKAGDIIPEIGQVI-LEKRP-------------------
DNLJ_PEDPA       ------VHIG------DTVLLHKAGDIIPEITRVV-LEKRP-------------------
DNLJ_LACDB       ------VRLG------DTVKLHKAGDIIPEISEVV-LSKRP-------------------
DNLJ_SYMTH       ------IRVG------DTVIVRKAGEIIPEVVRVV-PEKRP-------------------
DNLJ_MOOTA       ------IRIG------DTVIVQKAGDIIPEVVAVI-PERRT-------------------
DNLJ_DESHY       ------VRIG------DHVLIQKAGDVIPEVVKIL-PEKRT-------------------
DNLJ_CARHZ       ------IRIG------DIIRVQKAGEIIPEVVEVV-KEKRT-------------------
DNLJ_HUNT2       ------IRIG------DTVRIRKAGDIIPEVVDVV-FEKRS-------------------
DNLJ_CALS8       ------IRIG------DTVVVQKAAEIIPEVVEVV-FSKRT-------------------
DNLJ_CALS4       ------IRIG------DTVLVHKAGGIIPEVVEVV-KEERT-------------------
DNLJ_CLOD6       ------IKIN------DTVLVQKAGDIIPQVLEVI-KEERT-------------------
DNLJ_SYNWW       ------LRIG------DMVLLHKAGDIIPEIIASL-PEKRS-------------------
DNLJ_THEMA       ------IRIG------DYVFVEKAGGIIPQIVKSI-PELRT-------------------
DNLJ_AQUAE       ------IRIG------DWVVVERAGDVIPYVVEVL-KEKRT-------------------
DNLJ_SOLUE       ------LQIG------DEVVVERSGDVIPKVVRVS-SQGSY-------------------
DNLJ_KORVE       ------LLIG------DWVQVERGGDVIPKVVKVI-DDKDHP------------------
DNLJ_SYNE7       ------LHIG------DTIVVRKAGEIIPEVVRVL-TDLRPA------------------
DNLJ_SYNJA       ------VHIG------DTAIVRKAGEIIPEVVGIL-KELRPP------------------
DNLJ_SYNY3       ------IRVG------DTVIIRKAGEIIPEVVRVM-TELRPE------------------
DNLJ_GLOVI       ------VRVG------DTVIIRKAGEIIPEVVRVI-GELRPP------------------
DNLJ_PROMT       ------LHYE------DTIIVRKAGEIIPEVIRVI-KEFRKV------------------
DNLJ_PROMA       ------IHEG------DTIVIRKAGEIIPEVIRVI-KELRPN------------------
DNLJ_PARD8       ------LHIG------DQVYVEKGGEIIPKIVGVN-VEARSM------------------
DNLJ_PORGI       ------LHEG------DFVYVEKGGEIIPKIVGVD-TDARSI------------------
DNLJ_GRAFK       ------VREG------DTVFVEKGGEIIPKIVGVD-FTKRDP------------------
DNLJ_CYTH3       ------LHIG------DTVFVEKGGEIIPKITRVD-VSKRIA------------------
DNLJ_PELLD       ------IMIG------DRVVIEKSGEVIPKVIRVV-TEARPV------------------
DNLJ_CHLPN       ------IRIG------DTVCVAKGGEVIPKVVRVC-REKRPE------------------
DNLJ_CHLMU       ------IRIG------DSVYVEKGGEIIPKIVGIN-LAKRSP------------------
DNLJ_PARUW       ------IRIG------DLVTIEKGGDVIPKVLNVE-LSQRPL------------------
DNLJ_RHOMR       ------IRIG------DLVVVIRAGDVIPQVVRPV-VEART-------------------
DNLJ_RUBXD       ------ILIG------DTVIVERAGDVIPQVVRPV-PEERD-------------------
DNLJ_ROSS1       ------IRIG------DYVIVKRAGDVIPYIVGPI-VARRD-------------------
DNLJ_THEFI       ------IRIG------DWVLVHKAGGVIPEVLRVL-KERRT-------------------
DNLJ_DEIRA       ------LRVG------DTVLVRKSGGVIPQIMRVL-PDKRP-------------------
DNLJ_DEHMC       ------IREG------DTVIIQRAGEVIPEVVAPV-LSKRN-------------------
DNLJ_DESAG       ------LMLG------DVVIVQRAGDVIPEVVRAV-PEERT-------------------
DNLJ1_DESVV      ------LMLG------DMVLVQRAGDVIPEVVRPL-VEDRT-------------------
DNLJ_LAWIP       ------IRPG------DMVIVQRAGDVIPEIVSPI-LSDRS-------------------
DNLJ_RHOBA       ------VRVG------DTVVVEKAGKIIPKVVRVEKHARTKP------------------
DNLJ2_STRCO      ------LRLG------DHVMVHRAGDVIPRIEAPVAHLRTGE------------------
DNLJ1_NOCFA      -IKVG-----------DTVLVRRAGDVIPFVAGVLDASKRTG------------------
DNLJ_PSYIN       ------VGPG------AIVQLVRSGLVIPKIEKVIK------------------------
DNLJ_DESPS       ------IGPG------ARIRMSRSGEVIPKIEEVVKPVA---------------------
DNLJ_RUTMC       ------LGVG------SVVELTRSGLVIPKIIFVLK------------------------
DNLJ_VESOH       ------LGIG------SVVELTRSGLVIPKIISVLK------------------------
DNLJ_DESAL       ------AGVG------ASIEVIRSGEVIPKLENVLTP-----------------------
                                     :     ::* :                             

DNLJ_TREDE       ---------------VKEIEYPDTC----------SVCGSPLTNE---------------
DNLJ_TREPA       ---------------AQEIHIPTQC----------TSCNTVLENS---------------
DNLJ_THEFY       ---------------ERPFVMPTEC----------PECGSPLGQQK------------EG
DNLJ_FRACC       ---------------ERAFVMPTRC----------PECGTELVRP-------------EG
DNLJ_SACEN       ---------------EREFVMPTEC----------PDCGTALAHQK------------EG
DNLJ_NOCSJ       ---------------LQPWVPPTTC----------PSCGTPLVEQK------------EG
DNLJ_ARTS2       -------------PPVRDFVMPTEC----------PACGTPLAPGK------------EG
DNLJ_CUTAK       ---------------EREFLMPDHC----------PSCGAELAYEK------------NG
DNLJ_CORJK       ---------------ERPFLFSTFC----------PECGTRLAPSK------------VG
DNLJ_LEIXX       ---------------EREFAMPTDC----------PECGTPLAPAK------------EG
DNLJ_BIFLO       -------------DQLREFVMPEFC----------PSCGAKLSPAK------------EG
DNLJ_TROWT       ---------------EVLFKMPSLC----------PSCGAELMPSK------------LG
DNLJ_RHORT       -------------ADSAPFVFPETC----------PVCGSHAVRQEG-------------
DNLJ_MAGSA       -------------RGAVPFVYPETC----------PVCGAHAVRPEG-------------
DNLJ_CHESB       -------------ADAKEFVFPSVC----------PCELKTPVVRDSTAGGG-------E
DNLJ_BRADU       -------------KTAKEFHFPKTC----------PCPLHTDVTREETAAGE-------E
DNLJ_RHILO       -------------ADAVPYEFPHTC----------PVCGSPATREINEKTGK-------E
DNLJ_BARBK       -------------KGASPFVFPSLC----------PACGSHAVREVGEA-----------
DNLJ_PARDP       -------------SEAEPYAFPTTC----------PECGSPAIREEGDS-----------
DNLJ_MARMM       -------------GRGEAFDFPTEC----------PVCGSQALREHDAKTGK-------L
DNLJ_HYPNA       -------------GQGAPWAMPDTC----------PVCGSAAVREID-DAGR-------A
DNLJ_CAUVC       -------------PAPPPYEFPHVC----------PCPLQTPLAREVTASGQ-------E
DNLJ_SPHAL       -------------EPREPYVFPDHC----------PVCGSEAVAED-------------G
DNLJ_ZYMMO       -------------VDRPIWRFPHRC----------PVCDSVARREE-------------G
DNLJ_RHOPB       -------------EDAEPYEFPKFC----------PACGSHAVRDED----E-------G
DNLJ_GLUOX       --------------RSEPFVYPDHC----------PVCGSLAERVHG-------------
DNLJ_PELPD       -------------SGSIPFVFPSAC----------PVCGSKAVREPR-------------
DNLJ_RICTY       -------------NDTVKFDTPVFC----------PSCNSKLRYVSEDIIIR--------
DNLJ_ORITB       -------------QSSTRFIFPATC----------PSCNQNLVVNEGETVAR--------
DNLJ_WOLTR       -------------ADAPGFVFPEIC----------PECGGKV--QAEGAAIR--------
DNLJ_EHRRW       -------------VELAEFNFPTAC----------PACGSTVYQAQQEVSIY--------
DNLJ_ANAPZ       -------------AVPEEYVFPSHC----------PSCGSTLSRAPGEVAMR--------
DNLJ_NEOSM       -------------TNQERFIFPDKC----------PSCSSTLIRKNNEAATR--------
DNLJ_PELUB       -------------QNSKKFIFPLKC----------PSCGSKTIKDYNETTKRQ------D
DNLJ_SPICI       ---------------AQKWQEATHC----------PECNSLLERVEG-------------
DNLJ_MESFL       ---------------LPIWEKDVQC----------PACNELLEKTST-------------
DNLJ_UREPA       ---------------SVPYEPIINC----------PSCQSVLVREND-------------
DNLJ_MYCPE       ---------------QVVFPEPTNC----------PSCDSKLVKKEQ-------------
DNLJ_MYCPN       ---------------NQPIPEQTHC----------PACQAPLVQYKD-------------
DNLJ_MYCGA       ---------------AKKLEFDYNC----------PSCHQPLVKKPE-------------
DNLJ_MYCMO       ---------------ETIFKRIEYC----------TSCNEKLVQPED-------------
DNLJ_MYCS5       ---------------DSVFEKVLNC----------PSCNSLLEIPEG-------------
DNLJ_MYCPU       ---------------QNYFSPIEFC----------PSCKNKLSWSEN-------------
DNLJ_MYCH7       ---------------KTNFSIVKNC----------PKCNSELVNSES-------------
DNLJ_FUSNN       ---------------EKVIEEPTCC----------PICNHKLEREEG-------------
DNLJ_LEPIC       ---------------FK---IPDRC----------PSCNTQTIKKES-------------
DNLJ_BORBU       ---------------FK---VPDNC----------PACKTAVVKEG--------------
DNLJ_ONYPE       ---------------QKPTLMIEKC----------PACQTILEKQPG-------------
DNLJ_NITSB       ---------------EKKVERPKVC----------PVCGQPV--LDE-------------
DNLJ_SULDN       ---------------EVEYKRPTIC----------PVCESEL--LDE-------------
DNLJ_CAMHC       ---------------ETPIKRPEFC----------PVCGSRL--LVE-------------
DNLJ_CAMJJ       ---------------EMEISRPKLC----------PTCQSEL--LDE-------------
DNLJ_WOLSU       ---------------EKPLSRPTHC----------PECGSEL--LVE-------------
DNLJ_HELHP       ---------------QKVISKPTHC----------PVCGEEL--LLE-------------
DNLJ_HELAH       ---------------QCKIIRPKVC----------PICSHEL--LCE-------------
DNLJ_CLOTE       ---------------TEEIKAPLKC----------PYCESKL--INE-------------
DNLJ1_CLOAB      ---------------TKEIEAPTIC----------PYCGSEI--VKE-------------
DNLJ_MARHV       -------------AEAPMVEMPEH----------CPVCGSDI-VQ-----------IEGE
DNLJ_ALCBS       -------------ANAQGIALPSS----------CPVCGSEI-LR-----------GHDQ
DNLJ_IDILO       -------------ENTKAIEFPQH----------CPICQSDI-ER-----------VEGE
DNLJ_COLP3       -------------DNAVDIVFPTS----------CPVCDSAV-AK-----------PEGE
DNLJ_SHEAM       -------------DEAQDILFPDN----------CPVCGSLV-ER-----------IEGE
DNLJ_SACD2       -------------QDAREIKFPTA----------CPVCGSDV-ES-----------VEGE
DNLJ_CHRSD       -------------ATTRAIEMPEH----------CPVCGSQT-ER-----------LEGE
DNLJ_LEGPA       -------------INARKIELPKN----------CPVCGSEV-VR-----------EADE
DNLJ_MAGMM       -------------GALAVYKEPVA----------CPVCGAPT-ER-----------EGGE
DNLJ_NITMU       -------------SNAKPFVMPEH----------CPVCGSRT-IR-----------LPGE
DNLJ_JANMA       -------------VDAQPFVMPTN----------CPVCNSPI-VK-----------LEDE
DNLJ_METCA       -------------PGAEPFRMPEV----------CPECGSAV-EA-----------EPGE
DNLJ_NITOC       -------------PDSRPFQMPRQ----------CPVCGSEI-VK-----------EEGG
DNLJ_COXBU       -------------KKAKLIKIPSR----------CPVCHAEV-IK-----------PEGE
DNLJ_PSYCK       -------------ENSEPVKLPST----------CPVCDSPV-VL-----------PKDE
DNLJ_HYDCU       -------------ENTQLFEMPQH----------CPECGSDV-VK-----------ELDK
DNLJ_FRATN       -------------SDAQMVEMPTN----------CPVCDSAI-EN-----------VNDQ
DNLJ_DICNV       -------------PDAPVFAMPEH----------CPVCAAAI-VQ-----------NEDE
DNLJ_SODGM       -------------AEVRPVAFPTQ----------CPVCSSDV-ER-----------VEGE
DNLJ_BAUCH       -------------IKTSPVLYPLY----------CPVCGSKV-KQ-----------NNKE
DNLJ_BUCBP       -------------QRNEDISIPKF----------CPECGSKLKVD-----------SFSN
DNLJ_BUCCC       -------------KYTQKIIIPTY----------CPSCCTKL-IF-----------SDDL
DNLJ_BUCAI       -------------DNAKKIIFPSF----------CPVCNTEL-LE-----------NIEE
DNLJ_WIGBR       -------------KNVKEIIFPKT----------CIFCKSKI-EF-----------CLRK
DNLJ_BLOPB       -------------DHVKTIELPRF----------CPVCGSRIKTW-----------RNQS
DNLJ_BLOFL       -------------DNAKFIKIPEF----------CPSCGSILKVE-----------DNKS
DNLJ_BORA1       -------------GELPQFVMPTH----------CPICGSAIER------------LVDE
DNLJ_PSESM       -------------ETAKPVEVPQS----------CPVCGSHVERTQLIKRSKGKETVTEG
DNLJ_RALSO       -------------PKHPPFELPRS----------CPVCGSHVVR------------EEGE
DNLJ_XYLFT       -------------PGATAWSMPMA----------CPVCGSEIVR------------ETGA
DNLJ_NEIG1       FAETPSAKQTESVPLHKPYRLPAR----------CPICRSEIER------------EEGE
DNLJ_BDEBA       -------------ADRLPYSIPER----------CPACDSVAVKA------------EGE
DNLJ_GEOSL       -------------GSERPLPIPAV----------CPECGSEVVKI------------PDE
DNLJ_PELCD       -------------GQERSVPLPQS----------CPACGGPVVKL------------EGE
DNLJ_SYNAS       -------------GREIPFKIPDT----------CPECGSEVVRL------------AGE
DNLJ_SYNFM       -------------GGEEVFQMPGQ----------CPSCGSEVVRL------------PEE
DNLJ_MYXXD       -------------ADSAPFEFPKH----------CPVCDAVATKD------------EDG
DNLJ_ANADF       -------------GEERPFAFPAE----------CPICGAKVVRE------------EGE
DNLJ_HALHL       -------------EGAQPWRFEERVQA-------CPECGSAVQRI------------EGE
DNLJ_NATPD       ---------------EAHFEFPDR----------CPVCESPLER--------------DG
DNLJ_HALWD       ---------------TGTFNFPNQ----------CPICHSSVEQ--------------DG
DNLJ_SALRD       -------------GTEAPYHIPDA----------CPVCGSEVVLS------------DDK
DNLJ_LISW6       -------------GSEEPFHMPKN----------CPTCGSELVRL------------EEE
DNLJ_STAS1       -------------DDAEIYHMPSH----------CPSCEHELVRI------------EGE
DNLJ_GEOSE       -------------GDETPFAMPTH----------CPECESELVRL------------EGE
DNLJ_ENTFA       -------------ADSQPYEMPTH----------CPICHSELVHL------------DEE
DNLJ_STRS2       -------------KEQEIMPIPSH----------CPSCQSDLQHY------------EDE
DNLJ_LACS1       -------------EDSVEYQIPTE----------CPECGAKLVHL------------DDE
DNLJ_LACPL       -------------KDAQPLVIPTT----------CPSCGAPLVHL------------EDE
DNLJ_OENOB       -------------ADAQAYPIPVY----------CPSCKSKLVHV------------QGE
DNLJ_LEUMM       -------------TDSETYQVPTI----------CPACESNLVHI------------EGE
DNLJ_PEDPA       -------------VGISELDIPTH----------CPSCGKELVHL------------NGE
DNLJ_LACDB       -------------EDSVPYEVPTK----------CPSCGEDLVHL------------DEE
DNLJ_SYMTH       -------------PDAQPWTFPKT----------CPACGAELVRI------------EGE
DNLJ_MOOTA       -------------GSEEVFTMPER----------CPACGAAVVRP------------PGE
DNLJ_DESHY       -------------GGERIFEMPEL----------CPECQSPVIRE------------EGE
DNLJ_CARHZ       -------------GAEKEFVMPDT----------CPVCQGKAVRL------------PGE
DNLJ_HUNT2       -------------GNEAEFNMPEQ----------CPVCGADVVRE------------EGE
DNLJ_CALS8       -------------GNERIFEMPKK----------CPVCGADVIKF------------EDE
DNLJ_CALS4       -------------GDEKAFVMPDK----------CPECGALAVRL------------PGE
DNLJ_CLOD6       -------------GDEIDFKMPEK----------CPVCSEPTIRL------------EGE
DNLJ_SYNWW       -------------GEERVITPPEN----------CPACDSKVARF------------AGE
DNLJ_THEMA       -------------GNEKEIKPPDK----------CPVCGGKVGKLN-----------PDE
DNLJ_AQUAE       -------------GEEKPVEFPKY----------CPSCGSELVKL------------PEE
DNLJ_SOLUE       ---------------RKPFKMPSH----------CPVCNTKIVRE------------EGE
DNLJ_KORVE       -------------RGKKKFKMPER----------CPECGGHVVRT------------EGE
DNLJ_SYNE7       -------------D-AKPVVLPEK----------CPECGQPVQRP------------EEE
DNLJ_SYNJA       -------------D-AVPYRLPSH----------CPECGTLLVRP------------AGE
DNLJ_SYNY3       -------------N-TTPYIFPSH----------CPACGSPLVRP------------LEE
DNLJ_GLOVI       -------------E-AVPYVFPQT----------CPECGTAVVRA------------PGE
DNLJ_PROMT       -------------D-AKLVQLPQN----------CPECNSKLILE------------SNE
DNLJ_PROMA       -------------N-AKKLVLPEK----------CPECNSKLLKE------------TGE
DNLJ_PARD8       -------------LMGDKVRFIRV----------CPECGTPLVRP------------EGE
DNLJ_PORGI       -------------D-GRPIVFTVL----------CPDCATPLVRE------------QGE
DNLJ_GRAFK       -------------D-SNPTQYATN----------CPECDSELIRK------------DGE
DNLJ_CYTH3       -------------G-SQMIPFIQN----------CPVCDTKLIRI------------EGE
DNLJ_PELLD       -------------D-ARLVELPSR----------CPACSTPIVRE------------EGE
DNLJ_CHLPN       -------------G-SEVWNMPEF----------CPVCHSHVVRE------------EDR
DNLJ_CHLMU       -------------D-SKPWKMPSL----------CPMCHNPVIKE--------------R
DNLJ_PARUW       -------------H-SQPWQMPLY----------CPSCGTQVINI------------IGE
DNLJ_RHOMR       -------------GNERPWRMPER----------CPSCGSQLVRL------------PGE
DNLJ_RUBXD       -------------GDEEEFRMPER----------CPVCGERVSRP------------EGE
DNLJ_ROSS1       -------------GSERPWQMPAT----------CPACGTPLERA------------EGE
DNLJ_THEFI       -------------GEERPIRWPET----------CPECGHRLVKE--------------G
DNLJ_DEIRA       -------------ADAAPFEFPTH----------CPVCGHEAVRA------------EGD
DNLJ_DEHMC       -------------PESKPFRMEESLFNPNLNRPACPVCGGEIYRP------------AGE
DNLJ_DESAG       -------------GAEREYVFPAV----------CPVCGSAAVRG------------EGE
DNLJ1_DESVV      -------------GGERPFVFPTT----------CPECGSVVHKP------------NDE
DNLJ_LAWIP       -------------AKSKPFVFPKI----------CPVCHEKVYRI------------NNE
DNLJ_RHOBA       ---------------LPKFEFPTHC----------PQCDEVLTRD--------------E
DNLJ2_STRCO      ---------------EQPIVFPEAC----------PRCGSDIDTS--------------E
DNLJ1_NOCFA      --------------AEVEIVPPTEC----------PSCGQPVTEQ--------------G
DNLJ_PSYIN       ---------------AVEPQLAKEC----------PSCGTHLIWE---------------
DNLJ_DESPS       ---------------AAQLDIPAHC----------PSCGSDLAWD---------------
DNLJ_RUTMC       ---------------PMPVDIPDNC----------PSCDKPLVWK---------------
DNLJ_VESOH       ---------------PMPVDIPDNC----------LSCGMPLVWE---------------
DNLJ_DESAL       ---------------SDDTLIPENC----------PVCETPLEWN---------------
                                                                             

