CLUSTAL format seed alignment for MF_01589

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

CMOA_ARCB4       ----------------------------MIDKVFNKS--ITKQFEFDEEVASVFDDMLNR
CMOA_SULDN       ----------------------------MNDKVFTKA--IKKQFEFDEEVAAVFDDMLQR
CMOA_NITSB       ---------------------------MEKDKVFAKP--IEKRFEFDEEVASVFDDMIAR
CMOA_SULNB       ----------------------------MKDKVFEKP--IEKKFEFDQAVASVFDDMLSR
CMOA_CAMFF       ----------------------------MRDEVFKRP--IKKQFEFDESVVSVFDDMVSR
CMOA_CAMHC       ----------------------------MKDEIFKNE--IKKQFEFDENVASVFDDMISR
CMOA_CAMJE       ----------------------------MKDELFKQS--PKKQFEFDKSVASVFDDMINR
CMOA_CAMJR       ----------------------------MKDELFKQS--PKKQFEFDKSVASVFDDMINR
CMOA_CAMJJ       ----------------------------MKDELFKQS--PKKQFEFDKSVASVFDDMINR
CMOA_CAMJD       ----------------------------MKDELFKQN--PKKQFEFDKSVASVFDDMINR
CMOA_CAMJ8       ----------------------------MKDELFKQS--PKKQFEFDKSVASVFDDMINR
CMOA_HELPY       ----------------------------MKDTLFNES--LNKRFCFDEKVAHVFDDMLER
CMOA_HELPJ       ----------------------------MKDTLFNES--LNKRFCFDEKVAHVFDDMLER
CMOA_HELPH       ----------------------------MKDTLFNQS--LNKRFCFDEKVAHVFDDMLER
CMOA_HELAH       ----------------------------MKDTLFNEA--LGKRFCFDERVAHVFDDMLER
CMOA_HELHP       ----------------------------MKDRIFKQD--IGKQFEFDAQVASVFDDMLER
CMOA_WOLSU       ----------------------------MRDELFTEE--LKKQFEFDERVAGVFDDMLSR
CMOA_DESPS       -------------------------MTDKKDTIFQNPG-PAEDFEFNSRVVEVFDDMLDR
CMOA_ALCBS       -------------------MHTGAFMSDQQDRIYATSHSQVGRFSFDDTVVRVFPDMIRR
CMOA_MARHV       -------------------MSNRTPPEQLTDRLFATERNPED-FRFDASVARVFPDMIRR
CMOA_HAHCH       -------------------------MSDSKDQIYQDAKGAVGAFEFDERVAHVFTDMINR
CMOA_GEOMG       -------------------------MTHKTDAIYAAPLQKMIDFQFDERVVAVFPDMIQR
CMOA_SACD2       -----------------------MDDTSQRDNIYAAPHDNVGEFIFDKKVVDVFPDMIKR
CMOA_HYDCU       -----------------MLISRYTGIPILKDTLYAHPYEAVGEFQFDDSVVAVFPDMIQR
CMOA_AERHH       --------------------------MHTKDQIFAAPIARLGDFCFDEQVVDVFPDMIQR
CMOA_AERS4       --------------------------MHTKDQIFAAPIARLGDFCFDEQVVDVFPDMIQR
CMOA_ACTP2       ---------------------------MNKDTIFSAPIEKLGDFTFDESVAEVFPDMIQR
CMOA_HAEDU       ---------------------------MNRDTIFSTPIEKLGDFTFDESVADVFPDMIQR
CMOA_HAEI8       ---------------------------MVKDTLFSTPIAKLGDFIFDENVAEVFPDMIQR
CMOA_HAEIG       ---------------------------MVKDTLFSTPIAKLGDFIFDENVAEVFPDMIQR
CMOA_HAEIN       ---------------------------MVKDTLFSTPIAKLGDFIFDENVAEVFPDMIQR
CMOA_HAEIE       ---------------------------MVKDTLFSTPIAKLGDFIFDENVAEVFPDMIQR
CMOA_MANSM       ---------------------------MSKDTIFSTPIEKLGDFTFDENVAEVFPDMIQR
CMOA_PASMU       ---------------------------MTKDTLFSTPIAKLGDFTFDESVAEVFPDMIQR
CMOA_HAES1       ---------------------------MNKDCIFAAPIEKLGDFTFDENVAEVFPDMIQR
CMOA_PHOPR       -----------------------MRMAGQ-DNIFAAPIEKLGDFTFDQKVAEVFPDMIQR
CMOA_ALIF1       -------------------------MANP-DTIFSTPIDKIGDFTFDERVAEVFPDMIQR
CMOA_VIBCB       ----------------------MNPKSNP-DTIFSAPIDKIGDFTFDERVAEVFPDMIQR
CMOA_VIBPA       ----------------------MNPKSNP-DTIFSAPIDKIGDFTFDERVAEVFPDMIQR
CMOA_VIBVU       ----------------------MNPKSNP-DTIFSAPIDKIGDFTFDERVAEVFPDMIQR
CMOA_VIBVY       ----------------------MNPKSNP-DTIFSAPIDKIGDFTFDERVAEVFPDMIQR
CMOA_VIBCH       ----------------------MRSAMNPKDTLFSAPIDKIGDFTFDERVAEVFPDMIQR
CMOA_SHIBS       --------------------------MSHRDTLFSAPIARLGDWTFDERVAEVFPDMIQR
CMOA_SHIF8       --------------------------MSHRDTLFSAPIARLGDWTFDERVAEVFPDMIQR
CMOA_SHIFL       --------------------------MSHRDTLFSAPIARLGDWTFDERVAEVFPDMIQR
CMOA_SHIDS       --------------------------MSHRDTLFSAPIARLGDWTFDERVAEVFPDMIQR
CMOA_ECOL5       --------------------------MSHRDTLFSAPIARLGDWTFDERVAEVFPDMIQR
CMOA_ECOL6       --------------------------MSHRDTLFSAPIARLGDWTFDERVAEVFPDMIQR
CMOA_ECOK1       --------------------------MSHRDTLFSAPIARLGDWTFDERVAEVFPDMIQR
CMOA_ECO57       --------------------------MSHRDTLFSAPIARLGDWTFDERVAEVFPDMIQR
CMOA_ECOUT       --------------------------MSHRDTLFSAPIARLGDWTFDERVAEVFPDMIQR
CMOA_SHISS       --------------------------MSHRDTLFSAPIARLGDWTFDERVAEVFPDMIQR
CMOA_ECOLI       --------------------------MSHRDTLFSAPIARLGDWTFDERVAEVFPDMIQR