DNLJ_TREDE       -GTRLYCPNMSCPKLIHHRIEKWIS--VLDIRDFGITLIKRLFEMG--------------
DNLJ_TREPA       -GSRLFCPNVNCPLLSHHRITRWIE--CLEIKHVGTELIQRLFEEK--------------
DNLJ_THEFY       DVDLRCPNTRYCKGQLRERLAFIAGRKALDIEALGYVAATALTQPLEPAEPPLRD-----
DNLJ_FRACC       EVDIRCPNTVSCPAQLRESIFHFASRGAMDIDGLGYETATALLEA-----GRVRD-----
DNLJ_SACEN       DVDLRCPNSHNCIGQRRERLFQLAGRKAFDIEVLGYEGVSALLSAGVVFD----------
DNLJ_NOCSJ       DKDRRCPNHEKCPGQLRERVFFVASRNAFDIEGLGYEAAVALLDAEVIAN----------
DNLJ_ARTS2       DVDIRCPNSRSCPAQLRERVFHVASRGAFDIEALGWEAAIALTQPAEPVTPP--------
DNLJ_CUTAK       DKDLRCPNAQGCPSQLHERVFGLASRGALDIEALGWEAAIALTDPENQRPGDDEVAEELP
DNLJ_CORJK       DADWRCPNTQYCPGQLHTRLTYLASRKAFDIDALGEKGAYDLIHSGVLAD----------
DNLJ_LEIXX       DIDLRCPNAEFCPAQVRGRVEHIGSRGGLDIEALGEVAAAALTQPRFPERAP--------
DNLJ_BIFLO       DKDIRCPNVESCPAQLTERVISLASRKAFDIEHLGEQSAIALTNPEENRPDSVATYAPNI
DNLJ_TROWT       DIDLRCPNMQSCLVQLAGRLEYIGSRGVLDIAYLAEENAYALSHLRKFGKSA--------
DNLJ_RHORT       EVARRCAGGLICSAQAVERLKHFVSRDAFDIEGLGGKHIETFHNEG--------------
DNLJ_MAGSA       EVIRRCTGGLTCEAQAKERLKHFVSRNAFDIEGLGEKNIEFLWEKG--------------
DNLJ_CHESB       GVVRRCSGEFACPFQRIEHLRLFVSRRAFDIEGLGEKQIEFFFRDPD-------------
DNLJ_BRADU       GSRARCTGEFACPYQKIEHLKLFVSRRAFDIDGLGEKQLQYFFDEG--------------
DNLJ_RHILO       DSRRRCTGELICAAQAVERLRHFVSRGALDIEGLGAENIDTFFNAG--------------
DNLJ_BARBK       --VRRCTGGLICPAQAIERIRHFVSRNAFDIEGLGEKQVEFFFHAQDE------------
DNLJ_PARDP       --VRRCTGGLICPAQAVEKLRHFVSRAAFDIEGLGAKLVEELFRDG--------------
DNLJ_MARMM       DVVRRCTGGLICGAQLKERLKHFVSRKAFDIEGLGIKQIEAFQEEG--------------
DNLJ_HYPNA       DVRRRCTGGLICPAQAVERLKHFVSRKALDIDGLGEKQVLLFHEKG--------------
DNLJ_CAUVC       SVVRRCTGEFACPFQRVEHLRHFVSRRAFDIEGLGEKQLQAFFEEG--------------
DNLJ_SPHAL       EVDVRCTGGLICNAQKFERLRHFVSRGALDIEGLGEKSIAEFLELGW-------------
DNLJ_ZYMMO       EVAWRCTGGLICPAQRVERLCHFVSRTAFEIEGLGKSHIESFFADKL-------------
DNLJ_RHOPB       EAVRRCTGGLICPAQAIERLRHFVSRGAFDIAGFGETYVELLYEEGL-------------
DNLJ_GLUOX       EAVRRCTGGLTCEAQIVERLIHMVSRNAFDIDGLGERSIREFYDAG--------------
DNLJ_PELPD       EAVWKCTGGLTCPAQSLERLKHFVSRDAFNIDGLGEKNIELFYNKG--------------
DNLJ_RICTY       -----CDNGLNCPAQNYERICHFVSKNAMDIAGLGRKQVAFLIDKR--------------
DNLJ_ORITB       -----CGNSLACPAQIYERICHFVSKDALNIDGLGRQRIRFLLDNK--------------
DNLJ_WOLTR       -----CSEELTCKAQIIGKLSHFVSKGAFDIFGLGEKQIKFFYDLG--------------
DNLJ_EHRRW       -----CMGGLFCHNQILEKIRHFVSKDAFNIIGLGKKQLLFFYEYG--------------
DNLJ_ANAPZ       -----CTAELSCQAQVLERVKHFVSRDGLNIVGLGEKQIEFFCNAS--------------
DNLJ_NEOSM       -----CNNSKKCPEQVIQQIKHLVSAQAFDIDGIGTSHISFFIEKG--------------
DNLJ_PELUB       AVRRCASEGFECEKIAIERIKHFVSKDAFNIDGFGKKIVENFWNLK--------------
DNLJ_SPICI       EVDQYCINS-VCPKKITRGLEHYCSRNAMNIEGISEKIIERLFK----------------
DNLJ_MESFL       EVDQFCVNF-NCPAQILRSLEHFASRGAANIVGLGGQTIKKLFE----------------
DNLJ_UREPA       EVDQRCLNIYGCKKINIEKIVYFVSRNCMNIEGMSDAIINKFY-----------------
DNLJ_MYCPE       EVDLYCLNE-NCVEKQIQQIEYFSSRDAMNIEGLSISIISQLF-----------------
DNLJ_MYCPN       EVDQYCTNE-RCDQRNLEAINYFVSKTAMDIQGLSIQTISKLY-----------------
DNLJ_MYCGA       EVDWYCIYD-QCKQKQLQYLIYYCSKPIMNIEGLSESTLALFFNTKVNDVIRECNELITN
DNLJ_MYCMO       EVDQYCINK-KCLMIRLRKIEHFASKKAMNILGLGFQNIEKFFK----------------
DNLJ_MYCS5       YVDQFCRNE-NCDEKKIQMLTFFVSKNCLNITNLSVQNIRIFYN----------------
DNLJ_MYCPU       MLNQFCLNP-DCIEKKIQKLKYFVSKDGMEIQELGGKKIELFFA----------------
DNLJ_MYCH7       GLDQFCQNQ-FCPEIILQKIVHFCSKNALNIESLAQKRIEKFLE----------------
DNLJ_FUSNN       LVDIKCINE-ECPAKVQGEIEYFVSRDALNIMGLGSKIVEKFID----------------
DNLJ_LEPIC       LVDLFCPNP-DCPDRVKNGIIFYCQRKQMDIEGLGDKQIEFLYD----------------
DNLJ_BORBU       -AHFFCPNN-NCPSVAVERIKYFCSKNCMDIEGFSDKIISFLFE----------------
DNLJ_ONYPE       EVDYFCLNP-NCREQKIQKLIHFVSKNAMDINVLGEQTIIAFFD----------------
DNLJ_NITSB       GILIKCQN-LSCPARVVNSIIYFASKQCLDISGLGEATVKLLYE----------------
DNLJ_SULDN       GVLLKCQN-LTCEARVINSIIYFASKPCLNIDGLGVKIVEALFN----------------
DNLJ_CAMHC       DIFIRCQN-LTCKARIVNSLIYFCSKKCMNIDGLGEAIINTLFE----------------
DNLJ_CAMJJ       GTLIKCQN-IDCEDRLVNSIIHFVSKKCLNIDGLGENIVELLYK----------------
DNLJ_WOLSU       EVLIKCQN-LSCPARIKNSLIHFASKKALNIDGLGEKIIEQLFE----------------
DNLJ_HELHP       DIFIKCQN-LSCEARVIESIIHFASKKALNIDGLGEKIVIQLYE----------------
DNLJ_HELAH       EIFTYCQN-LNCSARLKESLIHFASKDALNIQGLGDKVIEQLFE----------------
DNLJ_CLOTE       GVHLFCENTLSCKPQLVKSLVHFASREAMNIEGFSEKTAEQFYE----------------
DNLJ1_CLOAB      GVHLFCENTLSCKPQMVKSIVHFASRKAMNIEGFSEKTAEQLFE----------------
DNLJ_MARHV       AVARCSGGLY-CPAQRKEAIRHYASRKAMDIEGLGDRLIEVLVDEG--------------
DNLJ_ALCBS       VVARCTGGLI-CGDQRREAIKHFASRRAMDIDGLGDKLVDALVDQE--------------
DNLJ_IDILO       AVARCTGGLY-CAAQRKEAIKHFASRKAMDIDGLGDKIVEQLVERD--------------
DNLJ_COLP3       AVLRCTAGLF-CAAQRKEAIKHFASRKAHDVDGLGDKLVEQLVDEK--------------
DNLJ_SHEAM       AVARCSGGLF-CEAQRREAIKHFASRKAMYIDGMGDKVVEQLIDKE--------------
DNLJ_SACD2       AAIRCTGGLV-CEAQRKESIKHFASRQAMDIDGLGDKIVDQLVDNK--------------
DNLJ_CHRSD       VAARCSGGLF-CPAQRKEALKHFASRRALDIDGLGEKLIDLLVERE--------------
DNLJ_LEGPA       AIARCIGGLY-CKAQLKRMMWHFASRKAMYIEGLGSVLIDQLVDEG--------------
DNLJ_MAGMM       TALRCSGGLT-CRAQVKEGVKHFASRKAMNIEGLGDKLVALLMQAG--------------
DNLJ_NITMU       TLTRCTGGLF-CPAQRKQAILHFASRRAMNIHGLGDKLVDHLVDNA--------------
DNLJ_JANMA       AIARCSGGWVKCAAQRKGGLLHFVSRRAMDVEGLGDQLVEQLVDKH--------------
DNLJ_METCA       VLARCSGGLY-CPAQHKESIKHFASRRAMDIEGLGDKLVDQLVGRK--------------
DNLJ_NITOC       AVARCSGGLY-CPAQRKEAIKHFAGRRAMDINGLGDKLVEQLTKQG--------------
DNLJ_COXBU       AVARCVGGLY-CRAQLRESIKHFASRRALDIEGLGDKLVELFIQEK--------------
DNLJ_PSYCK       ALARCTGGLF-CPAQQVEALIHFVSRRAMDIDGLGASWLISFFEHG--------------
DNLJ_HYDCU       AVFRCTGGLV-CPAQRKRALHHFVSRKAMDIQGLGDKLIDQLVDKG--------------
DNLJ_FRATN       AIYRCTGGWH-CQAQTTERLKHFVSRKAMDIDKLGAKLIEQLVAAN--------------
DNLJ_DICNV       AVARCSGGLH-CPAQRVAALIHFASREALDIRGLGEKLIQQLVAQE--------------
DNLJ_SODGM       AVLRCTAGLV-CAAQRKEALKHFVSRRAMDIDGMGDKIIDQLVERE--------------
DNLJ_BAUCH       KTIICTAGMI-CSAQLKEALKHFVSRRAMNIYGMGGKIIDQLVDLK--------------
DNLJ_BUCBP       IKIRCMAGLK-CLSQFKKLLHYFCSKKGLNILGLGPKIIDKLVDLG--------------
DNLJ_BUCCC       KTCYCPASFS-CFSQNVKRLIYFSSKNGLNFKGLGKKNIIKLINYG--------------
DNLJ_BUCAI       KLIRCHSGLT-CDAQKKQALYHFFSKKSLYVVGLGPKIINELVEKG--------------
DNLJ_WIGBR       KNLYCTGGFL-CYAQRKQLLNHFVSREALNIKGMGNKIISQLIEKK--------------
DNLJ_BLOPB       -ILRCTAGLS-CLAQRKATLEHFVSKKAMNIYGMGNKIIDQLVNQG--------------
DNLJ_BLOFL       SVLRCLAKLT-CLAQRKSALKHFASRKAMNIQGMGSRVINQLVDKG--------------
DNLJ_BORA1       AIARCTGGLF-CPAQRKQTLLHAAGRKALDIEGLGEKLVEQLVDNG--------------
DNLJ_PSESM       AVYRCVGRLA-CGAQLKQAIIHYVSRRAMDIEGLGDKTIEQLVDEK--------------
DNLJ_RALSO       AVARCSGGLF-CSAQRKEAIRHFAGRRMMDIEGLGERYIDNLVELE--------------
DNLJ_XYLFT       AVWRCSGELA-CPAQRKEAIRHFVSRRAMDVEGLGVKCIELLVDAA--------------
DNLJ_NEIG1       AVARCSGGML-CQAQRAQGLIHFASRKAMDIDGLGEKQIEQLVAQD--------------
DNLJ_BDEBA       VVTRCVNPLC--IAVVKESLKHFVARRAMNIDKVGDRLIETLVDNK--------------
DNLJ_GEOSL       VAVRCMGLS--CPAQIRESIIHFASRDAMDMEGLGEKYIEQLLRLG--------------
DNLJ_PELCD       VVPRCQEMS--CPARLRESIKHFVARRAMDIDGLGERTIEQLLKRE--------------
DNLJ_SYNAS       AAHRCIGLS--CPAQLRRHIQHFVSRGGMDIEGLGDKLVSQLVNQK--------------
DNLJ_SYNFM       AVHRCLNRN--CPAQIKASLRHFASRDAMNIEGLGKNIVSMLVDRG--------------
DNLJ_MYXXD       AIIRCTGAS--CPAQLVEKIRHFASRLAMDIEGLGDKLAAQLVSTG--------------
DNLJ_ANADF       KVYRCTGAA--CPAQLVGRLTHFAQRRAMDIDGLGDKLALGLVERG--------------
DNLJ_HALHL       AAHRCVGGLY-CPAQREGAILHFASRRALDIDGLGEKIVEQLVAKG--------------
DNLJ_NATPD       PLAYCTGGVA-CPAQLRRAVEHYASRSGLDIEGLGESAVDQLVDAG--------------
DNLJ_HALWD       PLAFCTGGLT-CDAQLVRTIVHYGSRSALDIDGLGEQRVEQLVESG--------------
DNLJ_SALRD       KQAFCTGGMT-CPAQFRERLKHYASREATDIEGLGDKRAEQLIDAG--------------
DNLJ_LISW6       VALRCIN-PK-CPAQIKEGLIHFVSRNAMNIDGLGEKVIIQLFSEH--------------
DNLJ_STAS1       VALRCIN-PK-CQAQLVEGLIHFVSRQAMNIDGLGTKIIQQLYENE--------------
DNLJ_GEOSE       VALRCLN-PN-CPAQLRERLIHFASRAAMNIEGLGEKVVTQLFNAG--------------
DNLJ_ENTFA       VALRCIN-PK-CPAQIKEGLNHFVSRNAMNIDGLGPRVLAQMYDKG--------------
DNLJ_STRS2       VALRCIN-PI-CPSQLMSKLEHFASRDAMNIAGLGSSIVEKLFGAG--------------
DNLJ_LACS1       VALRCIN-PQ-CPALVKESLTHFASRNAMDIRGLGPRIIEQLYNRE--------------
DNLJ_LACPL       VALRCIN-PK-CPAQVQEGLVHFASRNAMNIDGLGPRIIAQLYANR--------------
DNLJ_OENOB       VALRCIN-PE-CPAQIKEGLIHFASRNAMNIDGLGPRVVEQLLSKN--------------
DNLJ_LEUMM       VALRCIN-PF-CSAQIQEGLTHFASRNAMNIDGMGPRVVGQLLKAG--------------
DNLJ_PEDPA       VALRCIN-PD-CPAQIVARLEHFGSRNAMNIMGLGPKQIQQLYAKN--------------
DNLJ_LACDB       VALRCIN-PS-CPAQVEEGITHFASRQAMNIAGLGPKIVKQLIAKD--------------
DNLJ_SYMTH       AATRCTN-NL-CPAQQYRAILHFASRDAMNIEGLGEALVQSLLDHG--------------
DNLJ_MOOTA       AAHRCTGGLA-CPAQVLEGIIHFASRGAMDIQGLGPAIVAQLLEAG--------------
DNLJ_DESHY       AAHRCTS-IT-CPARQREAIIHFVSRNAMNIDGLGPAVIYQLLEAG--------------
DNLJ_CARHZ       AAWRCTN-AS-CPAQLKEGIVHFASRGAMNIEGLGPAVAELLLEAG--------------
DNLJ_HUNT2       AAYRCTG-IE-CSAQLYRKIVHFASRDAMNIEGLGPAIIEVLLEKG--------------
DNLJ_CALS8       VAYRCTG-VE-CPAKSYRLILHFVSRDAMDIAGMGEMIVKNLFERG--------------
DNLJ_CALS4       AVRRCTG-LN-CPAQIARRIIHFASKDAMDIEGLGPAIISQLLSKG--------------
DNLJ_CLOD6       AAVKCIN-MS-CPAQIRRGIIHFVSRDAMNIDGLGESIITLLLNEK--------------
DNLJ_SYNWW       VAYRCEN-IN-CPARLKESLIFFASRGAMDIDGLGSAVIEQLVNKD--------------
DNLJ_THEMA       VAIRCLN-PH-CPAKLKRALRTLVSREALDIEGLGEKLIDRLVDAG--------------
DNLJ_AQUAE       VAIRCIN-IS-CPAQSVLRIKHWASRDAMDIRGLGDATIKLLFNRG--------------
DNLJ_SOLUE       AASRCIN-AN-CPARLKESILHFASRGVMNIDGMGDALVDQLVDRE--------------
DNLJ_KORVE       ADHRCVN-AN-CPAKLRESILHFASRGVMNIEGMGDSLVNQLVDRG--------------
DNLJ_SYNE7       AVTRCVNST--CPAIVRGALTHWASRDALDIEGLGEKLVDQLVSKG--------------
DNLJ_SYNJA       AITRCPNPA--CPAKIRGQLQHWASRDAMDIEGLGEKRVAQLVEKL--------------
DNLJ_SYNY3       AVIRCVNSS--CSAILQGSLIHWASRNALDIQGLGEKVVITLLENR--------------
DNLJ_GLOVI       AAVRCPNPR--CPALIRGKLGHWCA--ALEIDGIGDKLIARLVSLG--------------
DNLJ_PROMT       AITKCINYR--CAAKLKGLLRHWVSKGSMNIDGLGEKIINQLVNEG--------------
DNLJ_PROMA       AATKCLNND--CPAILRGVLRHWVSKGAMNIDGFGTKLVEQLVKRK--------------
DNLJ_PARD8       AAHYCPNESG-CPPQIKGRIEHFVTRKAMNIN-IGPETVEDLYNAG--------------
DNLJ_PORGI       AAYYCPNAEG-CPQQQKGRLEHYCGRKTADIN-IGPETIELLYSRN--------------
DNLJ_GRAFK       AQHYCPNVNG-CPPQIIGRIQHYISRKAMDIEGLGGETVALLVNAD--------------
DNLJ_CYTH3       AAWYCPNDKG-CAPQITGKIEHFIQRKAMNIDGIGSETIELLYQKK--------------
DNLJ_PELLD       VGFYCPNEAG-CPAQLKGRILHFASRNAMDIQNLGEALVEQLVAFG--------------
DNLJ_CHLPN       VSVRCVNPE--CVAGAIEKIRFFVGRGALNIDHLGVKVITKLFELG--------------
DNLJ_CHLMU       VSVRCTNPL--CLGGMLEKICFFASKGALNIDHLGEKVIAKLFEMG--------------
DNLJ_PARUW       VAVRCPNEDS-CTEQQIRKLIYFVGKQAMDIKHMGEKIVIQLFQKG--------------
DNLJ_RHOMR       ADYYCVASD--CPAQFVRLLEHFAGRDAMDIEGMGSQVARQLAESG--------------
DNLJ_RUBXD       AITRCANVR--CPAQALEHIIHWASRGAMDIEGLGEKLARKLFDLG--------------
DNLJ_ROSS1       VAYRCPNFGI-CPAQITRRIEHFVSRGAMDIAGIGEKQVQLFVERG--------------
DNLJ_THEFI       KVHRCPNPL--CPAKRFEAIRHYASRKAMDIEGLGEKLIERLLEKG--------------
DNLJ_DEIRA       ANTYCPNPA--CPAQSFERIRYFVSRGAMDVRGIGEKLVTQLLHEG--------------
DNLJ_DEHMC       AMHYCTNVS--CPAQFERQLEHFVSRGAMDIRGIGESLSVILAQQG--------------
DNLJ_DESAG       AAWRCTNMQ--CPAVRKQAIIHFVSKAGLDIDGVGRKWIEQLVDSG--------------
DNLJ1_DESVV      VAHRCINVS--CPAVRRQSIIHFVSKAGLDVRGFGEHIVQQLVDAG--------------
DNLJ_LAWIP       VAWRCINLS--CPAIRLQSIIYFVSKSGLNIQGIGQRLIELLVTSG--------------
DNLJ_RHOBA       GGVYIRCTNPACPAQLRQRLVYFGSRTGMDIDGLGEEVVDLLLQKE--------------
DNLJ2_STRCO      ERWRCAQGRN---CHLVASLAYAAGRDQLDIEGLGTTRVVQLVEAG--------------
DNLJ1_NOCFA      NSRELFCTNASCPAQTVRRLIHWASRAAADIDAIGGVWIERLAEAG--------------
DNLJ_PSYIN       SDHLVCPNKTDCPAQTENTLVHFFKT-LGNNDGFGPKVIEKLHEFG--------------
DNLJ_DESPS       GDYLFCLNNMSCPAQITNSMEHFFKI-LGNVDGFGPSSVQRLYEGG--------------
DNLJ_RUTMC       SDFLTCINHKNCPAQIIGKMAYFFKI-LANNDGFGIATIEKLYAHD--------------
DNLJ_VESOH       SDFLVCVNHKNCPAQIIGRITYFFKV-LANNDGFGIATVEKLYAHN--------------
DNLJ_DESAL       NDFLKCPN-LNCKARVEQRIRHWFRI-LGNADWFGIKTVERLVAGG--------------
                                    :             ..      :                  

DNLJ_TREDE       ----------------------------RVNSITDLYTLTV-------------------
DNLJ_TREPA       ----------------------------KVRRIPDLYTLTC-------------------
DNLJ_THEFY       --------------------------------EGDLFSLTVEQLLPIRTLVLDPDTAEPK
DNLJ_FRACC       --------------------------------IGDIFHLTPES-----------------
DNLJ_SACEN       --------------------------------EGDLFDLNEEALLKTTLFRTD-------
DNLJ_NOCSJ       --------------------------------EGDVFDLDAAALLRAPLFTRAPKK----
DNLJ_ARTS2       -----------------------------LTSEANLFRLTREDLADVRIRREKRSKGVAT
DNLJ_CUTAK       KRQTAV-----------------------LSSEAGLFDLQLDDLAEIKVWRRRKVNG-GP
DNLJ_CORJK       --------------------------------ESELFDLRAEDLEKTSSYATK-------
DNLJ_LEIXX       -----------------------------LPTEAGLFGLRLEDLFPIEVVVRDSETGLPK
DNLJ_BIFLO       TEVLVAPGEEPDPYEPVEGLELPAAQKPVLSNESGLFNLTAADLRDVRVWREAAIVEVHE
DNLJ_TROWT       --------------------------------EVQLFKITIDDLVALEFMYKGNMRSPFR
DNLJ_RHORT       ----------------------------LITQPADIFALEAKD-----------------
DNLJ_MAGSA       ----------------------------WVRGPADIFRLKAR------------------
DNLJ_CHESB       ---------------------------LPVKSPADIFTLAER------------------
DNLJ_BRADU       ----------------------------FVKEPADIFTLEKR------------------
DNLJ_RHILO       ----------------------------LIKTAADIFTLRDRRPAVTKALAERREEQARQ
DNLJ_BARBK       --------------------------TLRIHSPADIFTLQKR------------------
DNLJ_PARDP       ----------------------------WIAEPADIFTLQDRY-----------------
DNLJ_MARMM       ----------------------------LITEPAHIFTLKARN-----------------
DNLJ_HYPNA       ----------------------------AVKAPQDIFRLKKNI-----------------
DNLJ_CAUVC       ----------------------------WITEPADIFKLARDA-----------------
DNLJ_SPHAL       ----------------------------LEKGPADIFRLKSHREELLA------------
DNLJ_ZYMMO       ----------------------------IET-PADIFRLFQKRQLLIE------------
DNLJ_RHOPB       ----------------------------VRN-PADIFALHSKVDELKAALFR--------
DNLJ_GLUOX       ----------------------------YIRRPGDIFRLRQHE-----------------
DNLJ_PELPD       ----------------------------LLASPVDIFRLEEILSPPLLWQ----------
DNLJ_RICTY       ----------------------------LISNPLDIFFLKKKN-ETNL------------
DNLJ_ORITB       ----------------------------YIVNIVDIFLLEENNKLLSS------------
DNLJ_WOLTR       ----------------------------LIKQIPDIFNLEERLNE---------------
DNLJ_EHRRW       ----------------------------LITNIIDIFTLEEKINNKN-------------
DNLJ_ANAPZ       ----------------------------YISNVADIFSLREKISH---------------
DNLJ_NEOSM       ----------------------------FISEPADIFRLDKHRDE---------------
DNLJ_PELUB       ----------------------------LVRLPQDIFKLNYNK-----------------
DNLJ_SPICI       --------------------------LEYLKSFSDLYQLEQYRAEII-------------
DNLJ_MESFL       --------------------------EKLITNIADIFKVEEHKENII-------------
DNLJ_UREPA       -------------------------DANLIKNIADLYYLQKHKEFIL-------------
DNLJ_MYCPE       -------------------------RNKIINDAIDLYELAHKKEILI-------------
DNLJ_MYCPN       -------------------------ENNLVRSVVDLYHLKEHKAAVL-------------
DNLJ_MYCGA       QNVSEDLSLFKLLDN---------EEQTFVNSVLDIYQLERYKEIII-------------
DNLJ_MYCMO       ------------------------LGILT--KYSDLFFLEKYKNLIE-------------
DNLJ_MYCS5       ------------------------HPVIQMREIQDIFLLKNHVDEIK-------------
DNLJ_MYCPU       ------------------------KGWVK--KIEDIYNLKNNYDDLL-------------
DNLJ_MYCH7       ------------------------KGLIS--SACDIFYLKDKLELIY-------------
DNLJ_FUSNN       --------------------------LGYIKTVVDIFDLKNHREALE-------------
DNLJ_LEPIC       --------------------------HDYIKSIADLYDLKDQKEKLM-------------
DNLJ_BORBU       --------------------------KKFIFSEIDLYTF--DFYKLL-------------
DNLJ_ONYPE       --------------------------KNLIAKPSDLYLLKKHKHILQ-------------
DNLJ_NITSB       --------------------------KGLVKDVVDLFKLKKEDLLRL-------------
DNLJ_SULDN       --------------------------SGLVKSVVDLFDLTLEKLLTL-------------
DNLJ_CAMHC       --------------------------KGKIINISDIYTLKADDLEGL-------------
DNLJ_CAMJJ       --------------------------HKKITTLESIFHLKFSDFEGL-------------
DNLJ_WOLSU       --------------------------AGLIKEFEDLFSLTKESLLSL-------------
DNLJ_HELHP       --------------------------NAFVRNIKDIYALSIQQLLTL-------------
DNLJ_HELAH       --------------------------EKLIFNALDLYALKLEDLMRL-------------
DNLJ_CLOTE       --------------------------ELNIKSIGDLYRVKKEDLLTL-------------
DNLJ1_CLOAB      --------------------------KLNIKSISDLYRITKEELMSL-------------
DNLJ_MARHV       ----------------------------MVSTVADLYRLT--------------------
DNLJ_ALCBS       ----------------------------LITTVADLYRLK--------------------
DNLJ_IDILO       ----------------------------WIKSPADLYRLS--------------------
DNLJ_COLP3       ----------------------------LINTPADLFKLT--------------------
DNLJ_SHEAM       ----------------------------LVESPADLFKLN--------------------
DNLJ_SACD2       ----------------------------LVNDVADLYTLD--------------------
DNLJ_CHRSD       ----------------------------WVKTPADLFRLE--------------------
DNLJ_LEGPA       ----------------------------IVHHLADLYELD--------------------
DNLJ_MAGMM       ----------------------------LVERISDLYRLHEQ------------------
DNLJ_NITMU       ----------------------------IIRTPADLYKLG--------------------
DNLJ_JANMA       ----------------------------IITTAADLYKLG--------------------
DNLJ_METCA       ----------------------------LIATVADLYRLD--------------------
DNLJ_NITOC       ----------------------------LLKDVADLYGLT--------------------
DNLJ_COXBU       ----------------------------LIKDITGIYQLK--------------------
DNLJ_PSYCK       ----------------------------LVKTVADIYQLHNH------------------
DNLJ_HYDCU       ----------------------------WVKHPDDFYHLT--------------------
DNLJ_FRATN       ----------------------------LIKYPADIYKLN--------------------
DNLJ_DICNV       ----------------------------FVRTPADLFCLT--------------------
DNLJ_SODGM       ----------------------------LVKTPADLFRLN--------------------
DNLJ_BAUCH       ----------------------------IIQNPVDLFRLN--------------------
DNLJ_BUCBP       ----------------------------YVSDLSDIFDLN--------------------
DNLJ_BUCCC       ----------------------------YLYTPIDFFSLT--------------------
DNLJ_BUCAI       ----------------------------LVKNPIDFFYLK--------------------
DNLJ_WIGBR       ----------------------------IIKYPSDIFKLN--------------------
DNLJ_BLOPB       ----------------------------LIFTSSDVFRLN--------------------
DNLJ_BLOFL       ----------------------------LICTPVDFFSLS--------------------
DNLJ_BORA1       ----------------------------SLKTLADVFRLN--------------------
DNLJ_PSESM       ----------------------------LIGSPADLYKLK--------------------
DNLJ_RALSO       ----------------------------YVHGIADLYRLT--------------------
DNLJ_XYLFT       ----------------------------VVHGVADLYHLS--------------------
DNLJ_NEIG1       ----------------------------LVRHFADLYRID--------------------
DNLJ_BDEBA       ----------------------------LLTRFSDFYRLT--------------------
DNLJ_GEOSL       ----------------------------LVKNVADLYTLT--------------------
DNLJ_PELCD       ----------------------------LIKSVADLYHLT--------------------
DNLJ_SYNAS       ----------------------------LIHDPADLYYLS--------------------
DNLJ_SYNFM       ----------------------------IVESVSDLYRLS--------------------
DNLJ_MYXXD       ----------------------------RVKAFADLYALT--------------------
DNLJ_ANADF       ----------------------------LVKDFADLYAVPFPAWQELFSRPR--------
DNLJ_HALHL       ----------------------------LVVDLADLFRLG--------------------
DNLJ_NATPD       ----------------------------LVERLPDLYDLS--------------------
DNLJ_HALWD       ----------------------------VIGELADLYTLS--------------------
DNLJ_SALRD       ----------------------------LIQTISDLYELE--------------------
DNLJ_LISW6       ----------------------------LIKDVADLFFLSK-------------------
DNLJ_STAS1       ----------------------------KIKDVADIFYLTK-------------------
DNLJ_GEOSE       ----------------------------LVRDVADLYCLTK-------------------
DNLJ_ENTFA       ----------------------------LVKDVADLYFLTE-------------------
DNLJ_STRS2       ----------------------------LVHDVADIYKLTV-------------------
DNLJ_LACS1       ----------------------------MIKDVAGIYSLTF-------------------
DNLJ_LACPL       ----------------------------LVSDVAGLYRLTK-------------------
DNLJ_OENOB       ----------------------------LIRKISDLYALTE-------------------
DNLJ_LEUMM       ----------------------------YIKDVASIYRITV-------------------
DNLJ_PEDPA       ----------------------------FIHHFDDLYKLTS-------------------
DNLJ_LACDB       ----------------------------LVHNVADLYYLTA-------------------
DNLJ_SYMTH       ----------------------------LIEDAADLYRLHEK------------------
DNLJ_MOOTA       ----------------------------LIHDAADLYYLKEE------------------
DNLJ_DESHY       ----------------------------LIKDAADLYALEYD------------------
DNLJ_CARHZ       ----------------------------LIHNYADLYYLSAE------------------
DNLJ_HUNT2       ----------------------------LIKEIADLYYLHKE------------------
DNLJ_CALS8       ----------------------------LIKTPADIYDLKFD------------------
DNLJ_CALS4       ----------------------------LIQNVADLYYLKYR------------------
DNLJ_CLOD6       ----------------------------IIQDVSDLYYIKKE------------------
DNLJ_SYNWW       ----------------------------MVKRIDDLYRLREE------------------
DNLJ_THEMA       ----------------------------LIKDIADIFYLTPF------------------
DNLJ_AQUAE       ----------------------------LAKDVGDLYYLKLT------------------
DNLJ_SOLUE       ----------------------------IVHNIADLYDLKI-------------------
DNLJ_KORVE       ----------------------------LVKNVADIYELDE-------------------
DNLJ_SYNE7       ----------------------------LVNAIADLYRLDA-------------------
DNLJ_SYNJA       ----------------------------GVRTVADLYRLTP-------------------
DNLJ_SYNY3       ----------------------------LVNSVADLYGLQV-------------------
DNLJ_GLOVI       ----------------------------LVHTVADLYELSA-------------------
DNLJ_PROMT       ----------------------------YVKSIADLYKLEI-------------------
DNLJ_PROMA       ----------------------------IIKSIAGIYELKE-------------------
DNLJ_PARD8       ----------------------------YVKDSADLYTLTV-------------------
DNLJ_PORGI       ----------------------------MIRNVADFYALTE-------------------
DNLJ_GRAFK       ----------------------------LIESYADLYKLQK-------------------
DNLJ_CYTH3       ----------------------------LIRNVADLYTLTY-------------------
DNLJ_PELLD       ----------------------------LVHDPGDLYFLQE-------------------
DNLJ_CHLPN       ----------------------------LVHTCADLFQLTT-------------------
DNLJ_CHLMU       ----------------------------LIRSCSDVFALTE-------------------
DNLJ_PARUW       ----------------------------FIHLPSDIFALTE-------------------
DNLJ_RHOMR       ----------------------------LVRPLSDLYRLKL-------------------
DNLJ_RUBXD       ----------------------------LIRDVADLYELRA-------------------
DNLJ_ROSS1       ----------------------------WVQDVADLYTLTP-------------------
DNLJ_THEFI       ----------------------------LVRDVADLYHLRK-------------------
DNLJ_DEIRA       ----------------------------LIHDAAGLYTLSA-------------------
DNLJ_DEHMC       ----------------------------LVKNVSDLYYLTT-------------------
DNLJ_DESAG       ----------------------------RVVSPADLFRITR-------------------
DNLJ1_DESVV      ----------------------------RVTTAADLFSLTT-------------------
DNLJ_LAWIP       ----------------------------CIKTPADLFTLTT-------------------
DNLJ_RHOBA       ----------------------------LVENYADLYRLNVDELAELTWPRLR-------
DNLJ2_STRCO      ----------------------------LVADLADLFLLRR-------------------
DNLJ1_NOCFA      ----------------------------ILENPSDFYTLTK-------------------
DNLJ_PSYIN       -----------------------------IKKIHEIYELKQES-----------------
DNLJ_DESPS       -----------------------------LVDLPALYAMESAD-----------------
DNLJ_RUTMC       -----------------------------IRSVSQIYALNIED-----------------
DNLJ_VESOH       -----------------------------IRSVSQIYTLNVER-----------------
DNLJ_DESAL       -----------------------------FDSLEKIYAMTEED-----------------
                                                    .: .                     