CMOA_CITK8       --------------------------MSHRDTLFSAPIASLGDWTFDERVAEVFPDMIQR
CMOA_SALPA       --------------------------MSHRDTLFSAPIARLGDWTFDERVAEVFPDMIQR
CMOA_SALTI       --------------------------MSHRDTLFSAPIARLGDWTFDERVAEVFPDMIQR
CMOA_SALTY       --------------------------MSHRDTLFSAPIARLGDWTFDERVAEVFPDMIQR
CMOA_SALCH       --------------------------MSHRDTLFSAPIARLGDWTFDERVAEVFPDMIQR
CMOA_KLEP7       --------------------------MSHRDTLFSAPIASLGDWTFDERVAEVFPDMIQR
CMOA_CROS8       --------------------------MSNRDTLFSAPIARLGDWTFDERVAEVFPDMIQR
CMOA_YERPE       ------MPNRDTQSQNDTPRHSPEAAEPQRDSLFAAPIAKLGDWTFDEKVAEVFPDMIQR
CMOA_YERPA       ------MPNRDTQSQNDTPRHSPEAAEPQRDSLFAAPIAKLGDWTFDEKVAEVFPDMIQR
CMOA_YERPN       ------MPNRDTQSQNDTPRHSPEAAEPQRDSLFAAPIAKLGDWTFDEKVAEVFPDMIQR
CMOA_YERPP       ------MPNRDTQSQNDTPRHSPEAAEPQRDSLFAAPIAKLGDWTFDEKVAEVFPDMIQR
CMOA2_YERPS      ------MPNRDTQSQNDTPRHSPEAAEPQRDSLFAAPIAKLGDWTFDEKVAEVFPDMIQR
CMOA_YERE8       ------MPKRETQSLHDTQQQ-PGPTAPQRDSLFAAPIAKLGDWTFDEKVAEVFPDMISR
CMOA_SODGM       --------------------------MTHRDDLFSAPIASLGDWTFDERVAEVFPDMIQR
CMOA_PECAS       --------------------------MPNRDMLFSVPIANLGDWTFDERVADVFPDMIQR
CMOA_PHOLL       --------------------MSNQDPHHQRDSLFATPIANLGDWRFDERVAEVFPDMIQR
CMOA_COLP3       ------------------------MHDSDTDLIYSQAHNQVKNFTFDAQVVEVFPDMISR
CMOA_PSYIN       --------------------------MSKTDNIYSKRRAQIDGFSFDEQVVQVFPDMIKR
CMOA_SHEB5       -------------------------MNVSQDTIYAQASEHISDFQFDNRVAGVFSDMIRR
CMOA_SHEB8       -------------------------MNVSQDTIYAQASEHISDFQFDNRVAGVFSDMIRR
CMOA_SHEPC       -------------------------MNTSQDTIYAQPNEHISDFQFDNRVAGVFSDMIRR
CMOA_SHESW       -------------------------MNTSQDTIYAQPNEHISDFQFDNRVAGVFSDMIRR
CMOA_SHESA       -------------------------MNASQDTIYAQASEHISDFQFDNRVAGVFSDMIRR
CMOA_SHESM       -------------------------MNASQDTIYAQASEHISDFQFDNRVAGVFSDMIRR
CMOA_SHESR       -------------------------MNASQDTIYAQASEHISDFQFDNRVAGVFSDMIRR
CMOA_SHEON       -------------------------MNASQDTIYAQVSEHISDFQFDSRVAGVFSDMIRR
CMOA_SHELP       -------------------------MNSTQDTIYAQACEHISDFQFDDRVAGVFSDMIRR
CMOA_SHEDO       -------------------------MNSKQDRIYAKPAQTISDFQFDSRVAGVFNDMIRR
CMOA_SHEFN       -------------------------MNSQQDTIYAHVTDQITDFQFDQRVAGVFNDMIRR
CMOA_SHEAM       -------------------------MTNQQDTLFAEPGEHQGNFQFDSRVAGVFGDMIRR
CMOA_PSEAE       -------------------------MS-ESDRLFAQPQQRVADFVFNEDVVRVFPDMIKR
CMOA_PSEAB       -------------------------MS-ESDRLFAQPQQRVADFVFNEDVVRVFPDMIKR
CMOA_PSEE4       -------------------------MSKEPDRLFAQPLEQVPDFVFNEDVVQVFPDMIKR
CMOA_PSEPK       -------------------------MSKQPDRLFSQPLEQVPDFVFNEDVVRVFPDMIKR
CMOA_PSEF5       -------------------------MSKEPDRLFAQPLAQVPDFAFNEDVVRVFPDMIKR
CMOA_PSEPF       -------------------------MSKEPDRIFAQPMAQVPDFAFNEDVVRVFPDMIKR
CMOA_PSE14       -------------------------MSKETDRIFAQPLAQVPDFAFNEDVVRVFPDMIKR
CMOA_PSEU2       -------------------------MSKETDRIFAQPLSQVPDFAFNEDVVRVFPDMIKR
CMOA_PSESM       -------------------------MSKEPDRLFAQPLPQVPDFAFNEDVVRVFPDMIKR
CMOA_PSEU5       -------------------------MSHDPDRLFAQPLARVQDFVFNEDVARVFPDMIKR
CMOA_PSEA6       -------------------------MQSSKDAIYSQP-QQVSDFRFDDTVAEVFPDMIQR
CMOA_PSEHT       --------------------------MTIKDSIYASE-QQVKDFSFDQNVVEVFPDMIQR
CMOA_IDILO       --------------------------MTQHDTIFSKPLPSISDFCFDQQVVEVFPDMINR
CMOA_RUTMC       ----------------------------MRDNIFTKE-NDLVNFAFDSQVANVFDDMVKR
CMOA_PSYA2       MSHPMSQSQ---------------PATVKHDTLFTTPLDKAARFSFDEQVVACFPDMIRR
CMOA_PSYCK       MSHTMSQSQ---------------PTTVKHDTLFTTPLDKAARFSFDEQVVACFPDMIRR
CMOA_CHRSD       MTRRVQYRHFLWPRPRLDAIDWLMSDASYRDAIFSTPLDRVANFSFDEKVVACFPDMIRR
CMOA_DICNV       ------------------------MNEFFRDDIFNRP-QNVVDFRFDERTAAVFPDMIHR
CMOA_PELCD       ---------------------------MTKDSLFSRPQKPVPPFEFNASVVEVFDDMLNR
CMOA_METCA       ---------------------------MSRDEIYRQSQSFLDDFGFGESVATVFDDMLER
CMOA_NITOC       --------MKGVDDTDLVPDSAGEGSRVFHDQLFAESNSAIEDFRFDGATASVFDDMVHR
CMOA_STAEQ       ---------------------------MNYNPFQWTFK--------SEQTANEFNEHVEK
CMOA_TRIEI       ---------------MTEPLETELYLSSEKDELFEKG-PWPKPFAFNAEVVKVFDNMVCR
CMOA1_YERPS      ---------------------------MNIDKIFENP-SNLRSFEFNNDVCKVFDDMVSR
                                               : .             .  .   * : : :

CMOA_ARCB4       SVPFYKEMQRLSINFACNFLSENDK---------VYDLGCSTASTLIEL-SKHCKHNLK-
CMOA_SULDN       SVPFYKESQKISEFFAQKALQNGGI---------AYDLGCSTATLLINI-SRKLQNKAT-
CMOA_NITSB       SVPFYKENMALVRDIVVKNVVQKDR---------VYDLGCSTGSLLIDI-AKRSPFSLE-
CMOA_SULNB       SVPFYDEVRHLVISLILAEQREGMK---------VLDLGASTAKFLLDL-HSKMEAGMQ-
CMOA_CAMFF       SVPYYCDVQALISLILSKNLSPNAK---------VFDLGCSTATTLLEI-FKL-RSDLS-
CMOA_CAMHC       SVPYYRESCELSGEILARSLKEKAK---------IIDLGCSTAEFLIAL-HHK-RPDFE-
CMOA_CAMJE       SVPFYRENLELCGNLLAKILPTNAS---------VCDLGCSSANFLIFL-ANL-RKDFK-
CMOA_CAMJR       SVPFYRENLELCGNLLAKILPTNAS---------VCDLGCSSANFLIFL-ANL-RKDFK-
CMOA_CAMJJ       SVPFYRENLELCGNLLAKILSTNAS---------VCDLGCSSANFLIFL-ANL-RKDFK-
CMOA_CAMJD       SVPFYRENLELCGNLLAKILPTNAS---------ICDLGCSSANFLIFL-ANL-RKDFK-
CMOA_CAMJ8       SVPFYRENLELCGNLLAKILPINAS---------ICDLGCSSANFLIFL-ANL-RKDFK-
CMOA_HELPY       SIPYYHEMLNLGAYFIAQNLKENIYPKSL-PKPLIYDLGCSTGNFFIALNRQIQQ-EIE-
CMOA_HELPJ       SIPYYHEMLNLGAYFIAQNLKENVYHKSL-PKPLIYDLGCSTGNFFIALNQQIQQ-DIE-
CMOA_HELPH       SIPYYYEMLDLGAYFIAQNLKENLN-----AKPLIYDLGCSTGNFFIALNRQIQQ-EIE-
CMOA_HELAH       SIPYYHEMLNLGAYFIAQNLKESIN-----PKPLIYDLGCSTGNFFVVLNKQIQQ-DIE-
CMOA_HELHP       SIPHYKEVLGLIVDFCSYTLESSKS-----AIPLVYDLGSSTGTTLLALSQALST-HTR-
CMOA_WOLSU       SIPYYALALELSADFALANLPKEGG--------WVYDLGCSTGSLLLEIERRAGAKNPR-
CMOA_DESPS       SVPFYKEVIQASAQLLQRHLKENDS---------VYDLGSSTGTTLLELSRVLKRQDIS-
CMOA_ALCBS       SVPGYPTIIDMIGVLAARYAQPD---------TCLYDLGCSLGAAATAMATLTGDTGNP-
CMOA_MARHV       SVPGYTTIIPMIEVITEQYVQPG---------SHCYDLGCSLGASTLAMRHGIPYPDCT-
CMOA_HAHCH       SVPGYAMMLEMIGVISRRYAQAG---------AHCYDLGCSLGASTLAIRSNLKHFNESD
CMOA_GEOMG       SVPGYGMIISNIGIVAAKYAQAG---------SHCYDLGCSLGAVSLAMRQRITQPDCD-
CMOA_SACD2       SVPGYSTIIHMIGQMAERYAKAD---------STCYDLGCSLGAATLAMRHRISAAGVS-
CMOA_HYDCU       SVPGYQTILTGIGELTAKYAQPN---------SQLYDLGCSLGAATLTMRRKAPQGSQ--
CMOA_AERHH       SVPGYSNIISAIGMMAARYAQPQ---------SRLYDLGCSLGAATQAMRRHV-TQPGC-
CMOA_AERS4       SVPGYSNIISAIGMMAARYAQPQ---------SRLYDLGCSLGAATQAMRRHL-TQPGC-
CMOA_ACTP2       SVPGYSNIITAIGMLAQRFVTEG---------SQVYDLGCSRGAGILSIRRNL-QTNQV-
CMOA_HAEDU       SIPGYSNIITAIGMLAERFVTEG---------SNVYDLGCSRGASILAIRRNA-PTKNF-
CMOA_HAEI8       SVPGYSNIITAIGMLAERFVTAD---------SNVYDLGCSRGAATLSARRNI-HQPNV-
CMOA_HAEIG       SVPGYSNIITAIGMLAERFVTAD---------SNVYDLGCSRGAATLSARRNI-HQPNV-
CMOA_HAEIN       SVPGYSNIITAIGMLAERFVTAD---------SNVYDLGCSRGAATLSARRNI-NQPNV-
CMOA_HAEIE       SVPGYSNIITAIGMLAERFVTAD---------SNVYDLGCSRGAATLSARRNI-HQPNV-
CMOA_MANSM       SVPGYSNIITAIGMLAERFVTAD---------SNVYDLGCSRGAATLSARRNI-KQANV-
CMOA_PASMU       SIPGYANIITAIGMLASRFVTAN---------SNVYDLGCSRGAATLSARRHI-NQPGV-
CMOA_HAES1       SVPGYSNIITAIGMFAERFVTAN---------SLVYDLGCSRGAATLSARRHI-TQPNV-
CMOA_PHOPR       SVPGYSNIISAIGMLAERFAKPH---------SKIYDLGCSLGAATLSMRRSI-QQEGC-
CMOA_ALIF1       SIPGYSNIISAIGMLAERYAKPH---------SNVYDLGCSLGAATLSMRRSI-DQEGC-
CMOA_VIBCB       SVPGYSNIISAIGMLAERFVKPH---------SNIYDLGCSLGAATLSMRRHI-KQEGC-
CMOA_VIBPA       SVPGYSNIISAIGMLAERFVKPH---------SNIYDLGCSLGAATLSMRRHI-KQEGC-
CMOA_VIBVU       SVPGYSNIISAIGMLAERFVKPH---------SNVYDLGCSLGAATLSMRRHI-KQEGC-
CMOA_VIBVY       SVPGYSNIISAIGMLAERFVKPH---------SNVYDLGCSLGAATLSMRRHI-KQEGC-
CMOA_VIBCH       SVPGYSNIISAIGMLAERFVKPH---------SKIYDLGCSLGAATLSMRRHI-KQEGC-
CMOA_SHIBS       SVPGYSNIISMISMLAERFVQPG---------TQVYDLGCSLGAATLSVRRNI-HHDNC-
CMOA_SHIF8       SVPGYSNIISMIGMLAERFVQPG---------TQVYDLGCSLGAATLSVRRNI-HHDNC-
CMOA_SHIFL       SVPGYSNIISMIGMLAERFVQPG---------TQVYDLGCSLGAATLSVRRNI-HHDNC-
CMOA_SHIDS       SVPGYSNIISMIGMLAERFVQPG---------TQVYDLGCSLGAATLSVRRNI-HHDNC-
CMOA_ECOL5       SVPGYSNIISMIGMLAERFVQPG---------TQVYDLGCSLGAATLSVRRNI-HHDNC-
CMOA_ECOL6       SVPGYSNIISMIGMLAERFVQPG---------TQVYDLGCSLGAATLSVRRNI-HHDNC-
CMOA_ECOK1       SVPGYSNIISMIGMLAERFVQPG---------TQVYDLGCSLGAATLSVRRNI-HHDNC-
CMOA_ECO57       SVPGYSNIISMIGMLAERFVQPG---------TQVYDLGCSLGAATLSVRRNI-HHDNC-
CMOA_ECOUT       SVPGYSNIISMIGMLAERFVQPG---------TQVYDLGCSLGAATLSVRRNI-HHDNC-
CMOA_SHISS       SVPGYSNIISMIGMLAERFVQPG---------TQVYDLGCSLGAATLSVRRNI-HHDNC-
CMOA_ECOLI       SVPGYSNIISMIGMLAERFVQPG---------TQVYDLGCSLGAATLSVRRNI-HHDNC-
CMOA_CITK8       SVPGYSNIISMIGMLAERFVQPN---------TQVYDLGCSLGAATLSVRRNI-HHANC-