DNLJ_TREDE       ---------EELAAIDRMGKLS--------------------------------------
DNLJ_TREPA       ---------EDLIEIEHVGNAT--------------------------------------
DNLJ_THEFY       IDPKTGKPKVVSF-----------------------------------------------
DNLJ_FRACC       ------------------------------------------------------------
DNLJ_SACEN       ------------------------------------------------------------
DNLJ_NOCSJ       ------------------------------------------------------------
DNLJ_ARTS2       GEFELVPYFYTKG-----------------------------------------------
DNLJ_CUTAK       GPWQLEPYFFTKA-----------------------------------------------
DNLJ_CORJK       ------------------------------------------------------------
DNLJ_LEIXX       LTETGVEKVDAPFRRRRQ------------------------------------------
DNLJ_BIFLO       TVGANGKKKKVRKRVGGSGLWHQVPAFWTAPTPAKKLTAKQLAERAQGEAAIESAETQGD
DNLJ_TROWT       KKGD--------------------------------------------------------
DNLJ_RHORT       ---NEPGALQHLRSREGWGPKS--------------------------------------
DNLJ_MAGSA       ---NDAELLQRLENFEGWGKRS--------------------------------------
DNLJ_CHESB       ----DAQNIKKLKDKEGWGTVS--------------------------------------
DNLJ_BRADU       ----NAK--LKLEEIEGYGATS--------------------------------------
DNLJ_RHILO       REAASGKTRKNVRSVEDRNYEG--------------------------------------
DNLJ_BARBK       ----QEKSLTRLENMEGFGTLS--------------------------------------
DNLJ_PARDP       ----GPGQLTQLKNREGWGEKS--------------------------------------
DNLJ_MARMM       ---EAGEIKPPLQEREGFGETS--------------------------------------
DNLJ_HYPNA       ---EAAGL-PPLEEWEGFGAQS--------------------------------------
DNLJ_CAUVC       ---EKLAV---LREREGYGETS--------------------------------------
DNLJ_SPHAL       --------------REGWKERS--------------------------------------
DNLJ_ZYMMO       --------------REGWGELS--------------------------------------
DNLJ_RHOPB       ---KRESLATQREEKTGKKRKSSLS-----------------------------------
DNLJ_GLUOX       ---------EALLQRDGWGRLS--------------------------------------
DNLJ_PELPD       ---QKPSEFKPLQEWDGWGELS--------------------------------------
DNLJ_RICTY       ---------IRLENMDGWGKKS--------------------------------------
DNLJ_ORITB       ---------NKLEDIAGWGIKS--------------------------------------
DNLJ_WOLTR       ---------FSLKEQPDWGERS--------------------------------------
DNLJ_EHRRW       ---------IQLSSFNGWGEKS--------------------------------------
DNLJ_ANAPZ       ---------MNLSAEHGWGEKS--------------------------------------
DNLJ_NEOSM       -----------IKKYDGWGEKS--------------------------------------
DNLJ_PELUB       -----------IEELEGWGKLS--------------------------------------
DNLJ_SPICI       ---------------ELENFGE--------------------------------------
DNLJ_MESFL       ---------------NFEKFGE--------------------------------------
DNLJ_UREPA       ---------------TSDFKIK--------------------------------------
DNLJ_MYCPE       ---------------ATKQKFYRKND----------------------------------
DNLJ_MYCPN       ---------------ALELKIG--------------------------------------
DNLJ_MYCGA       ---------------KPWLKKGFSKS----------------------------------
DNLJ_MYCMO       ---------------SQPS-----------------------------------------
DNLJ_MYCS5       ---------------KIKF-----------------------------------------
DNLJ_MYCPU       ---------------KLEN-----------------------------------------
DNLJ_MYCH7       ---------------ERLSNKN--------------------------------------
DNLJ_FUSNN       ---------------NIDKMGK--------------------------------------
DNLJ_LEPIC       ---------------EEEGFGE--------------------------------------
DNLJ_BORBU       ---------------EFKGFKD--------------------------------------
DNLJ_ONYPE       ---------------EMPGFGA--------------------------------------
DNLJ_NITSB       ---------------PGFAEKK--------------------------------------
DNLJ_SULDN       ---------------EGFKEKK--------------------------------------
DNLJ_CAMHC       ---------------EGFKDKK--------------------------------------
DNLJ_CAMJJ       ---------------EGFKEKK--------------------------------------
DNLJ_WOLSU       ---------------EGFKEKK--------------------------------------
DNLJ_HELHP       ---------------EGWQEKR--------------------------------------
DNLJ_HELAH       ---------------DKFKIKK--------------------------------------
DNLJ_CLOTE       ---------------DKFKEKK--------------------------------------
DNLJ1_CLOAB      ---------------DKFKDKK--------------------------------------
DNLJ_MARHV       --------KFQIASLERMGDK---------------------------------------
DNLJ_ALCBS       --------AEQVAGLERMGEK---------------------------------------
DNLJ_IDILO       --------KAELATLPRMGAK---------------------------------------
DNLJ_COLP3       --------EIQVSTIDRMGKK---------------------------------------
DNLJ_SHEAM       --------VSKLTMLERMGTK---------------------------------------
DNLJ_SACD2       --------IPTLAGLERLGAK---------------------------------------
DNLJ_CHRSD       --------AERLAELPRLAEK---------------------------------------
DNLJ_LEGPA       --------LQTLANLPRMGEK---------------------------------------
DNLJ_MAGMM       --------RQVLVGLERLGGK---------------------------------------
DNLJ_NITMU       --------LAALAALDRMGEK---------------------------------------
DNLJ_JANMA       --------FRALAELDRMADK---------------------------------------
DNLJ_METCA       --------LDRLAGLDRMGEK---------------------------------------
DNLJ_NITOC       --------KEQLAGLERMGQK---------------------------------------
DNLJ_COXBU       --------KSAITALPRMGEK---------------------------------------
DNLJ_PSYCK       --------QEELITLEKLGEK---------------------------------------
DNLJ_HYDCU       --------VEKLATLERMAEK---------------------------------------
DNLJ_FRATN       --------FDQLTGLERMGAK---------------------------------------
DNLJ_DICNV       --------ADDWASLPRMGKK---------------------------------------
DNLJ_SODGM       --------KEILTRLDRMGSK---------------------------------------
DNLJ_BAUCH       --------QDQLTCLKNMGQK---------------------------------------
DNLJ_BUCBP       --------VSLLTKVENIGII---------------------------------------
DNLJ_BUCCC       --------VKKLKNIFRMGDK---------------------------------------
DNLJ_BUCAI       --------DIDLIQLKNVGKR---------------------------------------
DNLJ_WIGBR       --------TDKIIFLKGMGLK---------------------------------------
DNLJ_BLOPB       --------KNKLLCLEGFGLE---------------------------------------
DNLJ_BLOFL       --------KEKLLCLDRYGEK---------------------------------------
DNLJ_BORA1       --------AFELAALDRMGKK---------------------------------------
DNLJ_PSESM       --------YEQIIDLEGFAEI---------------------------------------
DNLJ_RALSO       --------LDDFLEMKRRADE----------RDGVTPETVAA------------------
DNLJ_XYLFT       --------LDQLLRLRLVTNAQTPTMLLREARDHVTGMRYQQLEEILRTVGVDLSGEGDV
DNLJ_NEIG1       --------IPTLQKMKETADKGSS------ENENGDAETVSGDLSKYNTQ----------
DNLJ_BDEBA       --------KEQILSLERQGDK---------------------------------------
DNLJ_GEOSL       --------KDQFMQFDRMGDK---------------------------------------
DNLJ_PELCD       --------KEDLLLCERLADK---------------------------------------
DNLJ_SYNAS       --------HDALLNLERMAEK---------------------------------------
DNLJ_SYNFM       --------VETLEQLPGFAGK---------------------------------------
DNLJ_MYXXD       --------KEDLLTLERMGDK---------------------------------------
DNLJ_ANADF       --------KEERDAKAELPQK---------------------------------------
DNLJ_HALHL       --------HAQLAGLERMGDK---------------------------------------
DNLJ_NATPD       --------VADVAELDGWGRT---------------------------------------
DNLJ_HALWD       --------VADLSKLDGWGTT---------------------------------------
DNLJ_SALRD       --------KADLLQLERYADK---------------------------------------
DNLJ_LISW6       ---------EKLLELERMGEK---------------------------------------
DNLJ_STAS1       ---------EDLLPLDRMGEK---------------------------------------
DNLJ_GEOSE       ---------EQLVGLERMGEK---------------------------------------
DNLJ_ENTFA       ---------EQLMTLDKIKEK---------------------------------------
DNLJ_STRS2       ---------DDLLTLEGFKEK---------------------------------------
DNLJ_LACS1       ---------EQLITLDKFKEK---------------------------------------
DNLJ_LACPL       ---------AQLLTLDKIKDK---------------------------------------
DNLJ_OENOB       ---------SQLTTLDKFADL---------------------------------------
DNLJ_LEUMM       ---------EQLLTLDKFQEK---------------------------------------
DNLJ_PEDPA       ---------EELSQLDGFKEK---------------------------------------
DNLJ_LACDB       ---------DDLSQLDHFKEK---------------------------------------
DNLJ_SYMTH       --------RDALIRLERMGEK---------------------------------------
DNLJ_MOOTA       --------D--LLKLERFGQQ---------------------------------------
DNLJ_DESHY       --------A--LVPLERLGKK---------------------------------------
DNLJ_CARHZ       --------E--VARLPRMGKK---------------------------------------
DNLJ_HUNT2       --------KETLVNIERMGKK---------------------------------------
DNLJ_CALS8       --------D--LVNLERFGVK---------------------------------------
DNLJ_CALS4       --------D--LITLERMGDK---------------------------------------
DNLJ_CLOD6       --------D--VVDLERMGEK---------------------------------------
DNLJ_SYNWW       --------E--ITALERMGPK---------------------------------------
DNLJ_THEMA       --------D-LAQLGPGIGQR---------------------------------------
DNLJ_AQUAE       --------D-ILKL-PGFGEK---------------------------------------
DNLJ_SOLUE       ---------EDLMDLDRMGVK---------------------------------------
DNLJ_KORVE       ---------EKLLSLERMGKK---------------------------------------
DNLJ_SYNE7       ---------PLLASLERFGEK---------------------------------------
DNLJ_SYNJA       ---------EHLESLEGMGSR---------------------------------------
DNLJ_SYNY3       ---------EQLLGLERFAQK---------------------------------------
DNLJ_GLOVI       ---------EQLAGLERLGAR---------------------------------------
DNLJ_PROMT       ---------DSLLELERFGEK---------------------------------------
DNLJ_PROMA       ---------KNLENLERMGTK---------------------------------------
DNLJ_PARD8       ---------ADLLRLERWAEK---------------------------------------
DNLJ_PORGI       ---------EQLLTLPGFKKR---------------------------------------
DNLJ_GRAFK       ---------EEVLPLERMAEK---------------------------------------
DNLJ_CYTH3       ---------DQLIQLDRFGEK---------------------------------------
DNLJ_PELLD       ---------PQLRNLERMGPK---------------------------------------
DNLJ_CHLPN       ---------EDLMQIPGIRER---------------------------------------
DNLJ_CHLMU       ---------NDLKQVPGFKDR---------------------------------------
DNLJ_PARUW       ---------GQISQLTNFKTK---------------------------------------
DNLJ_RHOMR       ---------EDLLKLEGFAET---------------------------------------
DNLJ_RUBXD       ---------EQLAPLEGLGEK---------------------------------------
DNLJ_ROSS1       ---------DHFANVEGYGPK---------------------------------------
DNLJ_THEFI       ---------EDLLGLERMGEK---------------------------------------
DNLJ_DEIRA       ---------EQLAGLERGGEK---------------------------------------
DNLJ_DEHMC       ---------ADLLQLPRMGEK---------------------------------------
DNLJ_DESAG       ---------EDLLGMERMGEK---------------------------------------
DNLJ1_DESVV      ---------VDLMGFERMGPT---------------------------------------
DNLJ_LAWIP       ---------ADLLTYKRMGAK---------------------------------------
DNLJ_RHOBA       ------KGKGDEMIEVQFGRKN--------------------------------------
DNLJ2_STRCO      ---------EQLLALERMGETS--------------------------------------
DNLJ1_NOCFA      ---------ERLLEFDRIGEVS--------------------------------------
DNLJ_PSYIN       ------------FVSFGFGDKT--------------------------------------
DNLJ_DESPS       ------------FEQVGFGPKQ--------------------------------------
DNLJ_RUTMC       ------------LVTIGFGEKT--------------------------------------
DNLJ_VESOH       ------------LMAIGFGEKT--------------------------------------
DNLJ_DESAL       ------------FLSLEFGPVQ--------------------------------------
                                                                             

DNLJ_TREDE       ------------------------------------------------------------
DNLJ_TREPA       ------------------------------------------------------------
DNLJ_THEFY       ---------------------------------------------------FANQKGEPK
DNLJ_FRACC       ---------------------------------------------------FEGLRGFAQ
DNLJ_SACEN       ------------------------------------------------------DGS-LS
DNLJ_NOCSJ       ----------------------------------------------------DEDGPQLS
DNLJ_ARTS2       ---------------------------------------------------TAKSPSKPT
DNLJ_CUTAK       ---------------------------------------------------TAKKPSTPT
DNLJ_CORJK       -------------------------------------------------------AGKLN
DNLJ_LEIXX       --------------------------------------KKDGAFDPEAEAFDGDEIAVPS
DNLJ_BIFLO       TASETTGAPTGAEAPLGTMPGFAAASYPEYDVPADAVIVRVDHKTTRTGVTDVPVIIRPG
DNLJ_TROWT       ---------------------------------------------------SFPGFEEPT
DNLJ_RHORT       ------------------------------------------------------------
DNLJ_MAGSA       ------------------------------------------------------------
DNLJ_CHESB       ------------------------------------------------------------
DNLJ_BRADU       ------------------------------------------------------------
DNLJ_RHILO       ------------------------------------------------------------
DNLJ_BARBK       ------------------------------------------------------------
DNLJ_PARDP       ------------------------------------------------------------
DNLJ_MARMM       ------------------------------------------------------------
DNLJ_HYPNA       ------------------------------------------------------------
DNLJ_CAUVC       ------------------------------------------------------------
DNLJ_SPHAL       ------------------------------------------------------------
DNLJ_ZYMMO       ------------------------------------------------------------
DNLJ_RHOPB       ------------------------------------------------------EEKRQY
DNLJ_GLUOX       ------------------------------------------------------------
DNLJ_PELPD       ------------------------------------------------------------
DNLJ_RICTY       ------------------------------------------------------------
DNLJ_ORITB       ------------------------------------------------------------
DNLJ_WOLTR       ------------------------------------------------------------
DNLJ_EHRRW       ------------------------------------------------------------
DNLJ_ANAPZ       ------------------------------------------------------------
DNLJ_NEOSM       ------------------------------------------------------------
DNLJ_PELUB       ------------------------------------------------------------
DNLJ_SPICI       ------------------------------------------------------------
DNLJ_MESFL       ------------------------------------------------------------
DNLJ_UREPA       -----------------------------------------------------------E
DNLJ_MYCPE       ----------------------------------------------DGTKTEFERSLFKD
DNLJ_MYCPN       -----------------------------------------------------------E
DNLJ_MYCGA       ----------------------------------------------SLKYN----FRFQE
DNLJ_MYCMO       ----------------------------------------------------FGEKS---
DNLJ_MYCS5       ----------------------------------------------------FAGKSQEN
DNLJ_MYCPU       ----------------------------------------------------FQEHS---
DNLJ_MYCH7       ----------------------------------------------QLLTKQNASQSMQI
DNLJ_FUSNN       ------------------------------------------------------------
DNLJ_LEPIC       ------------------------------------------------------------
DNLJ_BORBU       ------------------------------------------------------------
DNLJ_ONYPE       ------------------------------------------------------------
DNLJ_NITSB       ------------------------------------------------------------
DNLJ_SULDN       ------------------------------------------------------------
DNLJ_CAMHC       ------------------------------------------------------------
DNLJ_CAMJJ       ------------------------------------------------------------
DNLJ_WOLSU       ------------------------------------------------------------
DNLJ_HELHP       ------------------------------------------------------------
DNLJ_HELAH       ------------------------------------------------------------
DNLJ_CLOTE       ------------------------------------------------------------
DNLJ1_CLOAB      ------------------------------------------------------------
DNLJ_MARHV       ------------------------------------------------------------
DNLJ_ALCBS       ------------------------------------------------------------
DNLJ_IDILO       ------------------------------------------------------------
DNLJ_COLP3       ------------------------------------------------------------
DNLJ_SHEAM       ------------------------------------------------------------
DNLJ_SACD2       ------------------------------------------------------------
DNLJ_CHRSD       ------------------------------------------------------------
DNLJ_LEGPA       ------------------------------------------------------------
DNLJ_MAGMM       ------------------------------------------------------------
DNLJ_NITMU       ------------------------------------------------------------
DNLJ_JANMA       ------------------------------------------------------------
DNLJ_METCA       ------------------------------------------------------------
DNLJ_NITOC       ------------------------------------------------------------
DNLJ_COXBU       ------------------------------------------------------------
DNLJ_PSYCK       ------------------------------------------------------------
DNLJ_HYDCU       ------------------------------------------------------------
DNLJ_FRATN       ------------------------------------------------------------
DNLJ_DICNV       ------------------------------------------------------------
DNLJ_SODGM       ------------------------------------------------------------
DNLJ_BAUCH       ------------------------------------------------------------
DNLJ_BUCBP       ------------------------------------------------------------
DNLJ_BUCCC       ------------------------------------------------------------
DNLJ_BUCAI       ------------------------------------------------------------
DNLJ_WIGBR       ------------------------------------------------------------
DNLJ_BLOPB       ------------------------------------------------------------
DNLJ_BLOFL       ------------------------------------------------------------
DNLJ_BORA1       ------------------------------------------------------------
DNLJ_PSESM       ------------------------------------------------------------
DNLJ_RALSO       -------------------------------------------------------GKIAT
DNLJ_XYLFT       PKHWQIDVLRA-----------------------------------QWPDFDWNHKKIAT
DNLJ_NEIG1       -----------------------------------------------------NGKKQPT
DNLJ_BDEBA       ------------------------------------------------------------
DNLJ_GEOSL       ------------------------------------------------------------
DNLJ_PELCD       ------------------------------------------------------------
DNLJ_SYNAS       ------------------------------------------------------------
DNLJ_SYNFM       ------------------------------------------------------------
DNLJ_MYXXD       ------------------------------------------------------------
DNLJ_ANADF       ------------------------------------------------------------
DNLJ_HALHL       ------------------------------------------------------------
DNLJ_NATPD       ------------------------------------------------------------
DNLJ_HALWD       ------------------------------------------------------------
DNLJ_SALRD       ------------------------------------------------------------
DNLJ_LISW6       ------------------------------------------------------------
DNLJ_STAS1       ------------------------------------------------------------
DNLJ_GEOSE       ------------------------------------------------------------
DNLJ_ENTFA       ------------------------------------------------------------
DNLJ_STRS2       ------------------------------------------------------------
DNLJ_LACS1       ------------------------------------------------------------
DNLJ_LACPL       ------------------------------------------------------------
DNLJ_OENOB       ------------------------------------------------------------
DNLJ_LEUMM       ------------------------------------------------------------
DNLJ_PEDPA       ------------------------------------------------------------
DNLJ_LACDB       ------------------------------------------------------------
DNLJ_SYMTH       ------------------------------------------------------------
DNLJ_MOOTA       ------------------------------------------------------------
DNLJ_DESHY       ------------------------------------------------------------
DNLJ_CARHZ       ------------------------------------------------------------
DNLJ_HUNT2       ------------------------------------------------------------
DNLJ_CALS8       ------------------------------------------------------------
DNLJ_CALS4       ------------------------------------------------------------
DNLJ_CLOD6       ------------------------------------------------------------
DNLJ_SYNWW       ------------------------------------------------------------
DNLJ_THEMA       ------------------------------------------------------------
DNLJ_AQUAE       ------------------------------------------------------------
DNLJ_SOLUE       ------------------------------------------------------------
DNLJ_KORVE       ------------------------------------------------------------
DNLJ_SYNE7       ------------------------------------------------------------
DNLJ_SYNJA       ------------------------------------------------------------
DNLJ_SYNY3       ------------------------------------------------------------
DNLJ_GLOVI       ------------------------------------------------------------
DNLJ_PROMT       ------------------------------------------------------------
DNLJ_PROMA       ------------------------------------------------------------
DNLJ_PARD8       ------------------------------------------------------------
DNLJ_PORGI       ------------------------------------------------------------
DNLJ_GRAFK       ------------------------------------------------------------
DNLJ_CYTH3       ------------------------------------------------------------
DNLJ_PELLD       ------------------------------------------------------------
DNLJ_CHLPN       ------------------------------------------------------------
DNLJ_CHLMU       ------------------------------------------------------------
DNLJ_PARUW       ------------------------------------------------------------
DNLJ_RHOMR       ------------------------------------------------------------
DNLJ_RUBXD       ------------------------------------------------------------
DNLJ_ROSS1       ------------------------------------------------------------
DNLJ_THEFI       ------------------------------------------------------------
DNLJ_DEIRA       ------------------------------------------------------------
DNLJ_DEHMC       ------------------------------------------------------------
DNLJ_DESAG       ------------------------------------------------------------
DNLJ1_DESVV      ------------------------------------------------------------
DNLJ_LAWIP       ------------------------------------------------------------
DNLJ_RHOBA       ------------------------------------------------------------
DNLJ2_STRCO      ------------------------------------------------------------
DNLJ1_NOCFA      ------------------------------------------------------------
DNLJ_PSYIN       ------------------------------------------------------------
DNLJ_DESPS       ------------------------------------------------------------
DNLJ_RUTMC       ------------------------------------------------------------
DNLJ_VESOH       ------------------------------------------------------------
DNLJ_DESAL       ------------------------------------------------------------
                                                                             