CMOA_SALPA       SVPGYSNIISMIGMLAERFVQPN---------TQVYDLGCSLGAATLSVRRNI-RHEHC-
CMOA_SALTI       SVPGYSNIISMIGMLAERFVQPN---------TQVYDLGCSLGAATLSVRRNI-RHEHC-
CMOA_SALTY       SVPGYSNIISMIGMLAERFVQPN---------TQVYDLGCSLGAATLSVRRNI-RHEHC-
CMOA_SALCH       SVPGYSNIISMIGMLAERFVQPN---------TQVYDLGCSLGAATLSVRRNI-RHEHC-
CMOA_KLEP7       SVPGYSNIISMIGMLAERFVQPN---------TQVYDLGCSLGAATLSVRRNI-SHPDC-
CMOA_CROS8       SVPGYSNIISMIGMLAERFVQPA---------SQVYDLGCSLGAATLSVRRNV-HHDGC-
CMOA_YERPE       SVPGYSNIISMIGMLAERFVQPN---------SQIYDLGCSLGAATLSMRRNI-KAEGC-
CMOA_YERPA       SVPGYSNIISMIGMLAERFVQPN---------SQIYDLGCSLGAATLSMRRNI-KAEGC-
CMOA_YERPN       SVPGYSNIISMIGMLAERFVQPN---------SQIYDLGCSLGAATLSMRRNI-KAEGC-
CMOA_YERPP       SVPGYSNIISMIGMLAERFVQPN---------SQIYDLGCSLGAATLSMRRNI-KAEGC-
CMOA2_YERPS      SVPGYSNIISMIGMLAERFVQPN---------SQIYDLGCSLGAATLSMRRNI-KAEGC-
CMOA_YERE8       SVPGYSNIISMIGMLAERFVQPN---------SQIYDLGCSLGAATLSMRRNI-KVEGC-
CMOA_SODGM       SVPGYSNIISMIGMLAGRFARPG---------TQIYDLGCALGAATLAMRRTI-SHGDC-
CMOA_PECAS       SVPGYSNIISMIGMLAERFARSN---------SLVYDLGCSLGAATLSMRRNI-HVPDC-
CMOA_PHOLL       SVPGYSNIVSMIGMLAGRFVTSN---------SQIYDMGCSLGASTLAMRRNI-VAENC-
CMOA_COLP3       SVPGYKTIIDTIGRLSERFTQDD---------SNIYDLGCSLGAATLAMRKGI-TANNC-
CMOA_PSYIN       SVPGYETIINSIGTITERCAVEN---------SNLYDLGCSLGAATLSMRRGL-NKAGC-
CMOA_SHEB5       SVPGYTQIINTIGDFADRFVMPN---------TQIYDLGCSLGAATLSIRRQI-QGRQC-
CMOA_SHEB8       SVPGYTQIINTIGDFADRFVMPN---------TQIYDLGCSLGAATLSIRRQI-QGRQC-
CMOA_SHEPC       SVPGYTQIINTIGDFADRFVMPN---------TQIYDLGCSLGAATLSIRRQI-QGRQC-
CMOA_SHESW       SVPGYTQIINTIGDFADRFVMPN---------TQIYDLGCSLGAATLSIRRQI-QGRQC-
CMOA_SHESA       SVPGYTQIINTIGDFADRFVKPN---------TQVYDLGCSLGAATLSIRRQI-QGRDC-
CMOA_SHESM       SVPGYTQIINTIGDFADRFVKPN---------TQVYDLGCSLGAATLSIRRQI-QGRDC-
CMOA_SHESR       SVPGYTQIINTIGDFADRFVKPN---------TQVYDLGCSLGAATLSIRRQI-QGRDC-
CMOA_SHEON       SVPGYTQIINTIGDFADRFVKPN---------TQVYDLGCSLGAATLSIRRQI-QGRDC-
CMOA_SHELP       SVPGYGQIINTLGDFADKCVTPN---------SKIYDLGCSLGAATLSVRRRI-EGRGC-
CMOA_SHEDO       SVPGYNQIIATLGDFARRYVTPN---------SKVFDLGSSLGSATLSIRRQI-EGRQC-
CMOA_SHEFN       SVPGYAQIINTIGDFANRFVTPQ---------SNIYDLGSSLGSATLSIRRQI-EGRGC-
CMOA_SHEAM       SVPGYTQIINTIGEIADRCVTPG---------SNVYDLGCSLGAATLAIRRKI-EGRNA-
CMOA_PSEAE       SVPGYPTIVENIGVLGAQFAQPN---------SVLYDLGCSLGAVTQSLRRHV-RNDGC-
CMOA_PSEAB       SVPGYPTIVENIGVLGAQFAQPN---------SVLYDLGCSLGAVTQSLRRHV-RNDGC-
CMOA_PSEE4       SVPGYPTIVENLGVLAARFAQPH---------SALYDLGASLGAVSQSLRRHV-RSDGC-
CMOA_PSEPK       SVPGYPTIVENLGVLAARFAQPG---------TALYDLGASLGAVTQSLRRHV-RSDGC-
CMOA_PSEF5       SVPGYPTIVENLGVLAAQFAQPN---------SVLYDLGSSLGAVTQALRRHV-RTDGC-
CMOA_PSEPF       SVPGYPTIVENLGVLAAQFAQPN---------SVLYDLGASLGAVTQALRRHV-RTDGC-
CMOA_PSE14       SVPGYPTIVENLGVLAAQFAQPD---------TVLYDLGSSLGAVTQALRRHV-RSEGC-
CMOA_PSEU2       SVPGYPTIVENLGVLAAQFAQPN---------TVLYDLGSSLGAVTQALRRHV-RGEGC-
CMOA_PSESM       SVPGYPAIVENLGVLAAQFAQPD---------TVLYDLGCSLGAVTQALRRHV-RSDGC-
CMOA_PSEU5       SVPGYPTIVENIGVIAAQFAQPN---------TRLYDLGCSLGAVTQALRRHV-SQDNC-
CMOA_PSEA6       SVPGYNTIVDAIGQLAGRYATNN---------SNIYDLGCSLGAVSLAAAKYV-VADNC-
CMOA_PSEHT       SVPGYATIVSTMGKLAGEYAQSN---------SNLYDLGCSLGAVTLSMRRNI-RTDNC-
CMOA_IDILO       SVPGYSSILQTLPQIVSRYVQPN---------SHLYDLGCSLGAATLAIRKGCEQTENC-
CMOA_RUTMC       SVPAYQSMIEMISLSVKTYGQDN---------TNYYDLGASTGATSIALGINNPHSNNQ-
CMOA_PSYA2       SVPGYGQVLAMLPIFARRHCKYRQQGDNGQRVSRIYDLGCSLGAASMTLAGEFESQDLQ-
CMOA_PSYCK       SVPGYGQVLAMLPIFARRHCKYRQQSDSGQRVSRIYDLGCSLGAASMTLAGEFEPQDLQ-
CMOA_CHRSD       SVPGYGQILGMLGLIAERHLRFG---------AHVYDLGCSLGAVTLALAGRLPPDAFT-
CMOA_DICNV       SIPAYASLLHMLGVIAGTYVQEG---------DHIYDLGCSLGGATLSLSRFIPKTAHI-
CMOA_PELCD       SVPCYRELIHRQAQLAAHFYQPK---------TRIYDLGCSTGNLDLAICSAMDAARPF-
CMOA_METCA       SVPFYAELQRMIAEMAGDFAMPH---------TRIYDFGCSTGTTLIGLDQAI--GPRG-
CMOA_NITOC       SVPFYDEMQRMTEEITADFAVPG---------TNLFDLGCATGTTLLRLDAAL--DPR--
CMOA_STAEQ       SVPFYKEIHKIVKIIGGFFVEEN---------TNVYDIGSSTGNLLKGMSNIL--KRN--
CMOA_TRIEI       SVPLYREVVAGAVHWTRAYYQPK---------TRIIDIGCSTGTFLELLGRFLKQPAIL-
CMOA1_YERPS      SVPGYHNIQDIISLTYDEFSQNR----------VFIDVGCSTGTTIAKILSEN-QVNYC-
                 *:* *                               *.*.: .                 