DNLJ_TREDE       --AEKVYKALHSKKEI--SLTEFIAGFDIEGIGETMVEKLEE------------------
DNLJ_TREPA       --AKKILEAIHHKKEI--ALQTFIAGFGIEGIGETMGEKLIC------------------
DNLJ_THEFY       KIVEKLFQQLEEAKKR--PLWRVLVALSIRHVGPRAAEDLA-------------------
DNLJ_FRACC       KKIDQILRGVEAARHR--PLWRLLVGLSIRHVGPTAARALA-------------------
DNLJ_SACEN       VNGGKLLANLESAKQQ--PLWRVLVALSIRHVGPIAARVLA-------------------
DNLJ_NOCSJ       ANGQRLLDNLDKAKQV--PLWRVLVALSIRHVGPKAGRALA-------------------
DNLJ_ARTS2       ATTEKLFTELEKAKSQ--PLWRVLVALSIRHVGPRASRALA-------------------
DNLJ_CUTAK       ATTKKMFDELAKAKSQ--PLWRVLVALSIRHVGPTAARALA-------------------
DNLJ_CORJK       KSGETLLEKLQSAKEA--DLWRVLVALSIRHVGPTAAKALA-------------------
DNLJ_LEIXX       KSAIELLANLRAARTK--PLWRILVSLNIRHVGPVAARALA-------------------
DNLJ_BIFLO       ENTRKMFDEMDKARHA--DLWRVLVALSIRRLGPPTARLIA-------------------
DNLJ_TROWT       KSAQDMVDSIERAKRS--PLWKFLLALNIRHIGPASAKALA-------------------
DNLJ_RHORT       --AENLFKAITARKTI--PLDRFIYALGIRQVGQATAR----------------------
DNLJ_MAGSA       --TEKLFESIKTRSAM--GLERFIFALGIRQIGEATAK----------------------
DNLJ_CHESB       --AGNLFAAIEAKRTI--PLDRMIYGLGIRHVGERTAV----------------------
DNLJ_BRADU       --VRNLFAAIESRRRI--ALERFVYALGMRHVGETTAL----------------------
DNLJ_RHILO       --LDKLFAAIDSRREP--ELDRFIFALGIRHIGETTAA----------------------
DNLJ_BARBK       --VRKLYDAINARRKI--PLSRFLFALGIRHVGEVNAR----------------------
DNLJ_PARDP       --AASLFQAIEKRREI--PLARLLFALGIRHVGEVAAQ----------------------
DNLJ_MARMM       --IRNLFTSIEDRRTI--TLARFLNALGIRHVGENTSA----------------------
DNLJ_HYPNA       --ARKLYSAIDARRKV--PFARFLNGLGIRYVGQTTSA----------------------
DNLJ_CAUVC       --VANLVKGIEARRTI--GMDRMIYGLGARDIGETTST----------------------
DNLJ_SPHAL       --VDNLLAAIEAKRQP--DAARLLFGLGIRHVGAVTAR----------------------
DNLJ_ZYMMO       --VDNLISAIDKRRKV--PFDRFLFALGIRHVGAVTAR----------------------
DNLJ_RHOPB       TDVENLLAAIDARRTV--AFNRFIFGLGIRHVGEVTSK----------------------
DNLJ_GLUOX       --VDNLFRAIEDRRTI--PLSRLIFGLGIRRIGERNAQ----------------------
DNLJ_PELPD       --ANNLFRAIRTKQKI--TLYRFIYALGIPKVGEVTAK----------------------
DNLJ_RICTY       --VANLWQNIEKSQKI--SLQRFIYALGIRHIGEQNAK----------------------
DNLJ_ORITB       --VNKLFKNINQAKNV--ILDRFIYALAVKHVGKYSAK----------------------
DNLJ_WOLTR       --IANLLNAIQNRRVI--TLDRFIFSLGIRFIGQVAAE----------------------
DNLJ_EHRRW       --INNLLSAINNSKVI--NLENFIFSLGIRFVGKHIAK----------------------
DNLJ_ANAPZ       --IALLINAINASTTV--KLSNFIFALGIRFIGKGAAK----------------------
DNLJ_NEOSM       --VENILKNIKNSRKI--SLEKFIFSLGIKNIGEKTAY----------------------
DNLJ_PELUB       --VANLRFSIEEKKNI--SLERFIYSLGIRHIGQENAK----------------------
DNLJ_SPICI       KSFENMITSINNSKNN--SLERLLFALGIRHVGQKTAK----------------------
DNLJ_MESFL       KSFENLIASIKESKNN--SFEKTLFGLGIRHVGSKTAL----------------------
DNLJ_UREPA       KSFSNLINSINNSKKC--SLEFLLTAFGIRHVGPNLAK----------------------
DNLJ_MYCPE       KSFTNIIEAIEKSKSN--SMEKFLTGLGIKYVGLRAAK----------------------
DNLJ_MYCPN       VLFNKLISSIEQSKTK--GMARLLTGLGIKHVGQVLAK----------------------
DNLJ_MYCGA       KSFDKLINSINESKNR--ELYRLLAALNIKYIGIATAK----------------------
DNLJ_MYCMO       --FNNLIESINRSKSN--SLEKFIFAIGIKQIGERSAK----------------------
DNLJ_MYCS5       KKINNILQSIEKAKDA--YLRNVLAALGIKGIGNIAAN----------------------
DNLJ_MYCPU       --VNVLLHKIEESKDV--YTWKLIAALGIKNIGKKLAKSLVKI-----------------
DNLJ_MYCH7       KSIMKLLNEVERAKNI--DFYRLIFGLGIRNVGLKAAK----------------------
DNLJ_FUSNN       KSIENLLNSIEESKNR--DYDKILYALGIAEIGKVTSK----------------------
DNLJ_LEPIC       KSVNIILKGIEQSKQK--DFRFLLPSLGLSELGHKVTELLIEHGI---------------
DNLJ_BORBU       RKINNLINSIEASKKK--PFSKLLLSMGIKDLGENTIRLLFLNNL---------------
DNLJ_ONYPE       KKITNILDAIEASKQK--GFEDVLFALGIKHIGKKVSQVLAKH-----------------
DNLJ_NITSB       --AQNLIDATQSVKGV--ECWRFVNALGIEHIGEVASK----------------------
DNLJ_SULDN       --AQNLLDALGSAKGC--EYWRFVNSLGIEHIGEVASK----------------------
DNLJ_CAMHC       --ISNLLASIENSRIS--PLYRFITALGIEHIGEVAAR----------------------
DNLJ_CAMJJ       --INNLLNAIEQAREC--ELFRFITALGIEHIGEVAAK----------------------
DNLJ_WOLSU       --AQNLLDAIQGVRGC--DLWRFINALGIEHIGEGAAK----------------------
DNLJ_HELHP       --ANNLIYAIQNTIGV--ELWRFINALGIEHIGEGASK----------------------
DNLJ_HELAH       --AQNLLDAIQKSKNP--PLWRLINALGIEHIGKGASK----------------------
DNLJ_CLOTE       --ADNIMNAIENSKKP--KLSSFIYALSIPNVGVKTAR----------------------
DNLJ1_CLOAB      --ASNLINAIEKSKEC--DLDSFVYSLGIPNVGKKTAT----------------------
DNLJ_MARHV       -SAANLIAAIDRSREP--VLWRFLYALGIREVGEATAKGLA----AHFG-----------
DNLJ_ALCBS       -SADNLIAALEASKTV--GLGRFLFALGILQIGEETAKNLA----DCFG-----------
DNLJ_IDILO       -SAENLRNAIKATQET--TLARFIYALGIREVGEATANALA----NHFK-----------
DNLJ_COLP3       -SATNLINGLEQAKST--TLAKFIYGLGIREVGEATAANLA----NHFY-----------
DNLJ_SHEAM       -SATNLVAAIEEAKTT--TLPKFLYALGIREVGEATAANLA----KHFR-----------
DNLJ_SACD2       -SAANLVAAIEASKQT--SLDKILYALGIREVGRATARNLA----NHFC-----------
DNLJ_CHRSD       -SANNLVNALEAAKRT--TLARFIYAIGIREVGEATAASLA----RHFG-----------
DNLJ_LEGPA       -SAKNLLSALEKSKKT--TFNRFLYALGIREIGEAGARVLA----EHYC-----------
DNLJ_MAGMM       -SVANLLEAIEQSKAQ--SAARFLFGLGIRDVGVTLAGSLA----AHFT-----------
DNLJ_NITMU       -SAGNIINEIEKSKDT--TLARFIYSLGIRNVGEATARDLA----RYFG-----------
DNLJ_JANMA       -SAQNVMAALEKSKST--TLARFIYALGIRHVGEATAKELA----RHFG-----------
DNLJ_METCA       -SAANLLAALERSKRT--TLARFLYALGIRDVGEVTAKVLS----EHFG-----------
DNLJ_NITOC       -SATNLINAIQQSKHT--TLPRFLYALGIREVGEATAQVLA----KEFG-----------
DNLJ_COXBU       -SAENLLTAIEKSKKT--TLPRFLYALGIRGVGDTTARTLA----RHFH-----------
DNLJ_PSYCK       -SVQNILSAIEASKQT--TLARFIYALGIRGVGETTAQNLA----QQFG-----------
DNLJ_HYDCU       -SAQNVITGIQASLET--TLAKFIYSLGIPEVGEVTAKNLA----NHFK-----------
DNLJ_FRATN       -SSQNVLDSIKKSKTP--SLARFIFAIGIKDIGEVSSDVLA----NHFG-----------
DNLJ_DICNV       -SAHNVMTAIDAAKKT--TLARFIYALGIRGVGSVNAQALA----AHFG-----------
DNLJ_SODGM       -SAQNLLEALEKARQT--TFARFLYALGIREVGEATAVNLA----AAYG-----------
DNLJ_BAUCH       -KTKKLLDAIEYAKKT--TFARFLYAIGIREIGETKAAYLA----DYYK-----------
DNLJ_BUCBP       -KSQNIIRSINNSKNV--SFSKFLCSLGIFEVGSIVARSIS----NYFF-----------
DNLJ_BUCCC       -LSEKIIKNIAFSKRV--SLDKFICSLGIFGVGTSIAKRLA----YYYR-----------
DNLJ_BUCAI       -KSIKIINSIKKCKKT--TLKCFIYALGIPGVGEVVAGKIA----NYFI-----------
DNLJ_WIGBR       -SSENLIKEIIKSKTT--ELYRVIYGIGIPNVGIYTSMNLA----NYYK-----------
DNLJ_BLOPB       -NIERLLRSIEDSKKI--TLARFIYALGIYGVGETVASNLA----IVYK-----------
DNLJ_BLOFL       -SAERLLQSILIAKEI--TLSAFIYALGIPGVGESVSNKLA----YMYR-----------
DNLJ_BORA1       -SADNLVAAIDQARRP--SLGRLLFALGIRHVGETTARDVA----RHFG-----------
DNLJ_PSESM       -SSNKLLKAIADSRQP--TLARFIYALGIPDVGEETAKVLA----RSLA-----------
DNLJ_RALSO       KWAENLLDGIRASKTP--PLARFLFAMGIRHVGESTAKTLA----DWLG-----------
DNLJ_XYLFT       KWAQNLIAAIDRSRQT--TLERFLFALGMTHVGETTAKALA----HSFG-----------
DNLJ_NEIG1       KWAQNILAGIESGKTP--ELARFLFALGIRHVGERTAKTLA----QAFG-----------
DNLJ_BDEBA       -SADNIIKSIENSKNP--TLARFIFALGIRFVGEQTGKHLA----DHFL-----------
DNLJ_GEOSL       -LAENLLNAIEASKQR--ELSRFIFALGIRHVGEHTAKLLA----GAFG-----------
DNLJ_PELCD       -SAEKLLTAIAASKTR--PLGRFLFALGIRHVGEHLASLLA----RQFG-----------
DNLJ_SYNAS       -SVSNLLSAIELSKHP--SLDKIIFALGIRHVGEHISKILA----RRFR-----------
DNLJ_SYNFM       -SSRNLVESIERSKKT--NLADFLYALGIYHVGSHVARLLA----ERFG-----------
DNLJ_MYXXD       -SADNLIASLERSKQT--TQRRFLYSLGIRHVGDATAKALA----EAFP-----------
DNLJ_ANADF       -SAQNMVDALERSKAT--TLRRLLFALGIPQVGEATAATLA----RHFG-----------
DNLJ_HALHL       -SADNLLAALDRARST--TLARFLYALGIPHVGEVTARRLA----EAAYGLMVAVPRGDR
DNLJ_NATPD       -SAENLLEELEASTEP--PLPAFLSALGIPGVGTTTAADIA----REFG-----------
DNLJ_HALWD       -SAENLIQAISETQTP--SLTDFLVGLGIPEVGPTIARNLA----GTFD-----------
DNLJ_SALRD       -SAQNLIDEIEASLEQ--DLDRFLYALGIPLVGSATARLLA----QHFD-----------
DNLJ_LISW6       -SVTNLLASIEASKQN--SLEKLLFGLGIRHVGAKAAKSLA----VHFE-----------
DNLJ_STAS1       -KVDNLLNAIEKAKSN--SLEQLLFGLGIRHLGVKASQVIA----EKYG-----------
DNLJ_GEOSE       -SAANLLAAIEASKQN--SLERLLFGLGIRYVGAKAAQLLA----EHFE-----------
DNLJ_ENTFA       -SANNIYTAIQGSKEN--SVERLIFGLGIRHVGAKAAKILA----EHFG-----------
DNLJ_STRS2       -SANKLYQAIQTSKSN--SAECLLFGLGIRHVGSKASKILV----EKFG-----------
DNLJ_LACS1       -SANNLLTAIDNSRNN--SIERLIFGLGIRHVGAKVARILA----ENYK-----------
DNLJ_LACPL       -SAEKLLTAIDRSRDN--SLERLLFGLGIRHVGAKVARLIA----QHFG-----------
DNLJ_OENOB       -SSKNLIQAIDRSRQN--SVERLITALGIRGVGAKAAKVLA----AHFK-----------
DNLJ_LEUMM       -SAVKLIDAINSSKEN--SLERLLFGLGIRMVGAKAARLIA----EKFR-----------
DNLJ_PEDPA       -RVNNLLEAIDNSRKN--SLERLINGLGIQGVGTKMARTLA----EKFG-----------
DNLJ_LACDB       -SINNLLVAIDQSRKN--SVELVLFGLGIDNVGGKAAQLIA----RKFK-----------
DNLJ_SYMTH       -SVDNLLAAIDATRQN--PLHRLIFALGIRHVGERAARLLA----DHFG-----------
DNLJ_MOOTA       -SASNLLAAIAASKKQ--PLERLIFALGIRNVGQRAARVLA----DHFG-----------
DNLJ_DESHY       -SAENLLKAIEDSKER--GLAPLIFGLGIRHVGEKAGKILA----QKYG-----------
DNLJ_CARHZ       -SAENLINAIEKSKQN--SLERLIYGLGIRLVGEKAARDLA----VHFK-----------
DNLJ_HUNT2       -SVENLLASIEKSKQN--NIDRLIFGFGIRHIGLRAAQLLS----ENFE-----------
DNLJ_CALS8       -STNNLLKAIEASKKR--PLDRLIFALGIRHIGQKAAKTLA----EHIS-----------
DNLJ_CALS4       -SARNLLEAIEKSKKR--DLDRLLFGLGINLIGSKAAQVIA----EHFK-----------
DNLJ_CLOD6       -SADNLINSIEKSKEN--DLWRLINGLGIKFIGVKAAKILA----YNFK-----------
DNLJ_SYNWW       -SAANLIKAINESKSR--PLSRLLTALGIRHIGARSAKILS----RHIH-----------
DNLJ_THEMA       -TIAKILQEIEEAKKR--PLHKLITGLGIPMVGQKTAKILA----EHFK-----------
DNLJ_AQUAE       -SAMNLLKAIEESKNR--PLDRVLYGLGIRYVGQTTAKKIA----EIIN-----------
DNLJ_SOLUE       -SAGNVIRNIDKSRRN--SLPRVLTALGIRFVGERTAVFLA----QAFG-----------
DNLJ_KORVE       -SAQNILDEIKGTKKL--PLERVIYGLGIRMVGERTAQFLA----EHFG-----------
DNLJ_SYNE7       -SAQNLVQAIAKSRQQ--PWSRVLYGLGIRHVGSVNAKNLA----ATFT-----------
DNLJ_SYNJA       -SSQKLVQAIQRSRQQ--PWERVLYGLGIPHVGVVTAQILA----QHFP-----------
DNLJ_SYNY3       -SAEKLIAAIEVSKSQ--PWSRILFGLGIRHVGQVNAKLLS----QQFP-----------
DNLJ_GLOVI       -SAAKIVEQLDRSHRQ--PWSRVLYGLGLRHIGASVSVELA----RAFA-----------
DNLJ_PROMT       -SANNLLIEINESKNK--NWHKQLYGLGIPHIGEANAKSLS----NNFN-----------
DNLJ_PROMA       -SAEKLLIEINNSKKQ--PWHKQLYGLGILHIGEANAKAIA----EVFP-----------
DNLJ_PARD8       -SAQNLMSSLEESKQV--PFERVLFGLGIRFVGETVAKRLV----SAFH-----------
DNLJ_PORGI       -AAAKLLDSIEASKAR--PYQAILFGLGIRFVGETVAKKLA----AVYP-----------
DNLJ_GRAFK       -SAENLINGIERSKEI--PFERVLFALGIRYVGETVAKKLA----KHFK-----------
DNLJ_CYTH3       -SVTNVLNGIEASKQT--PFKSVLFAIGIRYVGSTVAEKLA----LHFK-----------
DNLJ_PELLD       -SAQNVVRALDESRSQ--SYARLLFALGIRHVGQATARELA----RAFP-----------
DNLJ_CHLPN       -SARNILESIEQAKHV--DLDRFLVALGIPLIGIGVATVLA----GHFE-----------
DNLJ_CHLMU       -SVHNLLASIAGAKEV--TLDRFLTALSIPFVGSSGAIALA----DHFG-----------
DNLJ_PARUW       -AIQNLMRSIEESKHV--SLERFIMALEIKYIGIGTAELLA----ARAG-----------
DNLJ_RHOMR       -RARNLLRAIEASKQR--PLSRLLFGLGIRHVGKTTAELLV----QRFA-----------
DNLJ_RUBXD       -SAQNLIRAIERSKER--PFDRVLFGLGIRHVGSATAELIA----ERFS-----------
DNLJ_ROSS1       -RVANLLSAIAGSKNR--PLHRLIVGLGIRYVGEVVAQILA----DHFG-----------
DNLJ_THEFI       -SAQNLLRQIEESKHR--GLERLLYALGLPGVGEVLARNLA----RRFG-----------
DNLJ_DEIRA       -KAGNILGQLEASKTK--PLWRLINALGMSHVGQRNAQALA----RAFG-----------
DNLJ_DEHMC       -SADNIIDAIADSKTR--PLDRVIFGLGVRHVGNETATLLS----RHYG-----------
DNLJ_DESAG       -LASNFIEAFDSARHES-TLQRFICALGIRHVGEQTARTLA----ARFG-----------
DNLJ1_DESVV      -SAANAIASLDAARTGA-TLARLICALGIRHVGEQTARTLA----THFV-----------
DNLJ_LAWIP       -LAAKTIQALSLAKQTM-SLHRLICALGIRHVGEQTARILA----SSFI-----------
DNLJ_RHOBA       --AESLVAGINESRTR--GLARVLSSISIRHIGPRVAKLIT-------------------
DNLJ2_STRCO      --TDNLLAALARAKEQ--PLSRVLCALGVRGTGRSMSRRIA-------------------
DNLJ1_NOCFA      --ATRMIESIDRSRDV--GLRRALIGLAIPMASEGTAARLAR------------------
DNLJ_PSYIN       --AQNLVEQLQVSRDVEIEDWRFLAAFGVSRLAGGNCEKLL-------------------
DNLJ_DESPS       --ATNMVEQLNRSREELIEDWRFLAAFGVHRLGMGNCEKLL-------------------
DNLJ_RUTMC       --SMNLINQLNRSVSEQVEDWRFLAAFGMHRMGLGNCENLL-------------------
DNLJ_VESOH       --SINLISQLSRSISEKIEDWRFLAAFGMHRMGLGNCENLL-------------------
DNLJ_DESAL       --SKNLAEAINLSKSRPVEDWRFLAAFGISDLGEGDSRKIL-------------------
                                        : .:     .                           

DNLJ_TREDE       --------------AGFNDLNELLGAS---------------------------------
DNLJ_TREPA       --------------AGFDTLEKVLHAT---------------------------------
DNLJ_THEFY       --------------RHFRSLDAIAQAS---------------------------------
DNLJ_FRACC       --------------RELRSLEAIAATS---------------------------------
DNLJ_SACEN       --------------REFGSLDRIQEAS---------------------------------
DNLJ_NOCSJ       --------------TEFGSMAAIRAAT---------------------------------
DNLJ_ARTS2       --------------TAFGSMDAIREAS---------------------------------
DNLJ_CUTAK       --------------THFGSVEAIREAS---------------------------------
DNLJ_CORJK       --------------KHFESVEDIASAS---------------------------------
DNLJ_LEIXX       --------------DHFGSLDAIRAAS---------------------------------
DNLJ_BIFLO       --------------SAMGSLAAIENAT---------------------------------
DNLJ_TROWT       --------------DHFGSIESIINAK---------------------------------
DNLJ_RHORT       --------------LLAGHYASFAAW----------------------------------
DNLJ_MAGSA       --------------RLARHYGSFGAW----------------------------------
DNLJ_CHESB       --------------TLARGYGSWKAF----------------------------------
DNLJ_BRADU       --------------ALARGYGSWEAF----------------------------------
DNLJ_RHILO       --------------VLAKTFSTIEEL----------------------------------
DNLJ_BARBK       --------------RLARAYQNYNAF----------------------------------
DNLJ_PARDP       --------------DLARHYGSWEALEIALDTARPAAL----------------------
DNLJ_MARMM       --------------LFARTYGSWAAF----------------------------------
DNLJ_HYPNA       --------------QFARSFLSWQSF----------------------------------
DNLJ_CAUVC       --------------VLARNFDRFEDL----------------------------------
DNLJ_SPHAL       --------------DLLKGIGDIARLPGKAAELRAWVE----------------------
DNLJ_ZYMMO       --------------DLAKSYQTWDNFKAAIDEAAHLRT----------------------
DNLJ_RHOPB       --------------ALVRHFADVKAFLDGVDAAALARPGPAWLDLKNVRYIGEITLERLL
DNLJ_GLUOX       --------------LLARHYQTFENW----------------------------------
DNLJ_PELPD       --------------ILADNYVSLDNW----------------------------------
DNLJ_RICTY       --------------LLAREFVSYNNF----------------------------------
DNLJ_ORITB       --------------LLAKEFKTAKNF----------------------------------
DNLJ_WOLTR       --------------LLANYYVSYNNW----------------------------------
DNLJ_EHRRW       --------------ILANHFISYKNW----------------------------------
DNLJ_ANAPZ       --------------LIAEHYRSYSAW----------------------------------
DNLJ_NEOSM       --------------MLAQQFKSFANW----------------------------------
DNLJ_PELUB       --------------LIARHLKTASNF----------------------------------
DNLJ_SPICI       --------------LLARQFKTIDNLAA--------------------------------
DNLJ_MESFL       --------------TLAQIYKNIDNLKN--------------------------------
DNLJ_UREPA       --------------KIAKQFKTMTALMH--------------------------------
DNLJ_MYCPE       --------------ALSKRFKSIEELAM--------------------------------
DNLJ_MYCPN       --------------SLTKHFENIDALQS--------------------------------
DNLJ_MYCGA       --------------SIANTYHDIDQLKN--------------------------------
DNLJ_MYCMO       --------------LIANEVKLLSNLIN--------------------------------
DNLJ_MYCS5       --------------LLTNKITKLSDLNN--------------------------------
DNLJ_MYCPU       --------------IFENDQKNLLSLLE--------------------------------
DNLJ_MYCH7       --------------ILSRYASNLSELRN--------------------------------
DNLJ_FUSNN       --------------ILAKASKNIDKLMA--------------------------------
DNLJ_LEPIC       --------------DSIDEILSIAKDQK--------------------------------
DNLJ_BORBU       --------------NSFSKLFKLCQDRY--------------------------------
DNLJ_ONYPE       -------------------FQTIENLQQ--------------------------------
DNLJ_NITSB       --------------KLCEKFGLDWYK----------------------------------
DNLJ_SULDN       --------------TLSAKFGSGFID----------------------------------
DNLJ_CAMHC       --------------KIAEIFGENWLN----------------------------------
DNLJ_CAMJJ       --------------KLSLSFGKEWHK----------------------------------
DNLJ_WOLSU       --------------KLSHAFGLAFHL----------------------------------
DNLJ_HELHP       --------------KLAQKFGLNVFE----------------------------------
DNLJ_HELAH       --------------TLA-KYGLYVLE----------------------------------
DNLJ_CLOTE       --------------DLVKSFKTLDNIKN--------------------------------
DNLJ1_CLOAB      --------------DLCKQFKSFENIKK--------------------------------
DNLJ_MARHV       ------------------TLEAISAAD---------------------------------
DNLJ_ALCBS       ------------------DLDSIRHAP---------------------------------
DNLJ_IDILO       ------------------NLDALIAAE---------------------------------
DNLJ_COLP3       ------------------TLAAIESAS---------------------------------
DNLJ_SHEAM       ------------------SLEAIRDAD---------------------------------
DNLJ_SACD2       ------------------TLNKVMDAT---------------------------------
DNLJ_CHRSD       ------------------SLQALSEAS---------------------------------
DNLJ_LEGPA       ------------------DVESLKSAT---------------------------------
DNLJ_MAGMM       ------------------SLDALMAAT---------------------------------
DNLJ_NITMU       ------------------GLDRLMDAD---------------------------------
DNLJ_JANMA       ------------------NLEALLQAS---------------------------------
DNLJ_METCA       ------------------SLEALMEAT---------------------------------
DNLJ_NITOC       ------------------SLEALASVS---------------------------------
DNLJ_COXBU       ------------------ELDLLMKAS---------------------------------
DNLJ_PSYCK       ------------------DLDALMSAS---------------------------------
DNLJ_HYDCU       ------------------DLNAIKQAE---------------------------------
DNLJ_FRATN       ------------------SLESFRDAK---------------------------------
DNLJ_DICNV       ------------------DLAAFMAAD---------------------------------
DNLJ_SODGM       ------------------TLDALIAAD---------------------------------
DNLJ_BAUCH       ------------------HIDALMAAD---------------------------------
DNLJ_BUCBP       ------------------TLDKFMNSS---------------------------------
DNLJ_BUCCC       ------------------SVEKFFNTN---------------------------------
DNLJ_BUCAI       ------------------KLDKLMNSN---------------------------------
DNLJ_WIGBR       ------------------NISNFINTS---------------------------------
DNLJ_BLOPB       ------------------TIENLAAAD---------------------------------
DNLJ_BLOFL       ------------------TIENLMNAD---------------------------------
DNLJ_BORA1       ------------------NIDAIMDAD---------------------------------
DNLJ_PSESM       ------------------SLDRVKQAL---------------------------------
DNLJ_RALSO       ------------------SLAIVRRAP---------------------------------
DNLJ_XYLFT       ------------------DLAIIRQLP---------------------------------
DNLJ_NEIG1       ------------------TLERVRRAP---------------------------------
DNLJ_BDEBA       ------------------TIDKFLEAS---------------------------------
DNLJ_GEOSL       ------------------SIENLERAT---------------------------------
DNLJ_PELCD       ------------------SLDALSHAT---------------------------------
DNLJ_SYNAS       ------------------TLDALINTT---------------------------------
DNLJ_SYNFM       ------------------TLDAVRRAS---------------------------------
DNLJ_MYXXD       ------------------RSEMLFEAS---------------------------------
DNLJ_ANADF       ------------------ELARFMDAS---------------------------------
DNLJ_HALHL       AALRAAAGLDAQTAITSEALLRVMAAP---------------------------------
DNLJ_NATPD       ------------------TLDAVMDAT---------------------------------
DNLJ_HALWD       ------------------NFDAIIDAD---------------------------------
DNLJ_SALRD       ------------------TLDALVDAD---------------------------------
DNLJ_LISW6       ------------------TMDNLKMAD---------------------------------
DNLJ_STAS1       ------------------TIDELFHVT---------------------------------
DNLJ_GEOSE       ------------------TMERLERAT---------------------------------
DNLJ_ENTFA       ------------------DLPTLSRAT---------------------------------
DNLJ_STRS2       ------------------DLETLAFAD---------------------------------
DNLJ_LACS1       ------------------SMDNLAKAK---------------------------------
DNLJ_LACPL       ------------------TIEALMAAS---------------------------------
DNLJ_OENOB       ------------------NLRNLQNAG---------------------------------
DNLJ_LEUMM       ------------------TLSAVSEAS---------------------------------
DNLJ_PEDPA       ------------------TMDNLMQTT---------------------------------
DNLJ_LACDB       ------------------NMSKIASAS---------------------------------
DNLJ_SYMTH       ------------------SMEAIEQAG---------------------------------
DNLJ_MOOTA       ------------------SLDKLAAAT---------------------------------
DNLJ_DESHY       ------------------TMEDLEKAQ---------------------------------
DNLJ_CARHZ       ------------------ELDKLIAAG---------------------------------
DNLJ_HUNT2       ------------------SLDALMNAS---------------------------------
DNLJ_CALS8       ------------------SIDDLFTIT---------------------------------
DNLJ_CALS4       ------------------SMDNIMKAK---------------------------------
DNLJ_CLOD6       ------------------DLDEVISAT---------------------------------
DNLJ_SYNWW       ------------------DIDDFYKLG---------------------------------
DNLJ_THEMA       ------------------SLEAIADAS---------------------------------
DNLJ_AQUAE       ------------------SVWDLKDIP---------------------------------
DNLJ_SOLUE       ------------------SMDAIERAT---------------------------------
DNLJ_KORVE       ------------------SLDGVMKAT---------------------------------
DNLJ_SYNE7       ------------------SAEALAQAT---------------------------------
DNLJ_SYNJA       ------------------APELLAQAR---------------------------------
DNLJ_SYNY3       ------------------TVEKLSQAS---------------------------------
DNLJ_GLOVI       ------------------SADALARAD---------------------------------
DNLJ_PROMT       ------------------SIEELNAIAKES------------------------------
DNLJ_PROMA       ------------------SISLLADAAIAS------------------------------
DNLJ_PARD8       ------------------SIEALEQAS---------------------------------
DNLJ_PORGI       ------------------SIDALAAAT---------------------------------
DNLJ_GRAFK       ------------------SIEALMAAS---------------------------------
DNLJ_CYTH3       ------------------SINALEKAS---------------------------------
DNLJ_PELLD       ------------------SIEALEAAS---------------------------------
DNLJ_CHLPN       ------------------TLDRVISAT---------------------------------
DNLJ_CHLMU       ------------------TLDKVMKAS---------------------------------
DNLJ_PARUW       ------------------TIETLMQLN---------------------------------
DNLJ_RHOMR       ------------------SIDELAAAT---------------------------------
DNLJ_RUBXD       ------------------GEELLRGVG---------------------------------
DNLJ_ROSS1       ------------------SLDALAAAS---------------------------------
DNLJ_THEFI       ------------------TMDRLLEAS---------------------------------
DNLJ_DEIRA       ------------------TLEGLLAAT---------------------------------
DNLJ_DEHMC       ------------------NIWALAKTG---------------------------------
DNLJ_DESAG       ------------------NMDELMRAD---------------------------------
DNLJ1_DESVV      ------------------DLDAMRKAD---------------------------------
DNLJ_LAWIP       ------------------DLDALSSAS---------------------------------
DNLJ_RHOBA       --------------AKFWNLDLLRSAK---------------------------------
DNLJ2_STRCO      --------------RYFATMDHIRAAD---------------------------------
DNLJ1_NOCFA      --------------AGFASLEEVADAG---------------------------------
DNLJ_PSYIN       ---------------QHHSLDSLFEATV--------------------------------
DNLJ_DESPS       ---------------RYVRLEDVFNLSE--------------------------------
DNLJ_RUTMC       ---------------KSHHLNDIFDLNL--------------------------------
DNLJ_VESOH       ---------------KSYRLNDIFDLTL--------------------------------
DNLJ_DESAL       ---------------SFFPLEELLDKTR--------------------------------
                                                                             

DNLJ_TREDE       ------------------------------------------------------------
DNLJ_TREPA       ------------------------------------------------------------
DNLJ_THEFY       ------------------------------------------------------------
DNLJ_FRACC       ------------------------------------------------------------
DNLJ_SACEN       ------------------------------------------------------------
DNLJ_NOCSJ       ------------------------------------------------------------
DNLJ_ARTS2       ------------------------------------------------------------
DNLJ_CUTAK       ------------------------------------------------------------
DNLJ_CORJK       ------------------------------------------------------------
DNLJ_LEIXX       ------------------------------------------------------------
DNLJ_BIFLO       ------------------------------------------------------------
DNLJ_TROWT       ------------------------------------------------------------
DNLJ_RHORT       --RKAMDEAQTEG-----------------------------------------------
DNLJ_MAGSA       --RAAMLAGTEE------------------------------------------------
DNLJ_CHESB       -HDSALAIAGGDL-----------------------------------------------
DNLJ_BRADU       -HDACLKVAKGDE-----------------------------------------------
DNLJ_RHILO       -IRVGKETAAAE------------------------------------------------
DNLJ_BARBK       -ETVAMTALMPCNKEDKG------------------------------------------
DNLJ_PARDP       AHRVAEDAALAEREAARAEGRRARPSEARAAALAQ-------------------------
DNLJ_MARMM       -HAAAANLS---------------------------------------------------
DNLJ_HYPNA       -WAAVKAAE---------------------------------------------------
DNLJ_CAUVC       -QAAAEAAARALPGETYLELSTAPGVGPKALDMLVEAGKGGVVADPWPQTDDLELKIGHA
DNLJ_SPHAL       ANPRIEGESEGK------------------------------------------------
DNLJ_ZYMMO       ILQPSSEESEEK------------------------------------------------
DNLJ_RHOPB       EIQGGADTNEERQGFQPDARQRASLLSHYGNEEKI-------------------------
DNLJ_GLUOX       --RTAMLAARPDS-----------------------------------------------
DNLJ_PELPD       -QSSMLKAAERES-----------------------------------------------
DNLJ_RICTY       -IAQMELLSKNDSD----------------------------------------------
DNLJ_ORITB       -IDQSLKLANNVTE----------------------------------------------
DNLJ_WOLTR       -YNSMIKLLSNDAEVGVG------------------------------------------
DNLJ_EHRRW       -YTEMLKLAQD-------------------------------------------------
DNLJ_ANAPZ       -VRAMTSLANG-------------------------------------------------
DNLJ_NEOSM       -FDKMSMLKDDTQT----------------------------------------------
DNLJ_PELUB       -FRLSGE--KN-------------------------------------------------
DNLJ_SPICI       ------------------------------------------------------------
DNLJ_MESFL       ------------------------------------------------------------
DNLJ_UREPA       ------------------------------------------------------------
DNLJ_MYCPE       ------------------------------------------------------------
DNLJ_MYCPN       ------------------------------------------------------------
DNLJ_MYCGA       ------------------------------------------------------------
DNLJ_MYCMO       ------------------------------------------------------------
DNLJ_MYCS5       ------------------------------------------------------------
DNLJ_MYCPU       ------------------------------------------------------------
DNLJ_MYCH7       ------------------------------------------------------------
DNLJ_FUSNN       ------------------------------------------------------------
DNLJ_LEPIC       ------------------------------------------------------------
DNLJ_BORBU       ------------------------------------------------------------
DNLJ_ONYPE       ------------------------------------------------------------
DNLJ_NITSB       ------------------------------------------------------------
DNLJ_SULDN       ------------------------------------------------------------
DNLJ_CAMHC       ------------------------------------------------------------
DNLJ_CAMJJ       ------------------------------------------------------------
DNLJ_WOLSU       ------------------------------------------------------------
DNLJ_HELHP       ------------------------------------------------------------
DNLJ_HELAH       ------------------------------------------------------------
DNLJ_CLOTE       ------------------------------------------------------------
DNLJ1_CLOAB      ------------------------------------------------------------
DNLJ_MARHV       ------------------------------------------------------------
DNLJ_ALCBS       ------------------------------------------------------------
DNLJ_IDILO       ------------------------------------------------------------
DNLJ_COLP3       ------------------------------------------------------------
DNLJ_SHEAM       ------------------------------------------------------------
DNLJ_SACD2       ------------------------------------------------------------
DNLJ_CHRSD       ------------------------------------------------------------
DNLJ_LEGPA       ------------------------------------------------------------
DNLJ_MAGMM       ------------------------------------------------------------
DNLJ_NITMU       ------------------------------------------------------------
DNLJ_JANMA       ------------------------------------------------------------
DNLJ_METCA       ------------------------------------------------------------
DNLJ_NITOC       ------------------------------------------------------------
DNLJ_COXBU       ------------------------------------------------------------
DNLJ_PSYCK       ------------------------------------------------------------
DNLJ_HYDCU       ------------------------------------------------------------
DNLJ_FRATN       ------------------------------------------------------------
DNLJ_DICNV       ------------------------------------------------------------
DNLJ_SODGM       ------------------------------------------------------------
DNLJ_BAUCH       ------------------------------------------------------------
DNLJ_BUCBP       ------------------------------------------------------------
DNLJ_BUCCC       ------------------------------------------------------------
DNLJ_BUCAI       ------------------------------------------------------------
DNLJ_WIGBR       ------------------------------------------------------------
DNLJ_BLOPB       ------------------------------------------------------------
DNLJ_BLOFL       ------------------------------------------------------------
DNLJ_BORA1       ------------------------------------------------------------
DNLJ_PSESM       ------------------------------------------------------------
DNLJ_RALSO       ------------------------------------------------------------
DNLJ_XYLFT       ------------------------------------------------------------
DNLJ_NEIG1       ------------------------------------------------------------
DNLJ_BDEBA       ------------------------------------------------------------
DNLJ_GEOSL       ------------------------------------------------------------
DNLJ_PELCD       ------------------------------------------------------------
DNLJ_SYNAS       ------------------------------------------------------------
DNLJ_SYNFM       ------------------------------------------------------------
DNLJ_MYXXD       ------------------------------------------------------------
DNLJ_ANADF       ------------------------------------------------------------
DNLJ_HALHL       ------------------------------------------------------------
DNLJ_NATPD       ------------------------------------------------------------
DNLJ_HALWD       ------------------------------------------------------------
DNLJ_SALRD       ------------------------------------------------------------
DNLJ_LISW6       ------------------------------------------------------------
DNLJ_STAS1       ------------------------------------------------------------
DNLJ_GEOSE       ------------------------------------------------------------
DNLJ_ENTFA       ------------------------------------------------------------
DNLJ_STRS2       ------------------------------------------------------------
DNLJ_LACS1       ------------------------------------------------------------
DNLJ_LACPL       ------------------------------------------------------------
DNLJ_OENOB       ------------------------------------------------------------
DNLJ_LEUMM       ------------------------------------------------------------
DNLJ_PEDPA       ------------------------------------------------------------
DNLJ_LACDB       ------------------------------------------------------------
DNLJ_SYMTH       ------------------------------------------------------------
DNLJ_MOOTA       ------------------------------------------------------------
DNLJ_DESHY       ------------------------------------------------------------
DNLJ_CARHZ       ------------------------------------------------------------
DNLJ_HUNT2       ------------------------------------------------------------
DNLJ_CALS8       ------------------------------------------------------------
DNLJ_CALS4       ------------------------------------------------------------
DNLJ_CLOD6       ------------------------------------------------------------
DNLJ_SYNWW       ------------------------------------------------------------
DNLJ_THEMA       ------------------------------------------------------------
DNLJ_AQUAE       ------------------------------------------------------------
DNLJ_SOLUE       ------------------------------------------------------------
DNLJ_KORVE       ------------------------------------------------------------
DNLJ_SYNE7       ------------------------------------------------------------
DNLJ_SYNJA       ------------------------------------------------------------
DNLJ_SYNY3       ------------------------------------------------------------
DNLJ_GLOVI       ------------------------------------------------------------
DNLJ_PROMT       ------------------------------------------------------------
DNLJ_PROMA       ------------------------------------------------------------
DNLJ_PARD8       ------------------------------------------------------------
DNLJ_PORGI       ------------------------------------------------------------
DNLJ_GRAFK       ------------------------------------------------------------
DNLJ_CYTH3       ------------------------------------------------------------
DNLJ_PELLD       ------------------------------------------------------------
DNLJ_CHLPN       ------------------------------------------------------------
DNLJ_CHLMU       ------------------------------------------------------------
DNLJ_PARUW       ------------------------------------------------------------
DNLJ_RHOMR       ------------------------------------------------------------
DNLJ_RUBXD       ------------------------------------------------------------
DNLJ_ROSS1       ------------------------------------------------------------
DNLJ_THEFI       ------------------------------------------------------------
DNLJ_DEIRA       ------------------------------------------------------------
DNLJ_DEHMC       ------------------------------------------------------------
DNLJ_DESAG       ------------------------------------------------------------
DNLJ1_DESVV      ------------------------------------------------------------
DNLJ_LAWIP       ------------------------------------------------------------
DNLJ_RHOBA       ------------------------------------------------------------
DNLJ2_STRCO      ------------------------------------------------------------
DNLJ1_NOCFA      ------------------------------------------------------------
DNLJ_PSYIN       ------------------------------------------------------------
DNLJ_DESPS       ------------------------------------------------------------
DNLJ_RUTMC       ------------------------------------------------------------
DNLJ_VESOH       ------------------------------------------------------------
DNLJ_DESAL       ------------------------------------------------------------
                                                                             

DNLJ_TREDE       -------------------------------------EADFANVYQFGQVLSHTLVTNLS
DNLJ_TREPA       -------------------------------------TETLESIYQFGTELAKSVVTGIA
DNLJ_THEFY       -------------------------------------EEELEAVEGIGPTIARSIVDWFS
DNLJ_FRACC       -------------------------------------AEDLAAVEGVGPKIAGAVLDWFA
DNLJ_SACEN       -------------------------------------EEELAAGEGVGPTIATAVREWFD
DNLJ_NOCSJ       -------------------------------------EEQLAAAEGVGPTIAEAVIEWFK
DNLJ_ARTS2       -------------------------------------EEELAHVDGVGPVIAAALKEWFA
DNLJ_CUTAK       -------------------------------------VEELAGVDGVGEIIAESVKRWFE
DNLJ_CORJK       -------------------------------------AEEMAGIDGVAETIAESISDWFT
DNLJ_LEIXX       -------------------------------------RDELAAVDGVGGIVADAVLSWFE
DNLJ_BIFLO       -------------------------------------IEDLTAIDGVGPEIAESVVNWFA
DNLJ_TROWT       -------------------------------------IDELLKVRSLGETIAISVHDWFR
DNLJ_RHORT       ----------------------------------SEAFADLQNIESIGPSVARDLVAFFG
DNLJ_MAGSA       ------------------------------------ARAELTSIEDIGPSVAGDLLDFFS
DNLJ_CHESB       -----------------------------------SAREEMDALEDIGDAVIDAIATYFA
DNLJ_BRADU       -----------------------------------EAMADMDALDQIGDTVIKSIADYFG
DNLJ_RHILO       -----------------------------------DPHTVFPSVNGIGDTVIDALCDFFG
DNLJ_BARBK       ----------------------------------NEEWLELTSIEGIGVRVGKAIIDFYQ
DNLJ_PARDP       ---------------------------VDLSPEATAAWTGLIAADGIGPVLAMSLSDAFA
DNLJ_MARMM       -----------------------------DEAVRAE----MLGIDGIGNAAVEALEQYFT
DNLJ_HYPNA       -----------------------------EGGIESEAYNELIGIDGIGQAAARSLMAFEG
DNLJ_CAUVC       VPKLTKPARAALAQRYGTWDAFADGLVAAASGAPGDDYLHLAAIDGVGPVAAQSLARFFA
DNLJ_SPHAL       --------------------------YAARRLEAIKAILDVR-ADGIGPAVAEALGDFFH
DNLJ_ZYMMO       --------------------------YQKRVDKELISFFHI---PNMGGKIIRSLLDFFA
DNLJ_RHOPB       ----------------------AGALQAARSEAPGPAFQQLANDSEIGEVATQSLIDFFE
DNLJ_GLUOX       -----------------------------------EERASLGAIMGVGDAIADELSAFFS
DNLJ_PELPD       -----------------------------------ECYQHLISIDGIGSVVADEIVSFFA
DNLJ_RICTY       ------------------------------------VYQKLNDLEGIGDKMLVDIIDFFY
DNLJ_ORITB       ------------------------------------IYEKLCNIEGLGVKTADQLKQFFM
DNLJ_WOLTR       ---------------------------GVEKKIAKSFSDELVGIDGIGEKVAESLKSFFS
DNLJ_EHRRW       -------------------------------------VNYTINIQQVGLKTINSLRTFFI
DNLJ_ANAPZ       --------------------------------------EDPDNIHGIGLKSIESLRAFFS
DNLJ_NEOSM       -------------------------------------EDEIRNLDGMGSCICESLLDFFS
DNLJ_PELUB       -------------------------------------IESLSNIDGIGITQIQSIKKFFL
DNLJ_SPICI       -----------------------------------MNIEQLSIINDIGPIVAASVVDYFA
DNLJ_MESFL       -----------------------------------ATYEELSSIDSVGEVLAMSIVDWFK
DNLJ_UREPA       -----------------------------------ANFDELTNVDACGEKAALSLINWFN
DNLJ_MYCPE       -----------------------------------ATREEIEQVPDTGEKMSESLVNWFS
DNLJ_MYCPN       -----------------------------------ASMETLLELPDVGPTVAESLFNWFH
DNLJ_MYCGA       -----------------------------------LTVEDYMRLADISSITANSLFSFFS
DNLJ_MYCMO       -----------------------------------FDFEKLNNIRDISCKTINSLKCFFS
DNLJ_MYCS5       -----------------------------------LTDEDLLSIDTFGEKSIENLKEFLS
DNLJ_MYCPU       -----------------------------------FNYDELEKYDEFGSVKIESLKEFFA
DNLJ_MYCH7       -----------------------------------LDFNLLKNQHDFGPVIIESLIDYFN
DNLJ_FUSNN       -----------------------------------MTFEDLTSIEGIGEIAANEIIAFFT
DNLJ_LEPIC       ------------------------------------KIESLLEIPGIGPSTIQAFQENFS
DNLJ_BORBU       -----------------------------------FAFSTLLKIKGIGEKIALNIIEAFN
DNLJ_ONYPE       -----------------------------------ATPELITQIREIGIKIAQSIQQYFS
DNLJ_NITSB       -----------------------------------APKEKLYEIEGFGPEMVRSIEEFVE
DNLJ_SULDN       -----------------------------------ATKDEIVACDGVGEEMAESLLEFIR
DNLJ_CAMHC       -----------------------------------ASFDEILKIDGFGEAMAKSFVGFCE
DNLJ_CAMJJ       -----------------------------------QSFEAYANLEGFGEQMALSLCEFTR
DNLJ_WOLSU       -----------------------------------QNHEAIIGLEGFGEEMAQSLLEFCR
DNLJ_HELHP       -----------------------------------LELSEILSVDGFGEEMAYSLVEFNH
DNLJ_HELAH       -----------------------------------KSEDEFLEMEGFGVEMARSLVNFYA
DNLJ_CLOTE       -----------------------------------ATIEELTSVKDIGEIVANSVIEFFK
DNLJ1_CLOAB      -----------------------------------ASYFELILVQDIGSIVAKSIVDFFK
DNLJ_MARHV       -------------------------------------EETLQTVPDVGPIVAGHIRSFFD
DNLJ_ALCBS       -------------------------------------LLLLLAVPDVGLEVAKAIGAFFA
DNLJ_IDILO       -------------------------------------SEQLQEVPDVGAVVAKHIVAFFH
DNLJ_COLP3       -------------------------------------LEDLQNVSDVGEVVAKNIINFFK
DNLJ_SHEAM       -------------------------------------VDALIQVEDVGTVVAQHVAHFFA
DNLJ_SACD2       -------------------------------------QEQLIEVTDVGPVVAHYVVDFFA
DNLJ_CHRSD       -------------------------------------LEALEAVEDVGPVVARHIHTFFR
DNLJ_LEGPA       -------------------------------------IEELMTLNDIGPVAASHVVHFFA
DNLJ_MAGMM       -------------------------------------VEDLVGIEDVGEVVARRVVHFFA
DNLJ_NITMU       -------------------------------------VETLQQVSDVGPVVAQSIADFFG
DNLJ_JANMA       -------------------------------------EEQLLEVADIGPVVAQSIRSFLS
DNLJ_METCA       -------------------------------------EEELLAVADVGPVVSRHIRLFFA
DNLJ_NITOC       -------------------------------------EERLQQVTDIGPIVAAHIAAFFR
DNLJ_COXBU       -------------------------------------IETLQEIRDIGPVAAENIHAFFH
DNLJ_PSYCK       -------------------------------------IEKLLLTPDVGAITAELTYKFFR
DNLJ_HYDCU       -------------------------------------FEELITLNDVGEVVAEHIVNFFK
DNLJ_FRATN       -------------------------------------FEELIEINDIGEIMANNIVSFWH
DNLJ_DICNV       -------------------------------------RAALQEIEGIGDVVAADIEHFFA
DNLJ_SODGM       -------------------------------------IDSLTGVQDIGNIVATHVRHFFE
DNLJ_BAUCH       -------------------------------------IESLTKIQDIGIIVATNVLNFFH
DNLJ_BUCBP       -------------------------------------KEEFLLINGIGVNIADNLYNFIN
DNLJ_BUCCC       -------------------------------------YDTLSKIDHIGYNISNAIISFLK
DNLJ_BUCAI       -------------------------------------ILELNCISGVGKIISNNIFNYFS
DNLJ_WIGBR       -------------------------------------YEDLRSIKGIGSFTSNCIKKFLK
DNLJ_BLOPB       -------------------------------------LQSLSNLKYVGPIIANNIYHFFR
DNLJ_BLOFL       -------------------------------------LQSFLQLKFIGKIAAMNIYSFLH
DNLJ_BORA1       -------------------------------------EAALLAVPDVGPVVAGSIHRFFQ
DNLJ_PSESM       -------------------------------------PEVLTYLPDVGLEVAYEIHSFFE
DNLJ_RALSO       -------------------------------------APLLLTLPDVGATVAEAIADFFA
DNLJ_XYLFT       -------------------------------------WPLFKCVPDIGGEVARAIGHFMD
DNLJ_NEIG1       -------------------------------------EPVLACLPDIGTVVARSIAHFFA
DNLJ_BDEBA       -------------------------------------EEELLQVPEIGAKVAKSIRDWTG
DNLJ_GEOSL       -------------------------------------EEELLSIREVGPQVARSIITFFR
DNLJ_PELCD       -------------------------------------REELLAIHEIGPQVADSVTDFFA
DNLJ_SYNAS       -------------------------------------ENELLAIRDIGPEVSSSILEFFR
DNLJ_SYNFM       -------------------------------------VEELMSVNGVGEVVARSVVHYFS
DNLJ_MYXXD       -------------------------------------LEDISRVKDVGPIMAQVIHTFFQ
DNLJ_ANADF       -------------------------------------EDALLAVRDVGPETAREIRAWTE
DNLJ_HALHL       -------------------------------------ADDLEAIEDVGPVVARAIAGFFA
DNLJ_NATPD       -------------------------------------AEELRAVDGIGPTLGGEIAEFFD
DNLJ_HALWD       -------------------------------------EAALREIEDIGPTVSTHISEFFT
DNLJ_SALRD       -------------------------------------EDALTTIDDIGPEVAHSIATFFA
DNLJ_LISW6       -------------------------------------KETLTSINDIGEKMADSIVTYFA
DNLJ_STAS1       -------------------------------------EEALMDIHDVGHKLAQSVVTYLE
DNLJ_GEOSE       -------------------------------------KEELMAVPEIGEKMADAITAFFA
DNLJ_ENTFA       -------------------------------------AEEIVALDSIGETIADSVVTYFE
DNLJ_STRS2       -------------------------------------QEAIASLEGLGQVIAKSLTTFFA
DNLJ_LACS1       -------------------------------------SDEISTIDSLGKIIGDSVEMYFA
DNLJ_LACPL       -------------------------------------QEEIAAIDSMGDVIANAVVQYFE
DNLJ_OENOB       -------------------------------------AEEIAEIDGVGQVMADAIRQYFN
DNLJ_LEUMM       -------------------------------------VEDIANINGIGHTIAQSIVQYFS
DNLJ_PEDPA       -------------------------------------IEEFDAVDTIGETLANNLATFFQ
DNLJ_LACDB       -------------------------------------VQELTAIDTIGMTIAESLTTYFQ
DNLJ_SYMTH       -------------------------------------LDELTAIPGLGPKIAESVKNYFA
DNLJ_MOOTA       -------------------------------------VEELTALPDIGPRIAENIREFFG
DNLJ_DESHY       -------------------------------------VEELQEIPDVGPAMAQSVAQFFQ
DNLJ_CARHZ       -------------------------------------EEEIMAIPSVGPKMAASIKAFFA
DNLJ_HUNT2       -------------------------------------AEDIMAIPEFGEKMAKSVEQFFR
DNLJ_CALS8       -------------------------------------EEELLKLPDFGEKMAKSVVTFFR
DNLJ_CALS4       -------------------------------------YEDFLELPDIGPKMARSIVTFFS
DNLJ_CLOD6       -------------------------------------SEQLEELEEFGSIMANSVVEFFK
DNLJ_SYNWW       -------------------------------------VENLTSIPEIGPKMAESMVNFFA
DNLJ_THEMA       -------------------------------------YETLKDIPGIGPEIAKSIVEYFR
DNLJ_AQUAE       -------------------------------------LEKLMRLEGIGYKVARSIKEFFN
DNLJ_SOLUE       -------------------------------------VDELQQAEEVGPKVAEAVVQFFS
DNLJ_KORVE       -------------------------------------EEELLEVEEVGPRIAQSIHEFFA
DNLJ_SYNE7       -------------------------------------PDELAAVYGIGSEIADAVHQWFT
DNLJ_SYNJA       -------------------------------------AEDIAQIYGIGAEIAEAVVAWFA
DNLJ_SYNY3       -------------------------------------IPDLEGVYGIGPEIAEAVVNWFR
DNLJ_GLOVI       -------------------------------------LAAIASLYGFGEELARSVVEWFA
DNLJ_PROMT       -------------------------------------PEKISNIYGFGNEMKDAIVKWFD
DNLJ_PROMA       -------------------------------------PESISNIYGIGSEITESLHKWFN
DNLJ_PARD8       -------------------------------------LEDLVAVDEIGERIAQSVLSYFS
DNLJ_PORGI       -------------------------------------SEELVQIDEIGERIAAAVLHFFS
DNLJ_GRAFK       -------------------------------------EEELVNIDEIGERIAWSVVEFFN
DNLJ_CYTH3       -------------------------------------IEELLQAPEIGIKIAQSIIEWFS
DNLJ_PELLD       -------------------------------------EEELADVADIGPVIARSIREWFE
DNLJ_CHLPN       -------------------------------------FEELLSLEGIGEKVAHAIAEYFS
DNLJ_CHLMU       -------------------------------------LDELLSIEGIGQKVAASIIDFFS
DNLJ_PARUW       -------------------------------------EEDLIKIEGVGGKVAQAVVEHFQ
DNLJ_RHOMR       -------------------------------------IDELAALEGVGPITAESIANWFR
DNLJ_RUBXD       -------------------------------------VEELTQIEGVGEIVARAVVEYFS
DNLJ_ROSS1       -------------------------------------ADEIDALEGIGPAIAASVAAYFA
DNLJ_THEFI       -------------------------------------LEELLEVEEVGELTARAILETLK
DNLJ_DEIRA       -------------------------------------PEQIEAVPGLGGIIAQSVTASLA
DNLJ_DEHMC       -------------------------------------LGELQTIPDIGDKIASSIVAYFS
DNLJ_DESAG       -------------------------------------QETLQSLRDIGGEVAGSIRAFFA
DNLJ1_DESVV      -------------------------------------GEKLLHLPDIGPEVAASIRCFFD
DNLJ_LAWIP       -------------------------------------LEDLQQLSEIGPEVASSIQAFFK
DNLJ_RHOBA       -------------------------------------AEDLAAIHEIGDRIAESLVKFIH
DNLJ2_STRCO      -------------------------------------AEAMQRVDGIGVEKAPSVVAEIA
DNLJ1_NOCFA      -------------------------------------EERLVAVEDIGPKVAASLVEHLT
DNLJ_PSYIN       -------------------------------------EDLV-QLDGFAQVSADAIVEGLA
DNLJ_DESPS       -------------------------------------EQIVAEIKGFQEKTAHSICAGLA
DNLJ_RUTMC       -------------------------------------KEIA-NIDGFAELTGQIIVQGLI
DNLJ_VESOH       -------------------------------------EQIT-NIDGFAELTAQVIVQGLV
DNLJ_DESAL       -------------------------------------DDIV-ALHGFGDVTSISIEKGLK
                                                                             