CMOA_ARCB4       ----LIGIDNSDAMLKRASNKAKAFGV-------EIELINADLHDVTYNDAKLILSNYTL
CMOA_SULDN       ----LIGLDNSEAMLQRARKKCEAFKA-------DIELENADILEYDYREANLFISNYTL
CMOA_NITSB       ----LIGLDSSEAMLQRAHHKAKAFGV-------SIDFQKADIISYAYKPAKIFISNYTL
CMOA_SULNB       ----LKGIDNSPAMLERAEQKCQAFGA-------SIDLALADMMEYSYEEEDIIVANYTL
CMOA_CAMFF       ----LNGVDSSEAMIKTARNRSLAYLA-------NLNLYVSDILDFDFSGSDAVILNYTL
CMOA_CAMHC       ----LFGVDNSESMLKIAKRKSMAHGA-------KIDFKNEDILNCDLKGFDCAILNYTL
CMOA_CAMJE       ----LFGVDNSASMLEVAKSKAKAYGL-------DISFFEANLCEFDFFTCDVFVANYTM
CMOA_CAMJR       ----LFGVDNSASMLEVAKSKAKAYGL-------DISFFEANLCEFDFFTCDVFVANYTM
CMOA_CAMJJ       ----LFGVDNSASMLEVAKSKAKAYGL-------DISFFEANLCEFDFFVCDVFVANYTM
CMOA_CAMJD       ----LFGVDNSASMLEVAKSKAKAYGL-------DISFFEANLCEFDFFICDVFVANYTM
CMOA_CAMJ8       ----LFGVDNSASMVEVAKSKAKAYGL-------DISFFETNLCEFDFFVCDVFVANYTM
CMOA_HELPY       ----LVGIDNSMPMLKKAQEKLKDFN--------NARFECMDFLEVEFKEASAFSLLFVL
CMOA_HELPJ       ----LVGIDNSMPMLKKAQEKLKDFN--------NVRFECMDFLEVKFKEASAFSLLFVL
CMOA_HELPH       ----LVGIDNSMPMLKKAQEKLKDFN--------NVRFECMDFLEVEFKEASAFSLLFVL
CMOA_HELAH       ----LIGIDNSMPMLKKAQEKLKDFK--------NTHFECVDFLEIDFKEASAFSLLFVL
CMOA_HELHP       ----FIGIDSSQAMIDKASLKAQAYNA-------NIEFICTDLLEYDFLHSDIVIANYSL
CMOA_WOLSU       ----LIGIDNSEAMLSRARAKALGYGS-------RVDFIQGDILDFEYQKSEVILCHYTL
CMOA_DESPS       ----YVGIDASKPMLEKARLKAELYSKG-----DQFSFLEEDITQFCHQEAGAVILHYTL
CMOA_ALCBS       ----IVAVDNSRAMIEQAENLLSQA-----GQAHRVTLQEGDVAEMAFNSCSMAVLNFTL
CMOA_MARHV       ----LVGVDNSEAMIERCEHYVALD-----DHDLPVTLRCEDILSTELSNASVTTLNFTL
CMOA_HAHCH       NKPKVIGVDNSAAMVERCRVNMERM-----PSVIPTEILCQDILSTPIENASIAVMNFTL
CMOA_GEOMG       ----IIAVDNSPAMIARGRELLALDT----APTVPVTMICADLQEVAIENASVVVLNFTL
CMOA_SACD2       ----IVGVDNSSDMIERAKQVIDAD-----SYDVPVTLRCEDINQTPISNASVVVLNFTL
CMOA_HYDCU       ----IIAVDTSQPMIERAKEHIEGF-----HSDIPVRLLCDDMTQIPIENASVVVINFTL
CMOA_AERHH       ---HITAVDLSHPMIERARAHLSG-----FKSEVPVELVEADICDIAIENASVVVLNFTL
CMOA_AERS4       ---HITAVDLSHPMIERARAHLSG-----FKSEVPVALVEADICDIAIENASVVVLNFTL
CMOA_ACTP2       ---KIIGVDNSQPMVERCRSHINA-----YHSEVPVEILCDDIRHIEIKNASMVVLNFTL
CMOA_HAEDU       ---RIIGVDNSRPMVERCRSHLSA-----YHSDIPVNIVCDDIRNIEIQNASMVVLNFTL
CMOA_HAEI8       ---KIIGIDNSQPMVERCRQHIAA-----YHSEVPVEILCDDIRHVEIKNASMVILNFTL
CMOA_HAEIG       ---KIIGIDNSQPMVERCRQHIAA-----YHSEIPVEILCNDIRHVEIKNASMVILNFTL
CMOA_HAEIN       ---KIIGIDNSQPMVERCRQHIAA-----YHSEIPVEILCNDIRHVEIKNASMVILNFTL
CMOA_HAEIE       ---KIIGIDNSQPMVERCCQHIAA-----YHSEIPVEILCNDIRHVEIKNASMVILNFTL
CMOA_MANSM       ---KIIGVDNSQPMAERARQHIHA-----YHSEIPVEILCDDIRNIAIENASMVILNFTL
CMOA_PASMU       ---KIIGVDNSQPMVDRCRQHVSA-----YQSTIPVDIICDDIRHIEIENASMVILNFTL
CMOA_HAES1       ---KIIGVDNSLPMVERCRQHINA-----YQSDIPVEILCDDIRNIKIENASMVILNFTL
CMOA_PHOPR       ---EIIAVDNSAAMVERCRLHIDA-----YRSDTPVQVVEADIRNIDIADASVVVLNFTL
CMOA_ALIF1       ---QIIGVDNSSAMVERCRLLINA-----YRSDTPVTILEADIRDVDIQDASVVVLNFTL
CMOA_VIBCB       ---QIIAVDNSPAMVERCKLHVNA-----YRSDTPVDVVEADIRNIEIENASVVVLNFTL
CMOA_VIBPA       ---KIIAVDNSPAMVERCKLHVNA-----YRSDTPVTVVEADIRNIEIENASVVVLNFTL
CMOA_VIBVU       ---QIIAVDNSKAMVERCKLHVNA-----YRSDTPVNVIEADIRHIDIENASVVVLNFTL
CMOA_VIBVY       ---QIIAVDNSKAMVERCKLHVNA-----YRSDTPVNVIEADIRNIDIENASVVVLNFTL
CMOA_VIBCH       ---QIIAVDNSAAMVERCKLHLNA-----YRSDTPVQVIEADIRDIAIENASVVVLNFTL
CMOA_SHIBS       ---KIIAIDNSPAMIERCRRHIDA-----YKAPTPVDVIEGDIRDIAIENASMVVLNFTL