DNLJ_TREDE       ILK-------DEMTGLIDKGYIKIKPPLTSE-----------------------------
DNLJ_TREPA       RVK-------DDMCELLDRGFVRILAKQQAESPLRGKSFCFSGSLRNGDRATIHRIRALG
DNLJ_THEFY       VD-----WHREIVEKWRAAGVRMEEEG---------------------------------
DNLJ_FRACC       DE-----RHRDILARIAAGGARLADVG---------------------------------
DNLJ_SACEN       VD-----WHREIVRKWSEAGVRMADER---------------------------------
DNLJ_NOCSJ       EP-----WHVEIVDKWERAGVTMADER---------------------------------
DNLJ_ARTS2       ED-----WHREIVDTWAEDGVRMEDEQ---------------------------------
DNLJ_CUTAK       VD-----WHQEIISRWAAAGVRMADDR---------------------------------
DNLJ_CORJK       VD-----WHRRIVDRWAAAGVRMRREAGNVPGAA--------------------------
DNLJ_LEIXX       IG-----WHCEIVENWARDGVQFAIPGHPGPGR---------------------------
DNLJ_BIFLO       ATREPGDWRGATLRAWQAAGVGVDEAE---------------------------------
DNLJ_TROWT       DP-----WRVELVNTWRSDGALFGH-----------------------------------
DNLJ_RHORT       EEH-----NRAALDALIDAGVEV----LDFARPQAA------------------------
DNLJ_MAGSA       EEH-----NVQAVDDLVAAMAALDG-AVEDAKVIES------------------------
DNLJ_CHESB       EEH-----NCRLVEALAAQVNVL------EAERPVA------------------------
DNLJ_BRADU       ESH-----NRGIVERLTKEVEIV------DAEKPKS------------------------
DNLJ_RHILO       NER-----NDDVLDKLLEQVKPK------PYIVTVS------------------------
DNLJ_BARBK       ETH-----NRDVLSSLLQEVTPL------PEEAAVA------------------------
DNLJ_PARDP       NER-----ERAAIDRLVSFLTVL------PPEARAT------------------------
DNLJ_MARMM       EAH-----NRDLLDRLVAQLTIE------DAEAIAN------------------------
DNLJ_HYPNA       EPH-----NREMLAALLEEVEVE------DEIPAET------------------------
DNLJ_CAUVC       EDH-----NRQKVANLVAELDIQ------PVAKPKT------------------------
DNLJ_SPHAL       EPH-----NRVLWDDLLSEVSPP-------PYVVET------------------------
DNLJ_ZYMMO       ETH-----NSDVVSDLLQEVQIE-------PLYFEL------------------------
DNLJ_RHOPB       ETN-----NRQVVTALMDQVQVE-------RPAAAS------------------------
DNLJ_GLUOX       ESH-----NIETLDDLALELKDI-------IAEEAP------------------------
DNLJ_PELPD       EAH-----NIQVLDSLKNYLSVE------DFTKPAI------------------------
DNLJ_RICTY       VKE-----NIQLIKKLGAVLNIE------DYKETR-------------------------
DNLJ_ORITB       VSA-----NVNLITKLVNILTIQ------DWQYHG-------------------------
DNLJ_WOLTR       KEH-----NIKMLKDLTDYLQIL------SVNSNS-------------------------
DNLJ_EHRRW       EQH-----NLNMINNLVEHLTII------DAQSNS-------------------------
DNLJ_ANAPZ       SED-----NLRVLQTLEEKLNIL------NEIANTE------------------------
DNLJ_NEOSM       DSD-----NCNMVKSLSNHVMIT------DHTVNI-------------------------
DNLJ_PELUB       NKT-----NLKVLSELEKNLLIK------DVILIN-------------------------
DNLJ_SPICI       IPA-----NQQELALLRQNGVKM-----EYFATNQH------------------------
DNLJ_MESFL       IES-----NLQLINELKSFDVNF-----EYLGQAKN------------------------
DNLJ_UREPA       DEH-----NVSLVNQLQQVGVNMEYIDDFIYDDNIN------------------------
DNLJ_MYCPE       DPK-----NQDLLWRAKKVGINFNYINEFNDVVVKN------------------------
DNLJ_MYCPN       NDN-----NLQLLAALKAVGVQM---DALKSNTNFD------------------------
DNLJ_MYCGA       DEK-----NWELIEQLKTLSINT---KDEINNDLVD------------------------
DNLJ_MYCMO       DEN-----EIEEIKIILELGLDF------KNLENEF------------------------
DNLJ_MYCS5       SE------KNQDLIKFLDENLNY------LNSK---------------------------
DNLJ_MYCPU       NDE-----NRNLIQFLDQNGFEL------KMEKEII------------------------
DNLJ_MYCH7       NQK-----NSEQLNCLETVGFNF------KTTFLTN------------------------
DNLJ_FUSNN       KEK-----NQKIIQGLKEKGLKFEIK--ESEASVQN------------------------
DNLJ_LEPIC       DKR-----ILKLIERLKKAGLKM----KADPIQV-A------------------------
DNLJ_BORBU       DSV-----MLNKFKFFENLEFKM----EEVVAID-G------------------------
DNLJ_ONYPE       NSC-----NLEEVSKLKTLGVSF----QSTNPQNPT------------------------
DNLJ_NITSB       VNK-----EKIEKLIELLQPTEPKK-----EEEV--------------------------
DNLJ_SULDN       VNR-----ETILKLQNILKPLEPLQ-----RQEA--------------------------
DNLJ_CAMHC       INR-----EKIENLLSFLH-LSAQK-----TEI---------------------------
DNLJ_CAMJJ       VNH-----VRIDEFYKLLN-LKIEK-----LEIK--------------------------
DNLJ_WOLSU       VNH-----ERIEHLLGLIEPLAPIQ-----LTPQ--------------------------
DNLJ_HELHP       ANK-----TLIAELLCIIKPKVELL-----EIDN--------------------------
DNLJ_HELAH       SNQ-----EFIQSLFDLLNPKNSDI-----IEEKQE------------------------
DNLJ_CLOTE       QEN-----INESIKELLELGVTPIM-----DITEIK------------------------
DNLJ1_CLOAB      QEK-----IEKSLNELFKLGVKPSY-----EESEVS------------------------
DNLJ_MARHV       QPH-----NQETLAALKEAGVTWQE-EQVLSAD---------------------------
DNLJ_ALCBS       ESD-----NEAVIDGLLAQGVSPQA-SGVPSAAFVKSLTLAQLLKSAKRLGMNLEGIGDK
DNLJ_IDILO       EAH-----NQQVVAELREF-ISWPEGEEASSVQ---------------------------
DNLJ_COLP3       EEH-----NLAIVSGLSEV-MHWPT-IEIKSAE---------------------------
DNLJ_SHEAM       QPH-----NLEVIDALIAAGVNWPA-IEKPSAD---------------------------
DNLJ_SACD2       QAN-----NREVIEKLIAAGVNWPDIEKVDGVK---------------------------
DNLJ_CHRSD       QPH-----NQETLEDLQGVGVTWEEVEIAGRPQ---------------------------
DNLJ_LEGPA       QAH-----NLEVIDRLLELGIHWP-KPEKIQVN---------------------------
DNLJ_MAGMM       QAH-----HGAELAALRALGVAAAGEPWRVEPDGHGV-----------------------
DNLJ_NITMU       ERH-----NREVVEQLRAAGIRWKEGAGTQTTDHAAG-----------------------
DNLJ_JANMA       DPL-----NMELIEQLQAAGVRWPEHVVENK-----------------------------
DNLJ_METCA       QPH-----NREVISQLLACGVSWEKPAPAPR-----------------------------
DNLJ_NITOC       QPH-----NRQIIQGLQKAGVCWPEVEDKVQI----------------------------
DNLJ_COXBU       QKN-----NAELINKLIHLGVHWPQEKAVVKSE---------------------------
DNLJ_PSYCK       APH-----NIEVINALREAGVHWDKVEQVASEG---------------------------
DNLJ_HYDCU       EPH-----NESVIQGLLDAGMHWPTPETTLVNE---------------------------
DNLJ_FRATN       DSL-----NIKIVEELLAIGIKIQNPVKVEHAY---------------------------
DNLJ_DICNV       DED-----NRAVIAAIVAAGVHWSTELTKKII----------------------------
DNLJ_SODGM       ETH-----NIEVIQDLLSPAIGIRWPEPVAAPVAASD-----------------------
DNLJ_BAUCH       NKH-----NIAIIEELCSPKIGIKFLSTLE-----KN-----------------------
DNLJ_BUCBP       DEF-----NKNIIFKLSKKLNISSDINAIID-NNN-------------------------
DNLJ_BUCCC       NKS-----NRSIILKLIRILNIFI------------------------------------
DNLJ_BUCAI       TIS-----NREMVVKLIKQAGIFLNDQEIHK-INSEK-----------------------
DNLJ_WIGBR       DKR-----NISIISDLLNVNLKIK------------------------------------
DNLJ_BLOPB       NPD-----NLKNVQDLIDPAIGIQLYVIT-------------------------------
DNLJ_BLOFL       QSD-----NYNNIQGLIRSNLIFK------------------------------------
DNLJ_BORA1       EAH-----NREVIR--------ELEKQG-----------------------VHPQAEAQL
DNLJ_PSESM       DEH-----NRNVIDALLGECGLQLQDQGELGAEFAASTTLEGLIDKLHIPSVGPGAAQKL
DNLJ_RALSO       EPK-----NQQALDALL-TAGVAPQGEHPPSAKLRDQLEPAELYAALGVPKLTAIRSKQL
DNLJ_XYLFT       QPA-----NQQAIDDLV-ERGVRITDAHPPTSTLRDQLTLASLLEHLEIPKITPLRAVQL
DNLJ_NEIG1       QAE-----QQAMIDELL-AAGVAPQ-AQAVSLPAAQYAGPQRWITRLPGFKISENK----
DNLJ_BDEBA       NPK-----LVDEVKAMIELGVKIAGPVRAQEGS---------------------------
DNLJ_GEOSL       NEG-----NRETIRRMFKAGVRPTAEE-KKVG----------------------------
DNLJ_PELCD       KSR-----NREILAALQRAGVAPQAEE-KRSG----------------------------
DNLJ_SYNAS       NAS-----NRRVIEKLKKAGVSPLETI-SPRS----------------------------
DNLJ_SYNFM       LPA-----NRTLVESLLSAGLEMAATE-PEAGPV--------------------------
DNLJ_MYXXD       EPQ-----NQEAIRALLAAGVQPA----APQVAT--------------------------
DNLJ_ANADF       EPQ-----NRRVVERLLAAGVRPA----PETVDA--------------------------
DNLJ_HALHL       EPH-----NRQVVDHLCAAGVHWPEPDPPEQAES--------------------------
DNLJ_NATPD       SDR-----NQQVIEQLRKRGVDPE-----PAETA--------------------------
DNLJ_HALWD       NEQ-----NRAAIDNLLSAGVTPQTQ--QSTATT--------------------------
DNLJ_SALRD       DDA-----NRGVIDEMRDAGLTLT----NPYAED--------------------------
DNLJ_LISW6       NEE-----VHDLLEELKRAGVNMTYTGPKL------------------------------
DNLJ_STAS1       NED-----IRALIDKLKAKNVNMIYKGVKT------------------------------
DNLJ_GEOSE       QPE-----ATELLQELRAYGVNMAYKGPKR------------------------------
DNLJ_ENTFA       NEE-----VHELMAELEKAQVNLTYKGLRT------------------------------
DNLJ_STRS2       SEG-----AQQLLAELKEAKVNLTYLG---------------------------------
DNLJ_LACS1       DEH-----VMELLDELRQAGVNLEFLGKTREE----------------------------
DNLJ_LACPL       SDE-----VHTLIRELQAVNVNTTYQGPS--A----------------------------
DNLJ_OENOB       SES-----VASLINELENFQVNFDYLTTS-------------------------------
DNLJ_LEUMM       TPE-----SKQLLVELASSGVNQSYLSDT-------------------------------
DNLJ_PEDPA       SDV-----AQNMIDELKAVGVNMEYLGVKP------------------------------
DNLJ_LACDB       QEE-----AKKLLARLEEAGVNMDYLG-ED------------------------------
DNLJ_SYMTH       SPR-----SHQLLAKLRAAGVNMVGEKK--------------------------------
DNLJ_MOOTA       EPR-----NRAVLEKLKKAGVRLEAL----------------------------------
DNLJ_DESHY       QES-----THHFLNKLRQAGVVMSAQ----------------------------------
DNLJ_CARHZ       QKE-----NLELIEKLKAAGVNTKYL----------------------------------
DNLJ_HUNT2       QKQ-----NRDTVEKLKAAGVNTVSF----------------------------------
DNLJ_CALS8       QDQ-----TKHLIERLKKAGVNTVA-----------------------------------
DNLJ_CALS4       EEQ-----NRRVVERLKEAGVNMEKL----------------------------------
DNLJ_CLOD6       EDK-----NMNVINKLKNVGVNTKSLD---------------------------------
DNLJ_SYNWW       EPR-----NRETIEDLKDLGVNTREE----------------------------------
DNLJ_THEMA       NPK-----TREIIEKLKKAGVKLEEK----------------------------------
DNLJ_AQUAE       IPQ-----NLEVLKKLEKAGVNLAKK----------------------------------
DNLJ_SOLUE       IPD-----NRELVDRLRKADLQFTYAYS--------------------------------
DNLJ_KORVE       EPS-----NRELVKRLEAAGLQFKGVK---------------------------------
DNLJ_SYNE7       VAT-----NQNLIAALEQAGL-QLHGEAASPRS---------------------------
DNLJ_SYNJA       DPA-----HQKLLQELRELGIPALPRQAAPAVS---------------------------
DNLJ_SYNY3       NPG-----NQQLIQDLEELGLVLANQGIDQTKT---------------------------
DNLJ_GLOVI       QAE-----NRALLERLKAHGLQLAGGGRAAQSS---------------------------
DNLJ_PROMT       DSN-----NQTLIKELKAIGFSLKESLDSNYNS---------------------------
DNLJ_PROMA       CSI-----NQNLIKELKDLGIALERVNEEGAID---------------------------
DNLJ_PARD8       DEK-----NRTLVNRLKEQGLRMAVSEEQLAN----------------------------
DNLJ_PORGI       LRQ-----NRELIERLRLAGVSLEAETVSVA-----------------------------
DNLJ_GRAFK       IEA-----NRENVERLKEYGIQLEISAEKLAN----------------------------
DNLJ_CYTH3       VDT-----NVQLIEDLKKAGVKLELSEHEILKP---------------------------
DNLJ_PELLD       APA-----VSALLEKLRDARLPLAAEDPKPLI----------------------------
DNLJ_CHLPN       DST-----HLNEIKKMQDLGVCISPYHKSG------------------------------
DNLJ_CHLMU       KTE-----NVEEICRMQELGVRILPKQVDRW-----------------------------
DNLJ_PARUW       NPK-----HRQEVYRLLELGVCPQSKTVQIFT----------------------------
DNLJ_RHOMR       VED-----NRRLIEELKELGVNTQRLPEEAP-----------------------------
DNLJ_RUBXD       LEE-----NRKLVRRLMEHGLNFG--PVRGK-----------------------------
DNLJ_ROSS1       RPE-----SKALIAKLKRAGVRTEAQETARA-----------------------------
DNLJ_THEFI       DPA-----FRDLVRRLKEAGVSME---SKE------------------------------
DNLJ_DEIRA       DPA-----MRDLIARLQASGVAPQ---AEEV-----------------------------
DNLJ_DEHMC       EEK-----NVAVIRRLEEAGVRLTS-DQKPV-----------------------------
DNLJ_DESAG       NGQ-----NRELLQQFKNLGLWPEEQQPAGDSTPV-------------------------
DNLJ1_DESVV      NQS-----NIELLEQLRDKGLWPRKPDANGPFVREG------------------------
DNLJ_LAWIP       NKA-----NIQMINQFREMNIWPIQQVNDTTTKGF-------------------------
DNLJ_RHOBA       SES-----GSQTLSDLDAVGVTMSETEPVATPDEE-------------------------
DNLJ2_STRCO      ELAPLIDRLAAAGVNMTEPGATPPRPADTDGADGATAEAP--------------------
DNLJ1_NOCFA      RLR-------PELERLRERGVSLDVREEDLPPVVAA------------------------
DNLJ_PSYIN       NIK-------EEFLKLSALNFNLTITPKASEKS---------------------------
DNLJ_DESPS       GIK-------DLFFQLFALGFKLEPTPLLAEGG---------------------------
DNLJ_RUTMC       SIA-------DEFNHIYQYGFNLETTILTKDL----------------------------
DNLJ_VESOH       SIV-------DEYNQIYQYNFNLDTTVFTKDL----------------------------
DNLJ_DESAL       ALG-------PTIRHMLDLGFNLQPTPLKSEM----------------------------
                                                                             

DNLJ_TREDE       ------------------------------------------------------------
DNLJ_TREPA       GVVRTSVTRDLSYLIFESLSQPYRTAQKLKKEQGVALEIISEDEFCRLLDQASASCTHTG
DNLJ_THEFY       ------------------------------------------------------------
DNLJ_FRACC       ------------------------------------------------------------
DNLJ_SACEN       ------------------------------------------------------------
DNLJ_NOCSJ       ------------------------------------------------------------
DNLJ_ARTS2       ------------------------------------------------------------
DNLJ_CUTAK       ------------------------------------------------------------
DNLJ_CORJK       ------------------------------------------------------------
DNLJ_LEIXX       ------------------------------------------------------------
DNLJ_BIFLO       ------------------------------------------------------------
DNLJ_TROWT       ------------------------------------------------------------
DNLJ_RHORT       ------------------------------------------------------------
DNLJ_MAGSA       ------------------------------------------------------------
DNLJ_CHESB       ------------------------------------------------------------
DNLJ_BRADU       ------------------------------------------------------------
DNLJ_RHILO       ------------------------------------------------------------
DNLJ_BARBK       ------------------------------------------------------------
DNLJ_PARDP       ------------------------------------------------------------
DNLJ_MARMM       ------------------------------------------------------------
DNLJ_HYPNA       ------------------------------------------------------------
DNLJ_CAUVC       ------------------------------------------------------------
DNLJ_SPHAL       ------------------------------------------------------------
DNLJ_ZYMMO       ------------------------------------------------------------
DNLJ_RHOPB       ------------------------------------------------------------
DNLJ_GLUOX       ------------------------------------------------------------
DNLJ_PELPD       ------------------------------------------------------------
DNLJ_RICTY       ------------------------------------------------------------
DNLJ_ORITB       ------------------------------------------------------------
DNLJ_WOLTR       ------------------------------------------------------------
DNLJ_EHRRW       ------------------------------------------------------------
DNLJ_ANAPZ       ------------------------------------------------------------
DNLJ_NEOSM       ------------------------------------------------------------
DNLJ_PELUB       ------------------------------------------------------------
DNLJ_SPICI       ------------------------------------------------------------
DNLJ_MESFL       ------------------------------------------------------------
DNLJ_UREPA       ------------------------------------------------------------
DNLJ_MYCPE       ------------------------------------------------------------
DNLJ_MYCPN       ------------------------------------------------------------
DNLJ_MYCGA       ------------------------------------------------------------
DNLJ_MYCMO       ------------------------------------------------------------
DNLJ_MYCS5       ------------------------------------------------------------
DNLJ_MYCPU       ------------------------------------------------------------
DNLJ_MYCH7       ------------------------------------------------------------
DNLJ_FUSNN       ------------------------------------------------------------
DNLJ_LEPIC       ------------------------------------------------------------
DNLJ_BORBU       ------------------------------------------------------------
DNLJ_ONYPE       ------------------------------------------------------------
DNLJ_NITSB       ------------------------------------------------------------
DNLJ_SULDN       ------------------------------------------------------------
DNLJ_CAMHC       ------------------------------------------------------------
DNLJ_CAMJJ       ------------------------------------------------------------
DNLJ_WOLSU       ------------------------------------------------------------
DNLJ_HELHP       ------------------------------------------------------------
DNLJ_HELAH       ------------------------------------------------------------
DNLJ_CLOTE       ------------------------------------------------------------
DNLJ1_CLOAB      ------------------------------------------------------------
DNLJ_MARHV       ------------------------------------------------------------
DNLJ_ALCBS       SLDILGSHFRTVTELSAAAAEG--------------------------------------
DNLJ_IDILO       ------------------------------------------------------------
DNLJ_COLP3       ------------------------------------------------------------
DNLJ_SHEAM       ------------------------------------------------------------
DNLJ_SACD2       ------------------------------------------------------------
DNLJ_CHRSD       ------------------------------------------------------------
DNLJ_LEGPA       ------------------------------------------------------------
DNLJ_MAGMM       ------------------------------------------------------------
DNLJ_NITMU       ------------------------------------------------------------
DNLJ_JANMA       ------------------------------------------------------------
DNLJ_METCA       ------------------------------------------------------------
DNLJ_NITOC       ------------------------------------------------------------
DNLJ_COXBU       ------------------------------------------------------------
DNLJ_PSYCK       ------------------------------------------------------------
DNLJ_HYDCU       ------------------------------------------------------------
DNLJ_FRATN       ------------------------------------------------------------
DNLJ_DICNV       ------------------------------------------------------------
DNLJ_SODGM       ------------------------------------------------------------
DNLJ_BAUCH       ------------------------------------------------------------
DNLJ_BUCBP       ------------------------------------------------------------
DNLJ_BUCCC       ------------------------------------------------------------
DNLJ_BUCAI       ------------------------------------------------------------
DNLJ_WIGBR       ------------------------------------------------------------
DNLJ_BLOPB       ------------------------------------------------------------
DNLJ_BLOFL       ------------------------------------------------------------
DNLJ_BORA1       QSG---------------------------------------------------------
DNLJ_PSESM       ADRFGTLEAVISADWLDMR-----------------------------------------
DNLJ_RALSO       ATLVPSLAQLANVDTAQL------------------------------------------
DNLJ_XYLFT       ATLAPTLPLLAEADLDALLQ----------------------------------------
DNLJ_NEIG1       ---AQALWELAGQSIEGLQ-----------------------------------------
DNLJ_BDEBA       ------------------------------------------------------------
DNLJ_GEOSL       ------------------------------------------------------------
DNLJ_PELCD       ------------------------------------------------------------
DNLJ_SYNAS       ------------------------------------------------------------
DNLJ_SYNFM       ------------------------------------------------------------
DNLJ_MYXXD       ------------------------------------------------------------
DNLJ_ANADF       ------------------------------------------------------------
DNLJ_HALHL       ------------------------------------------------------------
DNLJ_NATPD       ------------------------------------------------------------
DNLJ_HALWD       ------------------------------------------------------------
DNLJ_SALRD       ------------------------------------------------------------
DNLJ_LISW6       ------------------------------------------------------------
DNLJ_STAS1       ------------------------------------------------------------
DNLJ_GEOSE       ------------------------------------------------------------
DNLJ_ENTFA       ------------------------------------------------------------
DNLJ_STRS2       ------------------------------------------------------------
DNLJ_LACS1       ------------------------------------------------------------
DNLJ_LACPL       ------------------------------------------------------------
DNLJ_OENOB       ------------------------------------------------------------
DNLJ_LEUMM       ------------------------------------------------------------
DNLJ_PEDPA       ------------------------------------------------------------
DNLJ_LACDB       ------------------------------------------------------------
DNLJ_SYMTH       ------------------------------------------------------------
DNLJ_MOOTA       ------------------------------------------------------------
DNLJ_DESHY       ------------------------------------------------------------
DNLJ_CARHZ       ------------------------------------------------------------
DNLJ_HUNT2       ------------------------------------------------------------
DNLJ_CALS8       ------------------------------------------------------------
DNLJ_CALS4       ------------------------------------------------------------
DNLJ_CLOD6       ------------------------------------------------------------
DNLJ_SYNWW       ------------------------------------------------------------
DNLJ_THEMA       ------------------------------------------------------------
DNLJ_AQUAE       ------------------------------------------------------------
DNLJ_SOLUE       ------------------------------------------------------------
DNLJ_KORVE       ------------------------------------------------------------
DNLJ_SYNE7       ------------------------------------------------------------
DNLJ_SYNJA       ------------------------------------------------------------
DNLJ_SYNY3       ------------------------------------------------------------
DNLJ_GLOVI       ------------------------------------------------------------
DNLJ_PROMT       ------------------------------------------------------------
DNLJ_PROMA       ------------------------------------------------------------
DNLJ_PARD8       ------------------------------------------------------------
DNLJ_PORGI       ------------------------------------------------------------
DNLJ_GRAFK       ------------------------------------------------------------
DNLJ_CYTH3       ------------------------------------------------------------
DNLJ_PELLD       ------------------------------------------------------------
DNLJ_CHLPN       ------------------------------------------------------------
DNLJ_CHLMU       ------------------------------------------------------------
DNLJ_PARUW       ------------------------------------------------------------
DNLJ_RHOMR       ------------------------------------------------------------
DNLJ_RUBXD       ------------------------------------------------------------
DNLJ_ROSS1       ------------------------------------------------------------
DNLJ_THEFI       ------------------------------------------------------------
DNLJ_DEIRA       ------------------------------------------------------------
DNLJ_DEHMC       ------------------------------------------------------------
DNLJ_DESAG       ------------------------------------------------------------
DNLJ1_DESVV      ------------------------------------------------------------
DNLJ_LAWIP       ------------------------------------------------------------
DNLJ_RHOBA       ------------------------------------------------------------
DNLJ2_STRCO      ------------------------------------------------------------
DNLJ1_NOCFA      ------------------------------------------------------------
DNLJ_PSYIN       ------------------------------------------------------------
DNLJ_DESPS       ------------------------------------------------------------
DNLJ_RUTMC       ------------------------------------------------------------
DNLJ_VESOH       ------------------------------------------------------------
DNLJ_DESAL       ------------------------------------------------------------
                                                                             