CMOA_SHIF8       ---KIIAIDNSPAMIERCRRHIDA-----YKAPTPVDVIEGDIRDIAIENASMVVLNFTL
CMOA_SHIFL       ---KIIAIDNSPAMIERCRRHIDA-----YKAPTPVDVIEGDIRDIAIENASMVVLNFTL
CMOA_SHIDS       ---KIIAIDNSPAMIERCRRHIDA-----YKAPTPVDVIEGDIRDIAIENASMVVLNFTL
CMOA_ECOL5       ---KIIAIDNSPAMIERCRRHIDA-----YKAPTPVDVIEGDIRDIAIENASMVVLNFTL
CMOA_ECOL6       ---KIIAIDNSPAMIERCRRHIDA-----YKAPTPVDVIEGDIRDIAIENASMVVLNFTL
CMOA_ECOK1       ---KIIAIDNSPAMIERCRRHIDA-----YKAPTPVDVIEGDIRDIAIENASMVVLNFTL
CMOA_ECO57       ---KIIAIDNSPAMIERCRRHIDA-----YKAPTPVDVIEGDIRDIAIENASMVVLNFTL
CMOA_ECOUT       ---KIIAIDNSPAMIERCRRHIDA-----YKAPTPVDVIEGDIRDIAIENASMVVLNFTL
CMOA_SHISS       ---KIIAIDNSPAMIERCSRHIDA-----YKAPTPVDVIEGDIRDIAIENASMVVLNFTL
CMOA_ECOLI       ---KIIAIDNSPAMIERCRRHIDA-----YKAPTPVDVIEGDIRDIAIENASMVVLNFTL
CMOA_CITK8       ---KIIAVDNSPAMIERCRRHIDA-----YKAPTPVEIVEGDIRDISIENASMVVLNFTL
CMOA_SALPA       ---RIIAVDNSPAMIERCRRHIDA-----YKAPTPVEVVEGDIRDITIENASMVVLNFTL
CMOA_SALTI       ---RIIAVDNSPAMIERCRRHIDA-----YKAPTPVEVVEGDIRDITIENASMVVLNFTL
CMOA_SALTY       ---RIIAVDNSPAMIERCRRHIDA-----YKAPTPVEVVEGDIRDITIENASMVVLNFTL
CMOA_SALCH       ---RIIAVDNSPAMIERCRRHIDA-----YKAPTPVEVVEGDIRDITIENASMVVLNFTL
CMOA_KLEP7       ---RIIAIDNSPAMVERCRRHIDA-----YKAPTPVEVIEGDIRDVTIENASLVILNFTI
CMOA_CROS8       ---KIIAVDNSPAMVERCRRHIDA-----FKAQTPVEVIEDDIRNITIENASMVVLNFTL
CMOA_YERPE       ---KIIAVDNSPAMVERCRRHIDA-----FRAETPVDVVEADILDIKLENASMVVLNFTL
CMOA_YERPA       ---KIIAVDNSPAMVERCRRHIDA-----FRAETPVDVVEADILDIKLENASMVVLNFTL
CMOA_YERPN       ---KIIAVDNSPAMVERCRRHIDA-----FRAETPVDVVEADILDIKLENASMVVLNFTL
CMOA_YERPP       ---KIIAVDNSPAMVERCRRHIDA-----FRAETPVDVVEADILDIKLENASMVVLNFTL
CMOA2_YERPS      ---KIIAVDNSPAMVERCRRHIDA-----FRAETPVDVVEADILDIKLENASMVVLNFTL
CMOA_YERE8       ---KIIAVDNSPAMIERCRRHIDA-----FRAETPVDVVESDILDIQLENASMVVLNFTL
CMOA_SODGM       ---RIIAVDNSPAMIDRCRRHISA-----FHATTPTEIIEDDISTVPIENASLVVLNFTM
CMOA_PECAS       ---KIIAVDNSPAMVKRCRGHIDA-----FRSETPVEVIEADILNIDIKNASMVVLNFTL
CMOA_PHOLL       ---KIIAVDNSPAMVERCRRHIDA-----FRSQTPVEVIEADILNIDIQNASMVVLNFTL
CMOA_COLP3       ---KIIGVDNSIDMVKRCKMHVDA-----FKGDTPVTIIEGNIQDIDIENASMVVLNFTL
CMOA_PSYIN       ---QIIAVDNSQQMVERCEQYIHA-----YKSDTPVQVLCDDICNIHIENASVVILNFTL
CMOA_SHEB5       ---RIIAVDNSESMVARCQENLNA-----YVSDTDVDLVCGDIRDIDIQNASLVVLNFTL
CMOA_SHEB8       ---RIIAVDNSESMVARCQENLNA-----YVSDTDVDLVCGDIRDIDIQNASLVVLNFTL
CMOA_SHEPC       ---RIIAVDNSESMVARCQENLNA-----YVSDTDVDLVCGDIRDIDIQNASLVVLNFTL
CMOA_SHESW       ---RIIAVDNSESMVARCQENLNA-----YVSDTDVDLVCGDIRDIDIQNASLVVLNFTL
CMOA_SHESA       ---RIIAVDNSESMVTRCQENLNA-----YVSDTEVELICGDIRDIHIENASLVVLNFTL
CMOA_SHESM       ---RIIAVDNSESMVTRCQENLNA-----YVSDTEVELICGDIRDIHIENASLVVLNFTL
CMOA_SHESR       ---RIIAVDNSESMVTRCQENLSA-----YVSDTEVELICGDIRDIHIENASLVVLNFTL
CMOA_SHEON       ---RIVAVDNSESMVIRCQENLNA-----YVSDTEVELICGDIRDIHIENASLVVLNFTL
CMOA_SHELP       ---EIIAVDNSESMIERCKQNLSA-----YVSETPVDLICADIRDIEIQDASMVILNFTM
CMOA_SHEDO       ---QIIAIDNSQSMIERCEENLAA-----YVSDTQVTLVCDDIRNVDINNASMVVLNFTL
CMOA_SHEFN       ---QIYAVDNSQSMIERCTENLAA-----YVSDIKVNLLCADIRDIDIKNASMVVLNFTL
CMOA_SHEAM       ---RIFAIDNSEPMLVRAEENLSA-----YVSDTKVFFQLADIRDQTFENASLVVLNFTL
CMOA_PSEAE       ---RVIGVDNSHAMIERCSEYLHAQDA-MYQELLPVELIEADILALDLQPTSLVAMNFTL
CMOA_PSEAB       ---RVIGVDNSHAMIERCSEYLHAQDA-MYQELLPVELIEADILALDLQPTSLVAMNFTL
CMOA_PSEE4       ---RVIAVDNSAAMVERCRQYLTAQDS-MFQELLPVQVLEADILTLPFEPASVVAMNFTL
CMOA_PSEPK       ---RVIAVDNSAAMVERCRQYLTAQDS-MFQELLPVQVLEADILALPFEPASVVAMNFTL
CMOA_PSEF5       ---RVIAVDNSAAMVERCREYLNGQDS-MFQELLPVQVIEGDILALEFQPASVVALNFTL
CMOA_PSEPF       ---RVIAVDNSAAMVERCREYLNGQDS-MFQELLPVEVIEGDILALDFKPASVVALNFTL
CMOA_PSE14       ---EVIAIDNSSAMVERCREYLNAQNS-MFQELLPVQVIEGDILALEFKPASVVALNFTL
CMOA_PSEU2       ---EVIAIDNSSAMVERCREYLNAQDS-MFQELLPVQVLEGDILALAFKPASVVALNFTL
CMOA_PSESM       ---EVIAIDNSTAMVERCREYLNAQNS-MFQELLPVQVIEGDILALAFKPASVVALNFTL
CMOA_PSEU5       ---QVIAVDNSTAMVERCREYLHAQDS-MYQELLPVEVLEADILALEFQSSSLVALNFTL
CMOA_PSEA6       ---SIIAVDNSEAMAQRCARHVKA-----YKANTPIEVICDDLQNIHIENASSVVMNFTL
CMOA_PSEHT       ---HIIAVDNSQAMVERCKVHLQG-----FKSEVPVTVTLGDINELEIQNASVVAMNFTL
CMOA_IDILO       ---KIIGIDNSQPMIERAQLHLDG-----FKSQIPVELHCQDLAETEIKNASVVVLNFTL
CMOA_RUTMC       ----IIALDNSPDMVKKCQQNLAG-------KIDNVDVICGDILDMKFENASIIVLNLTL
CMOA_PSYA2       ----IKAIDISPAMTTEATTLLSD-----NYPEHDIEVITADIRDIEFEPCDMVILNLTL
CMOA_PSYCK       ----IKAIDISPAMTTEATTLLND-----NYPEHDIEVITADIRDIELEPCDMVILNLTL
CMOA_CHRSD       ----LTGVDLSPTMVARARETLGE-----ECPDHRIDIVEGDIRHVDYRPAGMIVLNFTL
CMOA_DICNV       -----TAVDSSPAMVQRFRAYVEG------AALHHIEVLEADIIHLPLKSSRVIVMNFVL
CMOA_PELCD       ---ELVGVDNSEPMLKVCRERMRE-----TPPEANISFACSDIRNLEMSNASVIILNLTL
CMOA_METCA       --LTLVGVDNSQEMLAKCRAKMAGH----AFANAVELIRADLNQGVVMENASLALMILTL
CMOA_NITOC       --VHFIGVDNSLEMLEKGRQKFLAR----KSTRRCEFMAADLHRERIIEDASVVIMILTL
CMOA_STAEQ       --ANYIGIDNSIYMN-----QVAMN----DADSDNIKIISEDVQDFKFTNASYITSILTL
CMOA_TRIEI       -----VGIDNSSDMLDKAKEKLAQ-----VEQIHQIELICESAENCSFEKSSVVVMNYTL
CMOA1_YERPS      -----YGIDISESMLAIAQEKCGEHESLVTFKNCNLLNGTDNVINSEK-VPDFIILNLVL
                       .:* *  *                                             :

CMOA_ARCB4       QFIRPLQREKLVKKIYDSLDEKGIFIFSEKVISTNSNLNKQCIDEYYEFKKTQGYSEFEI
CMOA_SULDN       QFVRPLIREELVKKIASSLKKDGLFIFSEKVISHHSKLHKDLIECYYDFKKEQGYSEYEI
CMOA_NITSB       QFIRPLKREPLVQKIYDALVDEGIFVFSEKVISADKTLDKQLLDIYFDFKKKQGYSDFEI
CMOA_SULNB       QFIRPMQRIELVKRLYESLNEGGMFIFSEKVVFEDKRLDKEMIDIYYDYKKTQGYSEYEI
CMOA_CAMFF       QFIRPIKREEFIKKIYSNLKSGGIFIFSEKLVYEDKKLTLDMIEIYENYKHSQGYSKFEI
CMOA_CAMHC       QFIRPIKRSDFVAKIYSNLANNGILIMAEKLIYDDKTLAAQMIEIYENYKQKQGYSAFEI
CMOA_CAMJE       QFIRPPKRQELLDQIYKNLNSKGILIMSEKILYEDAFLSKNIIELYADYKEKQGYSKFEI
CMOA_CAMJR       QFIRPPKRQELLDQIYKNLNSKGILIMSEKILYEDAFLSKNIIELYADYKEKQGYSKFEI
CMOA_CAMJJ       QFIRPPKRQELLDKIYKNLNSKGILIMSEKILYEDAFLSKNIIELYADYKEKQGYSKFEI
CMOA_CAMJD       QFIRPPKRQELLDKIYKNLNSKGILIMSEKILYEDAFLSKNIIELYADYKEKQGYSKFEI
CMOA_CAMJ8       QFIRPPKRQELLDKIYKNLNSKGILIMSEKILYEDAFLSKNIIELYADYKEKQGYSKFEI
CMOA_HELPY       QFVRPMQREVLLKKIYNSLALNGVLLVGEKIMSEDRILDKQMIELYYLYKQNQGYSHNEI
CMOA_HELPJ       QFVRPMQREVLLKKIYNSLALNGVLLVGEKIMSEDRILDKQMIELYYLYKQNQGYSHNEI
CMOA_HELPH       QFVRPMQREVLLKKIYNSLALNGVLLVGEKIMSEDRILDKQMIELYYLYKQNQGYSHNEI
CMOA_HELAH       QFIRPMQREVLLKKIYNSLALNGVLLVGEKIMSEDRILDKQMIELYYLYKQNQGYSHNEI
CMOA_HELHP       QFIRPMQRPALLQKIYNALTEGGILIVSEKMTSHHRILDRQMIERYVRYKQEQGYTKTEI
CMOA_WOLSU       QFIRPIHRAYLVQKLYDSLKPEGILIFSEKVVSEDRVLDHQMIERYYAYKREQGYSEVEI
CMOA_DESPS       QFIRPMQREEVMRRIYASLRPGGVLLLSEKTISHQKELNRDFISIYHHFKKDRGYSELEI
CMOA_ALCBS       QFIALEKRDALIRRLADATVPGGILVLSEKIRFANDAENALQTELHHAFKRNNGYSDLEI
CMOA_MARHV       QFVPPEQRLALLTRIGDATLPGGVLVLSEKIRFESDAEQAIQTRLHHEFKRANGYSDLEI
CMOA_HAHCH       QFIPLAQREDLLHRIAVNMKPGGAMVLSEKIEFADTDKQHTLFDLHHDFKRSRGYSDLEI
CMOA_GEOMG       QFIPPAERLALLERIHAGLRPGGVLILSEKIAFGEPGRQQFHEELHHDFKRANGYSDLEI