DNLJ_TREDE       ------EG----------------------------------------------------
DNLJ_TREPA       ETVHPLQGKSFYFSGASRSMNHKHAQEKVRALGGDVASSVTAQLDYLVFYSQSTRYRTAC
DNLJ_THEFY       ------------------------------------------------------------
DNLJ_FRACC       ------------------------------------------------------------
DNLJ_SACEN       ------------------------------------------------------------
DNLJ_NOCSJ       ------------------------------------------------------------
DNLJ_ARTS2       ------------------------------------------------------------
DNLJ_CUTAK       ------------------------------------------------------------
DNLJ_CORJK       ------------------------------------------------------------
DNLJ_LEIXX       ------------------------------------------------------------
DNLJ_BIFLO       ------------------------------------------------------------
DNLJ_TROWT       ------------------------------------------------------------
DNLJ_RHORT       ------------------------------------------------------------
DNLJ_MAGSA       ------------------------------------------------------------
DNLJ_CHESB       ------------------------------------------------------------
DNLJ_BRADU       ------------------------------------------------------------
DNLJ_RHILO       ------------------------------------------------------------
DNLJ_BARBK       ------------------------------------------------------------
DNLJ_PARDP       ------------------------------------------------------------
DNLJ_MARMM       ------------------------------------------------------------
DNLJ_HYPNA       ------------------------------------------------------------
DNLJ_CAUVC       ------------------------------------------------------------
DNLJ_SPHAL       ------------------------------------------------------------
DNLJ_ZYMMO       ------------------------------------------------------------
DNLJ_RHOPB       ------------------------------------------------------------
DNLJ_GLUOX       ------------------------------------------------------------
DNLJ_PELPD       ------------------------------------------------------------
DNLJ_RICTY       ------------------------------------------------------------
DNLJ_ORITB       ------------------------------------------------------------
DNLJ_WOLTR       ------------------------------------------------------------
DNLJ_EHRRW       ------------------------------------------------------------
DNLJ_ANAPZ       ------------------------------------------------------------
DNLJ_NEOSM       ------------------------------------------------------------
DNLJ_PELUB       ------------------------------------------------------------
DNLJ_SPICI       ------------------------------------------------------------
DNLJ_MESFL       ------------------------------------------------------------
DNLJ_UREPA       ------------------------------------------------------------
DNLJ_MYCPE       ------------------------------------------------------------
DNLJ_MYCPN       ------------------------------------------------------------
DNLJ_MYCGA       ------------------------------------------------------------
DNLJ_MYCMO       ------------------------------------------------------------
DNLJ_MYCS5       ------------------------------------------------------------
DNLJ_MYCPU       ------------------------------------------------------------
DNLJ_MYCH7       ------------------------------------------------------------
DNLJ_FUSNN       ------------------------------------------------------------
DNLJ_LEPIC       ------------------------------------------------------------
DNLJ_BORBU       ------------------------------------------------------------
DNLJ_ONYPE       ------------------------------------------------------------
DNLJ_NITSB       ------------------------------------------------------------
DNLJ_SULDN       ------------------------------------------------------------
DNLJ_CAMHC       ------------------------------------------------------------
DNLJ_CAMJJ       ------------------------------------------------------------
DNLJ_WOLSU       ------------------------------------------------------------
DNLJ_HELHP       ------------------------------------------------------------
DNLJ_HELAH       ------------------------------------------------------------
DNLJ_CLOTE       ------------------------------------------------------------
DNLJ1_CLOAB      ------------------------------------------------------------
DNLJ_MARHV       ------------------------------------------------------------
DNLJ_ALCBS       -----------------------------------------AGAEPKGVRSGVMTQLAKA
DNLJ_IDILO       ------------------------------------------------------------
DNLJ_COLP3       ------------------------------------------------------------
DNLJ_SHEAM       ------------------------------------------------------------
DNLJ_SACD2       ------------------------------------------------------------
DNLJ_CHRSD       ------------------------------------------------------------
DNLJ_LEGPA       ------------------------------------------------------------
DNLJ_MAGMM       ------------------------------------------------------------
DNLJ_NITMU       ------------------------------------------------------------
DNLJ_JANMA       ------------------------------------------------------------
DNLJ_METCA       ------------------------------------------------------------
DNLJ_NITOC       ------------------------------------------------------------
DNLJ_COXBU       ------------------------------------------------------------
DNLJ_PSYCK       ------------------------------------------------------------
DNLJ_HYDCU       ------------------------------------------------------------
DNLJ_FRATN       ------------------------------------------------------------
DNLJ_DICNV       ------------------------------------------------------------
DNLJ_SODGM       ------------------------------------------------------------
DNLJ_BAUCH       ------------------------------------------------------------
DNLJ_BUCBP       ------------------------------------------------------------
DNLJ_BUCCC       ------------------------------------------------------------
DNLJ_BUCAI       ------------------------------------------------------------
DNLJ_WIGBR       ------------------------------------------------------------
DNLJ_BLOPB       ------------------------------------------------------------
DNLJ_BLOFL       ------------------------------------------------------------
DNLJ_BORA1       ------------------------------------------------------------
DNLJ_PSESM       ------------------------------------------QTLPEKQAKSVRDFFDDN
DNLJ_RALSO       ------------------------------------------EGLPADVAASLLAWLDAD
DNLJ_XYLFT       ------------------------------------------AGVPQPAAQSLTEWFQSP
DNLJ_NEIG1       --------------------------------------------NDKALPADWQAWRSKA
DNLJ_BDEBA       ------------------------------------------------------------
DNLJ_GEOSL       ------------------------------------------------------------
DNLJ_PELCD       ------------------------------------------------------------
DNLJ_SYNAS       ------------------------------------------------------------
DNLJ_SYNFM       ------------------------------------------------------------
DNLJ_MYXXD       ------------------------------------------------------------
DNLJ_ANADF       ------------------------------------------------------------
DNLJ_HALHL       ------------------------------------------------------------
DNLJ_NATPD       ------------------------------------------------------------
DNLJ_HALWD       ------------------------------------------------------------
DNLJ_SALRD       ------------------------------------------------------------
DNLJ_LISW6       ------------------------------------------------------------
DNLJ_STAS1       ------------------------------------------------------------
DNLJ_GEOSE       ------------------------------------------------------------
DNLJ_ENTFA       ------------------------------------------------------------
DNLJ_STRS2       ------------------------------------------------------------
DNLJ_LACS1       ------------------------------------------------------------
DNLJ_LACPL       ------------------------------------------------------------
DNLJ_OENOB       ------------------------------------------------------------
DNLJ_LEUMM       ------------------------------------------------------------
DNLJ_PEDPA       ------------------------------------------------------------
DNLJ_LACDB       ------------------------------------------------------------
DNLJ_SYMTH       ------------------------------------------------------------
DNLJ_MOOTA       ------------------------------------------------------------
DNLJ_DESHY       ------------------------------------------------------------
DNLJ_CARHZ       ------------------------------------------------------------
DNLJ_HUNT2       ------------------------------------------------------------
DNLJ_CALS8       ------------------------------------------------------------
DNLJ_CALS4       ------------------------------------------------------------
DNLJ_CLOD6       ------------------------------------------------------------
DNLJ_SYNWW       ------------------------------------------------------------
DNLJ_THEMA       ------------------------------------------------------------
DNLJ_AQUAE       ------------------------------------------------------------
DNLJ_SOLUE       ------------------------------------------------------------
DNLJ_KORVE       ------------------------------------------------------------
DNLJ_SYNE7       ------------------------------------------------------------
DNLJ_SYNJA       ------------------------------------------------------------
DNLJ_SYNY3       ------------------------------------------------------------
DNLJ_GLOVI       ------------------------------------------------------------
DNLJ_PROMT       ------------------------------------------------------------
DNLJ_PROMA       ------------------------------------------------------------
DNLJ_PARD8       ------------------------------------------------------------
DNLJ_PORGI       ------------------------------------------------------------
DNLJ_GRAFK       ------------------------------------------------------------
DNLJ_CYTH3       ------------------------------------------------------------
DNLJ_PELLD       ------------------------------------------------------------
DNLJ_CHLPN       ------------------------------------------------------------
DNLJ_CHLMU       ------------------------------------------------------------
DNLJ_PARUW       ------------------------------------------------------------
DNLJ_RHOMR       ------------------------------------------------------------
DNLJ_RUBXD       ------------------------------------------------------------
DNLJ_ROSS1       ------------------------------------------------------------
DNLJ_THEFI       ------------------------------------------------------------
DNLJ_DEIRA       ------------------------------------------------------------
DNLJ_DEHMC       ------------------------------------------------------------
DNLJ_DESAG       ------------------------------------------------------------
DNLJ1_DESVV      ------------------------------------------------------------
DNLJ_LAWIP       ------------------------------------------------------------
DNLJ_RHOBA       ------------------------------------------------------------
DNLJ2_STRCO      ------------------------------------------------------------
DNLJ1_NOCFA      ------------------------------------------------------------
DNLJ_PSYIN       ------------------------------------------------------------
DNLJ_DESPS       ------------------------------------------------------------
DNLJ_RUTMC       ------------------------------------------------------------
DNLJ_VESOH       ------------------------------------------------------------
DNLJ_DESAL       ------------------------------------------------------------
                                                                             

DNLJ_TREDE       ------------------------------AVLKGLSFCFTGELNTM------KRAQAEA
DNLJ_TREPA       ALGIQIISEETLHKLIATAQSPLHTDAHVHAPLHGMSFCFSGDLDGM------TRAQAIA
DNLJ_THEFY       -------------------------ADDGPRLLDGITTVITGTLEKY------SRDGAKE
DNLJ_FRACC       -------------------------AEEGPRPLDGVTVVITGTLTDW------SRDSAKE
DNLJ_SACEN       -------------------------DESIERHLTGLSIVVTGSLEGF------SRDEAKE
DNLJ_NOCSJ       -------------------------DESTPRTLAGLTVVVTGSLVDF------SRDSAKE
DNLJ_ARTS2       -------------------------DESTPRTLEGLTVVVTGSLEGF------SRDEAKE
DNLJ_CUTAK       -------------------------DEAPEQTLEGLTVVVTGSLEGF------SRDEAKE
DNLJ_CORJK       -------------------------DGVDSALLEGLTIVVTGSLEDF------DRTAAKE
DNLJ_LEIXX       -------------------------ADTGGGVLSGLTVVATGSLEGY------TREAAQE
DNLJ_BIFLO       -------------------------TSSLPQTLAGKTVVVTGSLEGY------SRDSAKE
DNLJ_TROWT       ------------------------------------------------------------
DNLJ_RHORT       ----------------------------GDSPLAGKTVVFTGTLDTM------SRGEAKA
DNLJ_MAGSA       ----------------------------SASPVAGKAVVFTGTLVTM------TRPEAKA
DNLJ_CHESB       -----------------------------DSPVAGKTIVFTGALERM------SRDEAKD
DNLJ_BRADU       -----------------------------NSAVAGKTVVFTGSLEKM------TRDEAKA
DNLJ_RHILO       ----------------------------ADSEVAGKTIVFTGTLEKM------TRSEAKA
DNLJ_BARBK       ----------------------------DYSPVAGKTIVFTGTLVHM------SRDEVKA
DNLJ_PARDP       -----------------------------DSAIAGKTLVFTGTLEKM------TRAEAKA
DNLJ_MARMM       -----------------------------DSPVAGKTVVFTGALERM------TRDEAKA
DNLJ_HYPNA       -----------------------------GSPVTGKTVVFTGTLEKM------TRDEAKA
DNLJ_CAUVC       -----------------------------DTAVAGKTIVFTGSLEKM------TRDEAKA
DNLJ_SPHAL       ----------------------------RDSEVSGKTVVFTGKLETM------SRDEAKA
DNLJ_ZYMMO       ----------------------------ASSPLSGKIIVFTGSLQKI------TRDEAKR
DNLJ_RHOPB       ----------------------------AKSPISGKIVVFTGALERT------TRDEAKA
DNLJ_GLUOX       ----------------------------SEGHLSGKVIVFTGTLTTM------SRPEAKA
DNLJ_PELPD       ----------------------------ISSNISGKIVVFTGELEKR------SRKAAKI
DNLJ_RICTY       ----------------------------EQNILTGKILVFTGSLKTI------SRVEAKE
DNLJ_ORITB       ----------------------------DNLLLSNQTIVFTGTFATV------SRSEIKV
DNLJ_WOLTR       ----------------------------SNSVLNNKVIVFTGKLLTM------SRGEAKV
DNLJ_EHRRW       ----------------------------YVSLIHGKTIVFTGELSSM------SRSEAKL
DNLJ_ANAPZ       ----------------------------TASPISGKTIVFTGVLEDM------SRNEAAK
DNLJ_NEOSM       -----------------------------GGSLSGKKFVFTGTLLSI------TREEAKE
DNLJ_PELUB       ----------------------------NNGLLKNKTFMLTGKLNGI------SRAEAKS
DNLJ_SPICI       ----------------------------LAQKFENYRFVITGVLSKS------REYFKEL
DNLJ_MESFL       ----------------------------TESTISEKSFVITGTLSES------RDYFKDI
DNLJ_UREPA       ----------------------------IIDEYKNKTFVITGSFSIS------RDEIKTI
DNLJ_MYCPE       ----------------------------EHQKYMNKTFVITGSFNKS------RNEIKNY
DNLJ_MYCPN       ----------------------------TASIYFQKSFVITGSFPIS------RDTIKNL
DNLJ_MYCGA       ----------------------------SSSIYYDKKFVITGSFSIS------RNDIIKK
DNLJ_MYCMO       ----------------------------ESKKLQGLNFVITGTLSKP------RDFFKEL
DNLJ_MYCS5       ----------------------------KSSKLNNLNFAITGSLSIS------RDEFKKI
DNLJ_MYCPU       ----------------------------QSTKLENKTFLITGTLEKP------RDFYKNL
DNLJ_MYCH7       ----------------------------QSN--SWASFAISGKLSKP------RDEYVRI
DNLJ_FUSNN       ----------------------------VNPNFVGKNFLFTGTLKHF------TREQIKE
DNLJ_LEPIC       ----------------------------DQQPFAGQSWCVTGSFENFQ-----PRDKAMD
DNLJ_BORBU       ----------------------------ENKLLAGKKFCITGTFNGY------SRSIIID
DNLJ_ONYPE       ----------------------------TQTIFTNKKIVLTGTLQKY------SRLQIQQ
DNLJ_NITSB       ----------------------------ENSPLAHKTVVLTGEMKL-------PRSKIKE
DNLJ_SULDN       ----------------------------KENPFKGKSVVLTGSMSE-------SRDMIKE
DNLJ_CAMHC       ----------------------------SQNVFTKKTVVITGTLSI-------SRDEMKE
DNLJ_CAMJJ       ----------------------------SDGVIFGKTFVITGTLSR-------PRDEFKA
DNLJ_WOLSU       -----------------------------DSPIAGKSFVITGTLSA-------PREHFVE
DNLJ_HELHP       -----------------------------NNVFFNKTIVLTGTLSQ-------PRDRIIK
DNLJ_HELAH       ----------------------------SSSIFSHKTIVLTGTLSK-------PRQEYAQ
DNLJ_CLOTE       ----------------------------KDNKFNGKTIVVTGTLEGY------TRNEIKE
DNLJ1_CLOAB      -----------------------------ESVFNDKTVVATGSLQNY------SRTEIKE
DNLJ_MARHV       -----------------------------EQPLNGQTWVLTGTLSGM------TRDQAKE
DNLJ_ALCBS       LAENDWRGRLQDAEKKVADMAARAPQEMESQPLEGQTWVLTGTLEQF------TRNQAKQ
DNLJ_IDILO       -----------------------------SDRLSGNTYVITGTLSTM------TRDEAKS
DNLJ_COLP3       -----------------------------ELPLAEQIFVLTGTLTQM------GRTEAKT
DNLJ_SHEAM       -----------------------------AQPLLGQTWVLTGTLTSL------GRTEAKA
DNLJ_SACD2       -------------------------------PLEGTTYVLTGSLESL------SRDEAKD
DNLJ_CHRSD       -------------------------------PLAGQTWVLTGTLESM------TRDDGKA
DNLJ_LEGPA       ----------------------------QQNPFFGKTVVLTGTLSAM------GREEAKA
DNLJ_MAGMM       --------------------------AAAEQPLSGLSVVLTGTLAGL------TREAAAV
DNLJ_NITMU       --------------------SAHPGAAAASSKIAGRSFVLTGTLPTM------SREEARE
DNLJ_JANMA       -----------------------------PKPFAGKTFVLTGTLPTL------SRDQAAE
DNLJ_METCA       -----------------------------KLPLQGLVFVLTGTLASM------SRDEARA
DNLJ_NITOC       -----------------------------VQPLLGRTFVLTGTLESM------TREQAKE
DNLJ_COXBU       --------------------------------IAGKTFVLTGALKSL------TREEAEE
DNLJ_PSYCK       ------------------------------LPLDGQTWVITGALDSM------ARDEAKA
DNLJ_HYDCU       -----------------------------DSPFANKVVVLTGTLSEM------SRPEAKV
DNLJ_FRATN       -----------------------------NESFTGKTVVITGSFENY------GRTELTQ
DNLJ_DICNV       -----------------------------DAPLLGKTVVITGTLPSL------SRAEAQK
DNLJ_SODGM       ------------------------------NPFAGKTIVLTGSLSSL------SRDEAKD
DNLJ_BAUCH       ------------------------------NYFSGKNIVFTGTLAFL------SREEAID
DNLJ_BUCBP       -------------------------------TLFRKKIVFSGSFSNF------SRSKIIE
DNLJ_BUCCC       ------------------------------------------------------------
DNLJ_BUCAI       ------------------------------TYFFNKKIVLTGVFKSF------SRIELKT
DNLJ_WIGBR       ------------------------------------------------------------
DNLJ_BLOPB       ------------------------------------------------------------
DNLJ_BLOFL       ------------------------------------------------------------
DNLJ_BORA1       -------------------------------DLAGKTFVLTGTMPTW------SRDEATR
DNLJ_PSESM       ANAERARAIEAQLKDFGMHWRSEK-KTVEGLPLAGQTWVLTGSLERM------SRDVAKE
DNLJ_RALSO       DHRTRLGTLDALRAELLAAMPA---GAAEEGALSGKTVVLTGTLPTL------SRDEAKA
DNLJ_XYLFT       DNISLARRLQHCCDVLLAQLLSP--DRAHTAPLNGQSVVLTGKLASL------TREAAAT
DNLJ_NEIG1       QNTALLENLKTFFAQMPSEDEAAQGSDGINKAVAGKTFVLTGTLPTF------KRDQAQA
DNLJ_BDEBA       --------------------------------LSGMSFLITGTLPVK-------RDDAKD
DNLJ_GEOSL       ------------------------------GRFTGKTFVFTGALTRF------SRPEAQK
DNLJ_PELCD       ------------------------------GPLTGKSFVFTGSLTRF------SRKQAQE
DNLJ_SYNAS       ------------------------------APLTGKTFVFTGALSRM------TRDEAKQ
DNLJ_SYNFM       -----------------------------DAFWNGKTVVFTGALSSM------TRSNAAA
DNLJ_MYXXD       -----------------------------GGPFVGKSVVLTGAMTGM------TREQAKE
DNLJ_ANADF       -----------------------------GGPFAGKTVVLTGGLAAL------SRDDAKA
DNLJ_HALHL       -----------------------------VSSLAGRAFVVTGTLETM------TRDEAKA
DNLJ_NATPD       -----------------------------GDALSGQTFVFTGSLDGL------TREEAHE
DNLJ_HALWD       -----------------------------NAPLSDLTFVFTGSLS-V------PRTTATT
DNLJ_SALRD       -----------------------------AARLEGLTFVFTGSLEGW------TRSAVQR
DNLJ_LISW6       -----------------------EDMSEEELVFAGKTVVLTGKLEKL------TRNDAKA
DNLJ_STAS1       -----------------------TEL-EGHPDFKDKTIVLTGKLYQM------TRNEASN
DNLJ_GEOSE       -----------------------SAEAPADSAFAGKTVVLTGKLASM------SRNEAKE
DNLJ_ENTFA       -----------------------EQLAEVESPFKDKTVVLTGKLAQY------TREEAKE
DNLJ_STRS2       ------------------------QVVDENAALSGMTVVLTGKLERM------KRNEAKA
DNLJ_LACS1       -----------------------QLESSTDSSFNGLRVVLTGTLDTL------KRSEAKS
DNLJ_LACPL       -----------------------TVAEDSNSWFAGKRVVLTGKLESF------TRPDATQ
DNLJ_OENOB       -------------------------TVDEKNYFFNKRIVLTGKLIHW------TRPQMQA
DNLJ_LEUMM       -------------------------VIDENSFFYGKKVVLTGKLEQS------SRPAATK
DNLJ_PEDPA       -------------------------AESPDGYYKGKKVVLTGKLEQY------TRNELKE
DNLJ_LACDB       -------------------------GEAADNFFKGKTVVLTGKLAHY------SRAEFTK
DNLJ_SYMTH       -------------------------AGPAEGPLAGMTVVVTGTLVRW------SRKEIEE
DNLJ_MOOTA       ------------------------NAAAPAGPLTGKVFVLTGTLPGM------TRQEAEE
DNLJ_DESHY       ------------------------HSAKPQ-IFAGKSIVVTGSLQRW------DRHYVET
DNLJ_CARHZ       ------------------------AEVRDN-RLEGLTFVLTGTLSSF------TRKEAEQ
DNLJ_HUNT2       -----------------------GKKKIKDNRFEGKTFVLTGTLPSF------TRKEAEE
DNLJ_CALS8       ------------------------EKKAKSDILKGYTFVLTGALSKY------SRSQAKE
DNLJ_CALS4       -----------------------STGKV-SNIFEGKIFVLTGALKNY------TRDEAAR
DNLJ_CLOD6       -----------------------NTGEKVEKIFEGMKIVLTGTLPTL------KRNDAKE
DNLJ_SYNWW       ------------------------AIEAGEQLLQGKTFVLTGTLPSL------TRQQASE
DNLJ_THEMA       ------------------------VVK--LDILRGLTFAVTGTLKNF------TREEIIE
DNLJ_AQUAE       ------------------------VKEKVADVLKGKTFVFTGTLDCC------SREKAGE
DNLJ_SOLUE       --------------------------RPKGGPLTGSTFVLTGTLPNL------SREEAKQ
DNLJ_KORVE       --------------------------KERGTALAGQTFVLTGSLPTY------SRDEAKK
DNLJ_SYNE7       -----------------------Q-------ALAGQTFVLTGTLPTL------SRNEAKA
DNLJ_SYNJA       -----------------------Q-------VLAGKKFVITGTLPTL------SRQQAKA
DNLJ_SYNY3       -----------------------DS-----GKLKGKTFVLTGTLPNL------SRLEAQE
DNLJ_GLOVI       -----------------------A--------LAGLTFVITGTLPTL------SREECTA
DNLJ_PROMT       -----------------------N----QSNVFDGKSFVLTGTLDSL------TRDEAKE
DNLJ_PROMA       -----------------------NILMQEKLQFSGKTFVITGTMPSL------SRANLEE
DNLJ_PARD8       -----------------------R-----SEKLKGLTIVISGTFSKH------SRDEYKA
DNLJ_PORGI       -----------------------V-----SNRLAGKTVVISGTFEKR------SRDEYKA
DNLJ_GRAFK       -----------------------Q-----TNILEGNTFVISGVFEKV------SRNDLKK
DNLJ_CYTH3       -----------------------E-----SDKFAGKSFVISGVFENY------ERDELKD
DNLJ_PELLD       -----------------------------NSNFEGLSVVFTGALLRH------DRQSASE
DNLJ_CHLPN       ------------------------------STCFGKAFVITGTLEGM------SRLDAET
DNLJ_CHLMU       ------------------------------APLQGKIFVLTGTLQEM------TRLQAEE
DNLJ_PARUW       -----------------------------NHAFQGKIFVLTGSLEHY------TRQSAAS
DNLJ_RHOMR       ---------------------------AAESPVRGKTFVLTGALPHL------TRKEAEE
DNLJ_RUBXD       ---------------------------PEEGPLSGRRLVITGTLSR-------PRSEISD
DNLJ_ROSS1       ---------------------------SRGNALAGKTFVITGTLPSM------SREEASA
DNLJ_THEFI       ---------------------------EVSDLLSGLTFVLTGELSR-------PREEVKA
DNLJ_DEIRA       ---------------------------TRTDQLSGLNFVLTGALSR-------PREVIKA
DNLJ_DEHMC       ---------------------------NKNMPFSGMEFVVTGKLESF------SREEAQE
DNLJ_DESAG       ------------------------------TPLAGKKILFTGSLVRM------TRSEAKA
DNLJ1_DESVV      ------------------------------SQLQGLKLLFTGSLQRM------SRSEAKR
DNLJ_LAWIP       --------------------------------FTGKKLLFTGTLERP-------RAEMKR
DNLJ_RHOBA       ----------------------------ANLPLAGKNIVATGTLQHY------TRDEIKA
DNLJ2_STRCO      ---------------------------GDGGPLAGMKVVVTGAMTGNLERL--SRNEMNE
DNLJ1_NOCFA      -----------------------------GAPLAGKTVVVTGAISDPRSGEKVARPTFQR
DNLJ_PSYIN       --------------------------PGE-TPVFGKIIVFTGAMTQGS------RGDMEK
DNLJ_DESPS       --------------------------QGEKSPISGKTIVFTGAMLAAS------RGDMEK
DNLJ_RUTMC       --------------------------QTLTHELFDKKIVFTGKMNHS-------RDDMKK
DNLJ_VESOH       --------------------------QTLMHELFDKRIVFTGKMNCP-------RNEMKK
DNLJ_DESAL       ---------------------------DVSSPISGKGVVFTGSMETGS------RKDMEE
                                                                             

DNLJ_TREDE       LVKEKGGTVKSSVVKGLSYLVTNTPDSGSSKNKKAQELGTAIITEEAFLNLIGKV-----
DNLJ_TREPA       LVQRLGGTVKTAVSTQLTYLVSNDPHGQSRKCQNAVRCGVRIISEHVFLALCTPGT----
DNLJ_THEFY       AVQKLGGRVTGSVSRKTDFVVV-GANPG-SKYDKAVKLGVPILDEAGFEVLLTQGPEAAR
DNLJ_FRACC       AVEARGGKVTGSVSRKTTAVVV-GADPGASKYDKARSLRIPMLDEAGFAVLLAQGVDAAS
DNLJ_SACEN       LIMARGGRAAGSVSKKTAFVVV-GESPG-SKYDKAVQMKVPVLDEDGFRVLLEQGPEAAA
DNLJ_NOCSJ       AILSRGGKAAGSVSKKTDYVVV-GENAG-SKADKAEQLGVPVLDEAGFKTLLDGGP----
DNLJ_ARTS2       AILIRGGKASGSVSKNTSYVVA-GENAG-TKLDKAEQLGVPVLDEDGFRALLANGPAASA
DNLJ_CUTAK       AIVSRGGKAAGSVSRKTDYVVV-GENAG-SKETKARDLGRPILDEAGFRYLLENGPQGIT
DNLJ_CORJK       AIEARGGKAAGSVSKKTDFLVA-GEKAG-SKLKKAEDLGVPVLDEAAFKELLENGAPSSG
DNLJ_LEIXX       AIVAAGGKAASSVSKKTDFVAA-GPGAG-SKLAKAEELGVRVLDAAQFTILVEQGPGALP
DNLJ_BIFLO       AIIERGGKAAGSVSKKTDYVVI-GANAG-SKAAKAEELGIPMLSETQFAQLLATGTI---
DNLJ_TROWT       ------------------------------------------------------------
DNLJ_RHORT       RALALGAKVTGSVSAKTDYVVV-GAD-AGSKEKKARELGLTVLSEAEFRAMSGG------
DNLJ_MAGSA       RAEALGAKVVGSVSKKTDYVVV-GAD-AGSKAAEAVKLGIATLSEQEWLALTGAAD----
DNLJ_CHESB       MAERLGAKVAGSVSSKTDLVVA-GPG-AGSKLKKAAELGIEVIDEDMWFQRIGA------
DNLJ_BRADU       TAERLGAKVSGSVSKKTDLVVA-GPG-AGSKLAEANKHGVKVLTEDEWLKLIGE------
DNLJ_RHILO       MAERLGAKVAGSVSAKTDLLVA-GPG-AGSKLKLASELGVEVIDEDTWLQRVGKA-----
DNLJ_BARBK       LAERLGAKASSSISKKTDLLVA-GIG-AGSKLTKAKELGIEIMDEESWLQLINEHHI---
DNLJ_PARDP       RAEALGAHVAGSVSAKTDLLIA-GPG-AGSKAKKAAELGIKVIDEDEWLAIAQG------
DNLJ_MARMM       KAQALGAKVAGSVSGKTDYLVA-GPG-AGSKAKKAAELGVETLTEDEWFDLIGA------
DNLJ_HYPNA       RASALGAKVAGTVSAKTDIVIA-GPG-AGSKLVKAEQLGLAVMTEDEWLALIGET-----
DNLJ_CAUVC       QAEGLGAKVASSVSKKTDLVVA-GPG-AGSKLKTATDLGIQVMTEDEWLELVAG------
DNLJ_SPHAL       QAEALGAKAAGSVSAKTDLVVA-GPG-AGSKLKQAASLGIRVIDEAEWAAIVAAAG----
DNLJ_ZYMMO       QAENLGAKVASSVSKKTNLVVA-GEA-AGSKLSKAKELDISIIDEDRWHRIVENDGQDSI
DNLJ_RHOPB       IAERLGAKVASSVSSKTDLVVA-GPS-AGSKLRDAQKFGVKVLTEEEWAEISGNE-----
DNLJ_GLUOX       IAERLGAQVTDSVSKKTSLVVL-GEK-AGSKAKKAAELGIETVDESGWRVLAGL------
DNLJ_PELPD       EAEKFGAKVATDVSRKTDIVIA-GTD-PGSKLRKAQELGIKILSEDEWEHLINEK-----
DNLJ_RICTY       IAEKLGAKVASSVSSNTDLLIV-GVN-GGSKLKKAKELNIKIIDEAEWLAFIKCLEKEV-
DNLJ_ORITB       QAEKLGAKVGTQVSNNTDLLVV-GNK-AGNKLQKAQQLGIKIINEEEWIKMVNE------
DNLJ_WOLTR       RAKALGAKVSSNLSAKIDYLVA-GEK-PGNKYKKAVELGVGILNEDQWYRMINSEVSE--
DNLJ_EHRRW       KSETAGAKVSSSLSKNTDFLII-GNN-PGSKYKKAQSLNIQILSEDIWLQYIQPNKV---
DNLJ_ANAPZ       YAETLGAKVGNTVTTKTDILVA-GSN-SGSKLDTARKLGIQVMNESEWKDLLKTVSNSE-
DNLJ_NEOSM       IIKKAGGIVVNSISKQIDYVVA-GEK-AGSKLAKANELGIAIIEEKTLIEFTNGNNTPAL
DNLJ_PELUB       LIEQNSGKIISNVNKKLDYLIA-GDKPTLKKINTAKEWNIKIINQTEWLKMLNKSG----
DNLJ_SPICI       IESY-GGQVSESVSAKTTYLLA-GTDAGN-KLVKAQKLNVKIINEEEFQQLLSKED----
DNLJ_MESFL       IELN-NGKVIGSVSKKTDYVLA-GENAGS-KLTKAEELNVKVINEEEFFAILKGE-----
DNLJ_UREPA       LEKYYHAKVKNSVSKKTDYVLV-GTEAG-TKLEKAKLLGVKIIENEFWKKDNNF------
DNLJ_MYCPE       IESVFNAKVSDSVSKKTDYLVV-GENAGDSKLKKANDLKIEIITEPFWDN----------
DNLJ_MYCPN       LVNKYDCRFTNNVTSKVDFVLA-GIKATPRKLEQAKALNIPIINEPIWT-----------
DNLJ_MYCGA       LSLKYKIKFVSGVSKNVDFVLA-GNSPTAKKINQAKVLNIPIIQEEIWNK----------
DNLJ_MYCMO       IIKN-GGNVLNSISNRINYLLT-GEKSGSKIEKAQKINTIKILDENEFNKLI--------
DNLJ_MYCS5       ILDN-GGIFSNSVSKNTSYLIS-NSKENSTKIKKALENNIKVITEEEFHNLLKEENA---
DNLJ_MYCPU       IIQN-GGIISSSISKKLDYLIV-GQNPGS-KEKKAMELNIKIIDEEFLKKMLE-------
DNLJ_MYCH7       IEES-GASFHESVTKKTDFLLL-GQSAGS-KIEKAKKAGIKIINEVQFFDLIKNSKKT--
DNLJ_FUSNN       EIEKLGGKNLSSVSKNLDYLIV-GEKAGSKLKKAQEIPTIKILTEEEFIELKDKFD----
DNLJ_LEPIC       LIVYYGGRKVSAVSSKTTHLLA-GPGAGS-KLEKANELGVSVYDEKQFLDLLKSLKIDFK
DNLJ_BORBU       KLKNKGAIFNTCVTGSLDFLIV-GEKAGS-KLKKALSLNIKIMSFEDIKSYLD-------
DNLJ_ONYPE       ILEQMGAIITNSLSLQNNYLIV-GINAGS-KLTKAQKLQIPIIEEKELQQIIENSQIKL-
DNLJ_NITSB       LLERAGAHVTNSVSHHTDYVFY-GENPGS-KFQKAQQLGVPLLPEEKMWELLKEAGIEA-
DNLJ_SULDN       MLESLGAKVVSSVSKKTDFVIY-GEDAGS-KYDKAMDLGVECLNEDEMRSKIEQA-----
DNLJ_CAMHC       KLIKMGANVTNSVSKKTDFVLF-GKDAGS-KLEKAKMLGVKAISEDEFKEML--------
DNLJ_CAMJJ       LIEKLGGKVSSSVSKKTDYVLF-GEEAGS-KLIKAKELEVKCIDESAFNELVKE------
DNLJ_WOLSU       LLTSLGAKVVSSVSKKSDFLLY-GESAGS-KLEKARELGVRCVNEEELGEILES------
DNLJ_HELHP       LLESKGAKISSSVSKKTDFVIY-GEKAGS-KLEKAQSLNITTLNEEEFLAQINK------
DNLJ_HELAH       ILENLGAKISSSVSAKTDFLIV-GENAGS-KLSLAQKHGVNILNEEELLKYLKE------
DNLJ_CLOTE       KLEALGAKVSGSVSKKTDFVLA-GEEAGS-KYNKAMELGIRIITEEEFNEMIN-------
DNLJ1_CLOAB      KLESLGAKVAGSVSKKTDYVIA-GENAGS-KYDKAVALGVKILTEEKFEELIESVK----
DNLJ_MARHV       KLEQLGAKVAGSVSKKTACVVA-GEAAGS-KLAKAEQLGVPVLDEEGLANLLREHGIEV-
DNLJ_ALCBS       ALQQLGAKVAGSVSKNTRMVVA-GASAGS-KLAKAESLGIEVCDEAALLSLLNQHGIDPG
DNLJ_IDILO       ALEALGAKVASSVSKKTTALVA-GENAGS-KLTKAQSLGLDILDENALAELLSD------
DNLJ_COLP3       ALQSLGAKVSGSVSKNTHFVVA-GDKAGS-KLTKAQDLGISVLTEDGLVALLAEHGITI-
DNLJ_SHEAM       KLEALGAKVAGSVSKNTHCVVA-GEAAGS-KLAKAQELGIPVLDEAGLIELIGL------
DNLJ_SACD2       KLQALGAKVSGSVSAKTTCVVA-GPGAGS-KLAKAEKLGLAILDEVGLLALLEEHGV---
DNLJ_CHRSD       RLQALGAKVSGSVSKKTAGVVA-GEAAGS-KLEKAQNLGVEVIDEREFLQRLAHWESASS
DNLJ_LEGPA       KLLALGAKVSGSVSSKTDYVIA-GSEAGS-KLIKATELGVAIIEEDEFLKWVNS------
DNLJ_MAGMM       RLEGLGAKVVASVSGKTGCLVC-GESAGS-KLAKAQKAGVPVLDEAALEGLFRGEIPPEI
DNLJ_NITMU       KIEAMGGKVAGSVSKKTDYVVA-GADAGS-KYDKALELGVALLDEAELIRLLQASQADNS
DNLJ_JANMA       KIEAAGGKVAGSVSKKTSYVVA-GADAGS-KLAKAEELGITILDESALLQLLDTHE----
DNLJ_METCA       RLEALGAKCTGSVSRNTSFVVA-GSEPGS-KLDKASELGVPVLDEKGFLDLLERGRP---
DNLJ_NITOC       RLQALGGKVNGSVSPHTDYLII-GANPGS-KLVKARNLGITILDETYFRNFLDDTSFP--
DNLJ_COXBU       KIERSGGKATSSVSKNTDYVIV-GENPGS-KYEKAKALGISLIDEEAFLKLLKS------
DNLJ_PSYCK       KLQALGAKVSGSISAKTTALLA-GDKAGS-KMAKAEKLGVKVVGEEEFLVLVGE------
DNLJ_HYDCU       LLEAQGAKITGSVSAKTDYVIA-GEKAGS-KLTKAESLGVAVLSEAEWLAMMPQQD----
DNLJ_FRATN       LLKSIGAKVTSSVSKKTDMVIC-GDNAGS-KLTKAQELGVEVILEDNLKDLL--------
DNLJ_DICNV       RLETLGAKVTSQVSRQTDFLLL-GADAGS-KLARAQAFSVPIIDEAQLQTWWQHYGNAV-
DNLJ_SODGM       HLVALGARVSGSVSAKTDLLIA-GEAAGS-KLSKAQQLNIPVMDEAEMMRLLGESSDA--
DNLJ_BAUCH       MLIALGARIRSSVSSKIDLLIA-GKNTGF-KLTKAKQLQIKIIEEAEFYQILGIR-----
DNLJ_BUCBP       LSKKLGIIVVSSVSKSVDYIII-GKKPGR-KLIKAKKFSIPGIYEKEFLNIINVYL----
DNLJ_BUCCC       ------------------------------------------------------------
DNLJ_BUCAI       ILLSLGAKISNNISRKTDFLIY-GNNFGS-KFFRAKDLDVKIINQEELNSLIRIKE----
DNLJ_WIGBR       ------------------------------------------------------------
DNLJ_BLOPB       ------------------------------------------------------------
DNLJ_BLOFL       ------------------------------------------------------------
DNLJ_BORA1       HILAAGGKVSGSVSKKTAYVVA-GEEAGS-KLVKARELGVTILDEDGLKALLSQ------
DNLJ_PSESM       KLESLGAKVSGSVSAKTHTVVA-GPGAGS-KLTKANELGLTVLDEEALLKRLTELGVAVD
DNLJ_RALSO       MLEAAGAKVSGSVSKKTDYVVA-GVEAGS-KLARAQELGVRVLDEAGMLALLQNPPGDSA
DNLJ_XYLFT       RLESLGAKIVGSVSKKTSFLVA-GEDPGS-KLDKAHALHVDIWDEARLLAFLEQYSAQ--
DNLJ_NEIG1       LIEAAGGKVSGSVSKKTDYVVA-GETAGS-KLEKANALGVSVLSEAELLTLLC-------
DNLJ_BDEBA       LIERNGGKILGSVSSKLNYLVV-GDDPGS-KVEKAQGLGVKIISWEELQAMI--------
DNLJ_GEOSL       MVEKEGGHAAGSVSKKTDYVVA-GAEAGS-KLDKARQLGVRVLTEDEFLAMLEEG-----
DNLJ_PELCD       MVERLGGRASGSVSKKTDCVVA-GEAAGS-KLEKARQLNIQILSEEEFLQMIDTLEEA--
DNLJ_SYNAS       IVESLGGQAAGTVTKKTDYVVA-GEAAGS-KLQKAQKAGIAILSEEEFLRLAGKI-----
DNLJ_SYNFM       LTASRGARVSDSVSRKTDIVVA-GADPGS-KVEKARQLGITILDEREFLERLGM------
DNLJ_MYXXD       EVERRGGKVAGSVSRKTDFVVA-GEDAGS-KLKKAQELGVRILDEQAFLQMLQTNA----
DNLJ_ANADF       EIERRGGKVSGSVSRKTDLVVA-GAEAGS-KLEKAQALGVRVVGEEEFLRMLEE------
DNLJ_HALHL       AIEACGGRVTGSVSRKTDYLVA-GADAGS-KLNKARELGVEVVNESGLRELLAGAGA---
DNLJ_NATPD       LVETSGGTATGSVSGNTDYLVV-GDSPGQRKREAANEHGVETLSQSDFESLLESHGIEI-
DNLJ_HALWD       YIERHGGNATGSVSSNTDYLVI-GDNPGSTKRIDAERNDVPEIDETEFTELLAEHDDTLT
DNLJ_SALRD       FVEQHGANATSSVSGNTDYVVA-GPGAGS-KRDDADDRGIPVLDEDAFHALLREQGIDA-
DNLJ_LISW6       LIESLGGNVSGSVSKKTDVVVA-GSDAG-SKLAKAEELAIPIWSEEDLIEYLPDEGGLN-
DNLJ_STAS1       WLALQGAKVTNSVTKNTDLVIA-GEDAG-SKLAKAEKFGTEIWSEEAFVQKQNEIEG---
DNLJ_GEOSE       QIERLGGRVTGSVSRSTDLVIA-GEDAG-SKLEKAQQLGIEIWDESRFLQEINRGKR---
DNLJ_ENTFA       KIENLGGKVTGSVSKKTDIVVA-GEDAG-SKLTKAESLGVTVWNEQEMVDALDASHF---
DNLJ_STRS2       KLEALGANVAGSVSKKTNLVVA-GTDAG-SKLTKAQELGIEIKDEAWLESL---------
DNLJ_LACS1       WLEAHGAKVTGSVSKKTDLLIA-GHDAG-SKLTKAQELNVRVMNEAEFIQQMEEES----
DNLJ_LACPL       WLQAHGATVMGSVSKKTDLVIA-GSDAG-SKLQKAQQLDITVWDEARFSETMREDAQA--
DNLJ_OENOB       WLEEHGANVSSSVSSKTDLLIA-GSDVG-SKLERANKLGIKVINEQDFINLSNAKK----
DNLJ_LEUMM       WLQDHGANVAGSVSVKTDLVIA-GEAAG-SKLDKASQLGVTVWTEQQFVDEQVKEDGK--
DNLJ_PEDPA       RLISLGADVAGSVSKKTDILIA-GADAG-SKLTKAQALGIEILDETEAIAKFEQ------
DNLJ_LACDB       KLQALGAKVTGSVSKKTDCLVY-GEDAG-SKLAKAEALDIPRLTEAEAISKIEEKDTEK-
DNLJ_SYMTH       LIQQLGGKAAGSVSRKTSFVVA-GEAAG-SKLQKAQELGIPVLTEDEFCERYLQG-----
DNLJ_MOOTA       LITRAGGKVSSSVSRKTDYVVA-GEKPG-SKLDRARELGVPVINADGLRQLLRQ------
DNLJ_DESHY       MIEEFGGKAASSVSKKTAFVVA-GEKAG-SKLAKAKELGIPVLSEEEFAELLP-------
DNLJ_CARHZ       LILSLGGKVSSSVSKKTSYVVV-GEDPG-SKLTKAKELGIPILTEEEFRQMVMS------
DNLJ_HUNT2       IIKSFGGKTSGSVSKKTDYVLA-GEDAG-SKLQKAKELGIEIIDEDKFRKMIE-------
DNLJ_CALS8       ILESLGARVSESVSKKTTAVIV-GEDPG-SKLTKAQELNVKILYEQDFERLISAKSHEEV
DNLJ_CALS4       LIVERGGKVTNSVSKKTDYLIV-GADPG-SKLKKAQELGVKIINEEQFEAMLKGDIQP--
DNLJ_CLOD6       MIEKRGGKATSSVSKSTTFVLA-GEEAG-SKLTKANDLGIKVIDEERFLELLKLSSKDEV
DNLJ_SYNWW       MIESRGGKVSSSVSKKTSYVVA-GDDPG-SKLDKALQLELTILDEAGFLNLLGLS-----
DNLJ_THEMA       FLEKLGAKVVNSVSRNTDYLIV-GENPG-SKYERAKMLKVKMMSEEEFLEFVRKRAELKG
DNLJ_AQUAE       IVEMLGGKFSNSVTSKTDYLVV-GKDPGATKLSKAKKYGVKTITEEEFVNMIKDYVDLEK
DNLJ_SOLUE       LIEQAGGKVASAVSKKTSYVVA-GEDAG-SKLDKAHQLNIRVITEAELHAMLRGE-----
DNLJ_KORVE       LIEDAGGKVSGSVSKKTNYVVA-GEEAG-SKLDKARDLGVAVIDEDALKKLLGK------
DNLJ_SYNE7       LIEAAGGKVSGSVSKKTSYVVA-GEEAG-SKLEKAIALNIPQLNETQLLDLLAQAEG---
DNLJ_SYNJA       WIESRGGKVTASVSRQTDYVVV-GSDPG-SKLKQAQALGIPLLSEAELLALDPK------
DNLJ_SYNY3       LIEQSGGKVTSSVSTKTDYVLL-GDKPG-SKAAKAESLGIKLLSEAEFLQLLEP------
DNLJ_GLOVI       LIESHGGKVTSSVSSRTSYVVA-GEKAG-SKLARAQDLKVAVLDEEQLRALIETREMP--
DNLJ_PROMT       LIESAGGKVSSSISKKTDFLVS-GEKAG-SKLNKAQELGVKIINENELKLLL--------
DNLJ_PROMA       LIEREGGKVNSSVSSKTNYLVA-GEKPG-NKLKKAKELGIKVINEQELMTLISN------
DNLJ_PARD8       MIEQHGGKNSGSVSGKTDYILA-GENMGPAKLEKAAKLGVKIINEDAFLNMLE-------
DNLJ_PORGI       MVEDNGGRMAGSVSSKTSFILA-GSDMGPSKREKAEKLGVRLMSEEEFLRLIEE------
DNLJ_GRAFK       MIEDNGGKLSSSISSKTNYLVA-GDNMGPSKLAKAEKLGTSIISEEDFLKMLE-------
DNLJ_CYTH3       LILKNGGKISSGITGKLNYLVA-GENMGPAKLEKAQKLNITILSEAEFISLLNS------
DNLJ_PELLD       LVLERGGKIVSTVSKKTGLVVA-GREAG-SKLEKALKLGLRVISEEEFEAML--------
DNLJ_CHLPN       AIRNCGGKVGSSVSKQTDYVVM-GNNPG-SKLEKARKLGVSILDQEAFTNLIHLE-----
DNLJ_CHLMU       RIRSLGGKISSSVSKNTYAVVV-GREAG-SKLKKAQELGVQVLEESDLLKILNQN-----
DNLJ_PARUW       LIKERGGKVSDSVSRKTNYVVA-GAEPG-SKLDKARTLGIPVLNEKEFISLCH-------
DNLJ_RHOMR       LIKRAGGRVASSVSRNTDYVVV-GENPG-SKYDRARQLGIPMLDEDGLLRLLGMK-----
DNLJ_RUBXD       LIEGAGGTVTSSVSRNTDYLVA-GENPG-SKLERARELGVPVLDEEGLRRLLSGEERPG-
DNLJ_ROSS1       LITAHGGKVSGSVSKKTDYLVI-GAEPGGTKFAKAQELGIPMIDEAGLLALIGSGRTADD
DNLJ_THEFI       LLQRLGAKVTDSVSRKTSYLVV-GENPG-SKLEKARALGVAVLTEEEFWRFLKEKG----
DNLJ_DEIRA       ELEAAGGRVTGSVTKKTSYLVA-GEDAG-SKLARAGELGVPVLDEAGLAALLAERGLGER
DNLJ_DEHMC       KIRSLGGTAKDNVTKATSYLVV-GADAG-SKLAKARSMGVKELSEREFINMLEQS-----
DNLJ_DESAG       MAEKAGAAVMSGVSARLDILVA-GDKPG-SKLEKARSLGITVLTEDEFIRQASESEEISG
DNLJ1_DESVV      MAEAAGAHVVSNVSKSLDMIVA-GADAG-SKLDQAKSLGLHVIDEDAFANLLKGLDR---
DNLJ_LAWIP       LAEEAGAIVMTGISHKLDYVIA-GKNPG-SKLNKAQELHISILDEPTFLQKLLIVL----
DNLJ_RHOBA       RIEELGGRAASSVSKKTDFLIA-GEKAGS-KLTKAESLGVEVLSEDDFRLRYETEAT---
DNLJ2_STRCO      LIERAGGRSSSSVSKNTSLVVA-GEGAGS-KRAKAEQLGVRLATPEEFAVLVAGLLS---
DNLJ1_NOCFA      LCEKAGATAASSVSANTDLLIT-GAGVGESKLAKAEKLGVEIVDQATIWAQLIEAKLV--
DNLJ_PSYIN       QAKALGAKVAKSVTGKTSLLVT-GDKVGANKINAARDKGVQVLSELDYLALISTY-----
DNLJ_DESPS       QAKALGATVGKSITGKTDMLVT-GQRVGATKMAKAETLGIAILSEEAYRQLVSLD-----
DNLJ_RUTMC       HAKSIGIKVSTSISAKIDYLVI-GDKVGQKKIKDAEKFGVVVMTETDYLSKI--------
DNLJ_VESOH       HAKLVGIKVSTTISTKIDYLVI-GSRVGQKKIQNAEKLGVVVMTEADYLSKITM------
DNLJ_DESAL       NARSLGANVQKAVTGKTDYLIC-GAKVGAKKTQKAQDLGVTVLTEQEYLQLVEGGESQSS
                                                                             

DNLJ_TREDE       ---------------------------------
DNLJ_TREPA       ---------------------------------
DNLJ_THEFY       AARLSED-----ESVLS----------------
DNLJ_FRACC       KLAVPADGPEKAETPVE----------------
DNLJ_SACEN       EAALPAE--------------------------
DNLJ_NOCSJ       -AAL-----------------------------
DNLJ_ARTS2       DSADASADDDDAGVGDRPEDHQEEPAE------
DNLJ_CUTAK       TIG------------------------------
DNLJ_CORJK       DDASTSADSVDD---------------------
DNLJ_LEIXX       EVAE-----------------------------
DNLJ_BIFLO       ---------------------------------
DNLJ_TROWT       ---------------------------------
DNLJ_RHORT       ---------------------------------
DNLJ_MAGSA       ---------------------------------
DNLJ_CHESB       ---------------------------------
DNLJ_BRADU       ---------------------------------
DNLJ_RHILO       ---------------------------------
DNLJ_BARBK       ---------------------------------
DNLJ_PARDP       ---------------------------------
DNLJ_MARMM       ---------------------------------
DNLJ_HYPNA       ---------------------------------
DNLJ_CAUVC       ---------------------------------
DNLJ_SPHAL       ---------------------------------
DNLJ_ZYMMO       KI-------------------------------
DNLJ_RHOPB       ---------------------------------
DNLJ_GLUOX       ---------------------------------
DNLJ_PELPD       ---------------------------------
DNLJ_RICTY       ---------------------------------
DNLJ_ORITB       ---------------------------------
DNLJ_WOLTR       ---------------------------------
DNLJ_EHRRW       ---------------------------------
DNLJ_ANAPZ       ---------------------------------
DNLJ_NEOSM       KKETSSN--------------------------
DNLJ_PELUB       ---------------------------------
DNLJ_SPICI       ---------------------------------
DNLJ_MESFL       ---------------------------------
DNLJ_UREPA       ---------------------------------
DNLJ_MYCPE       ---------------------------------
DNLJ_MYCPN       ---------------------------------
DNLJ_MYCGA       ---------------------------------
DNLJ_MYCMO       ---------------------------------
DNLJ_MYCS5       ---------------------------------
DNLJ_MYCPU       ---------------------------------
DNLJ_MYCH7       ---------------------------------
DNLJ_FUSNN       ---------------------------------
DNLJ_LEPIC       NLI------------------------------
DNLJ_BORBU       ---------------------------------
DNLJ_ONYPE       ---------------------------------
DNLJ_NITSB       ---------------------------------
DNLJ_SULDN       ---------------------------------
DNLJ_CAMHC       ---------------------------------
DNLJ_CAMJJ       ---------------------------------
DNLJ_WOLSU       ---------------------------------
DNLJ_HELHP       ---------------------------------
DNLJ_HELAH       ---------------------------------
DNLJ_CLOTE       ---------------------------------
DNLJ1_CLOAB      ---------------------------------
DNLJ_MARHV       ---------------------------------
DNLJ_ALCBS       AL-------------------------------
DNLJ_IDILO       ---------------------------------
DNLJ_COLP3       ---------------------------------
DNLJ_SHEAM       ---------------------------------
DNLJ_SACD2       ---------------------------------
DNLJ_CHRSD       EDAQPTAPEDTP---------------------
DNLJ_LEGPA       ---------------------------------
DNLJ_MAGMM       QARMQG---------------------------
DNLJ_NITMU       STHVDPERMV-----------------------
DNLJ_JANMA       ---------------------------------
DNLJ_METCA       ---------------------------------
DNLJ_NITOC       ---------------------------------
DNLJ_COXBU       ---------------------------------
DNLJ_PSYCK       ---------------------------------
DNLJ_HYDCU       ---------------------------------
DNLJ_FRATN       ---------------------------------
DNLJ_DICNV       ---------------------------------
DNLJ_SODGM       ---------------------------------
DNLJ_BAUCH       ---------------------------------
DNLJ_BUCBP       ---------------------------------
DNLJ_BUCCC       ---------------------------------
DNLJ_BUCAI       ---------------------------------
DNLJ_WIGBR       ---------------------------------
DNLJ_BLOPB       ---------------------------------
DNLJ_BLOFL       ---------------------------------
DNLJ_BORA1       ---------------------------------
DNLJ_PSESM       ---------------------------------
DNLJ_RALSO       ---------------------------------
DNLJ_XYLFT       ---------------------------------
DNLJ_NEIG1       ---------------------------------
DNLJ_BDEBA       ---------------------------------
DNLJ_GEOSL       ---------------------------------
DNLJ_PELCD       ---------------------------------
DNLJ_SYNAS       ---------------------------------
DNLJ_SYNFM       ---------------------------------
DNLJ_MYXXD       ---------------------------------
DNLJ_ANADF       ---------------------------------
DNLJ_HALHL       ---------------------------------
DNLJ_NATPD       ---------------------------------
DNLJ_HALWD       WPP------------------------------
DNLJ_SALRD       ---------------------------------
DNLJ_LISW6       ---------------------------------
DNLJ_STAS1       ---------------------------------
DNLJ_GEOSE       ---------------------------------
DNLJ_ENTFA       ---------------------------------
DNLJ_STRS2       ---------------------------------
DNLJ_LACS1       ---------------------------------
DNLJ_LACPL       ---------------------------------
DNLJ_OENOB       ---------------------------------
DNLJ_LEUMM       ---------------------------------
DNLJ_PEDPA       ---------------------------------
DNLJ_LACDB       ---------------------------------
DNLJ_SYMTH       ---------------------------------
DNLJ_MOOTA       ---------------------------------
DNLJ_DESHY       ---------------------------------
DNLJ_CARHZ       ---------------------------------
DNLJ_HUNT2       ---------------------------------
DNLJ_CALS8       EKILME---------------------------
DNLJ_CALS4       ---------------------------------
DNLJ_CLOD6       KAVLES---------------------------
DNLJ_SYNWW       ---------------------------------
DNLJ_THEMA       YNFDEIMRSWKEWS-------------------
DNLJ_AQUAE       IKKEDKKEKPKIGRLF-----------------
DNLJ_SOLUE       ---------------------------------
DNLJ_KORVE       ---------------------------------
DNLJ_SYNE7       ---------------------------------
DNLJ_SYNJA       ---------------------------------
DNLJ_SYNY3       ---------------------------------
DNLJ_GLOVI       ---------------------------------
DNLJ_PROMT       ---------------------------------
DNLJ_PROMA       ---------------------------------
DNLJ_PARD8       ---------------------------------
DNLJ_PORGI       ---------------------------------
DNLJ_GRAFK       ---------------------------------
DNLJ_CYTH3       ---------------------------------
DNLJ_PELLD       ---------------------------------
DNLJ_CHLPN       ---------------------------------
DNLJ_CHLMU       ---------------------------------
DNLJ_PARUW       ---------------------------------
DNLJ_RHOMR       ---------------------------------
DNLJ_RUBXD       ---------------------------------
DNLJ_ROSS1       QATPASDRRAATASVPPSDDAPGSPRQLDFDLT
DNLJ_THEFI       --------------APVPA--------------
DNLJ_DEIRA       GVAEDGMSGAETEAAPAES--------------
DNLJ_DEHMC       ---------------------------------
DNLJ_DESAG       QAADDYENSLLRVQ-------------------
DNLJ1_DESVV      ---------------------------------
DNLJ_LAWIP       ---------------------------------
DNLJ_RHOBA       ---------------------------------
DNLJ2_STRCO      ---------------------------------
DNLJ1_NOCFA      ---------------------------------
DNLJ_PSYIN       ---------------------------------
DNLJ_DESPS       ---------------------------------
DNLJ_RUTMC       ---------------------------------
DNLJ_VESOH       ---------------------------------
DNLJ_DESAL       PEQMSLF--------------------------