CMOA_SACD2       QFIPKQQRQSLLANIYAGMNQGGILILSEKLTFEDAHHDELVTDLHHYFKKTNGYSELEI
CMOA_HYDCU       QFIEPSARQVLLDKIYQGLKPGGILILSEKIHFESAELQEAIEHLQLQFKRANGYSELEI
CMOA_AERHH       QFVEPEKRAALIQRIFDGLRPGGILILSEKFRFEDAPVNELLIDLHLDFKRANGYSELEI
CMOA_AERS4       QFVDPEKRMALIQRIFDGLRPGGILILSEKFRFEDEPVNDLLIELHLDFKRANGYSELEI
CMOA_ACTP2       QFLPRADRLELLTKIYQGLNPNGILVLSEKFTFENQVMNELLIDLHHTFKRANGYSELEV
CMOA_HAEDU       QFLPRTDRIALLTKIYHGLNPNGILILSEKFSFVDNTIDELLVDLHHTFKRANGYSELEV
CMOA_HAEI8       QFLPPEDRVALLTKIYEGLNPNGVLVLSEKFRFEDTKIDHLLIDLHHQFKRANGYSELEV
CMOA_HAEIG       QFLPPEDRVALLTKIYEGLNPNGVLVLSEKFRFEDTKIDHLLIDLHHQFKRANGYSELEV
CMOA_HAEIN       QFLPPEDRIALLTKIYEGLNPNGVLVLSEKFRFEDTKINHLLIDLHHQFKRANGYSELEV
CMOA_HAEIE       QFLPPEDRVALLIKIYEGLNPNGVLVLSEKFRFEDTKVNHLLIDLHHQFKRANGYSELEV
CMOA_MANSM       QFLPPEDRRALLEKIYRGLNQGGLLVLSEKFRFEDETINNLLIDLHHTFKRANGYSELEV
CMOA_PASMU       QFLPPEDRRSLLSKIYQGLQPNGILVLSEKFHFEDQNMNALLIDLHHQFKRANGYSELEV
CMOA_HAES1       QFVPQQDRQLLLEKIYQGLNPNGGLVLSEKFRFENKKMDDLLIDFHHQFKRANGYSELEV
CMOA_PHOPR       QFLVPEDRQMLLEKIYAGLRPGGILILSEKYIFDDEQAHELLINLHHDFKRANGYSELEI
CMOA_ALIF1       QFLAPADRHALLEKIYAGLRPGGILILSEKYIFEDENANELLIDLHHDFKRANGYSELEI
CMOA_VIBCB       QFLSPEDRYALLEKIYAGLRPGGILILSEKFVFEDEVSNELLIDLHHDFKRANGYSELEI
CMOA_VIBPA       QFLSPEDRYALLEKIYAGLRPGGILILSEKFVFEDEVSNELLIDLHHDFKRANGYSELEI
CMOA_VIBVU       QFLSPEDRYVLLEKIYAGLRPGGILILSEKYVFEDQVSNELLIDLHHDFKRANGYSELEI
CMOA_VIBVY       QFLSPEDRYVLLEKIYAGLRPGGILILSEKYVFEDQVSNELLIDLHHDFKRANGYSELEI
CMOA_VIBCH       QFLAPDDRYALLEKIYAGLRPGGILILSEKFVFSDQEAHELLIDLHHDFKRANGYSELEI
CMOA_SHIBS       QFLEPSERQALLDKIYQGLNPGGALVLSEKFSFEDAKVGELLFNMHHDFKRANGYSELEI
CMOA_SHIF8       QFLEPSERQALLDKIYQGLNPGGALVLSEKFSFEDAKVGELLFNMHHDFKRANGYSELEI
CMOA_SHIFL       QFLEPSERQALLDKIYQGLNPGGALVLSEKFSFEDAKVGELLFNMHHDFKRANGYSELEI
CMOA_SHIDS       QFLEPSERQALLDKIYQGLNPGGALVLSEKFSFEDAKVGELLFNMHHDFKRANGYSELEI
CMOA_ECOL5       QFLEPSERQALLDKIYQGLNPGGALVLSEKFSFEDAKVGELLFNMHHDFKRANGYSELEI
CMOA_ECOL6       QFLEPSERQALLDKIYQGLNPGGALVLSEKFSFEDAKVGELLFNMHHDFKRANGYSELEI
CMOA_ECOK1       QFLEPSERQALLDKIYQGLNPGGALVLSEKFSFEDAKVGELLFNMHHDFKRANGYSELEI
CMOA_ECO57       QFLEPSERQALLDKIYQGLNPGGALVLSEKFSFEDAKVGELLFNMHHDFKRANGYSELEI
CMOA_ECOUT       QFLEPSERQALLDKIYQGLNPGGALVLSEKFSFEDAKVGELLFNMHHDFKRANGYSELEI
CMOA_SHISS       QFLEPSERQALLDKIYQGLNPGGALVLSEKFSFEDAKVGELLFNMHHDFKRANGYSELEI
CMOA_ECOLI       QFLEPSERQALLDKIYQGLNPGGALVLSEKFSFEDAKVGELLFNMHHDFKRANGYSELEI
CMOA_CITK8       QFLEPLERQALLDKIYQGLNPGGALVLSEKFSFKDTTVGELLFNMHHDFKRANGYSELEI
CMOA_SALPA       QFLEPAERQALLDKIYLGLNPGGALVLSEKFSFEDAKVGELLFNMHHDFKRANGYSELEI
CMOA_SALTI       QFLEPAERQALLDKIYLGLNPGGALVLSEKFSFEDAKVGELLFNMHHDFKRANGYSELEI
CMOA_SALTY       QFLEPAERQALLDKIYLGLNPGGALVLSEKFSFEDAKVGELLFNMHHDFKRANGYSELEI
CMOA_SALCH       QFLEPAERQALLDKIYQGLNPGGALVLSEKFSFEDAKVGELLFNMHHDFKRANGYSELEI
CMOA_KLEP7       QFLEPGDRQAILNKVYQGLNPGGALVLSEKFSFEDAHVGELLFNMHHDFKRANGYSELEI
CMOA_CROS8       QFLNPDDRQLLLNKIFQGLNPGGALVLSEKFSFEDSVVGELLFNMHHDFKRANGYSELEI
CMOA_YERPE       QFLEPANRQRLLNQVYQGLRPGGALVLSEKFSFADHNVGELLFNMHHDFKRANGYSELEI
CMOA_YERPA       QFLEPANRQRLLNQVYQGLRPGGALVLSEKFSFADHNVGELLFNMHHDFKRANGYSELEI
CMOA_YERPN       QFLEPANRQRLLNQVYQGLRPGGALVLSEKFSFADHNVGELLFNMHHDFKRANGYSELEI
CMOA_YERPP       QFLEPANRQRLLNQVYQGLRPGGALVLSEKFSFADHNVGELLFNMHHDFKRANGYSELEI
CMOA2_YERPS      QFLEPANRQRLLNQVYQGLRPGGALVLSEKFSFADHNVGELLFNMHHDFKRANGYSELEI
CMOA_YERE8       QFLEPADRQRLLNQVYQGLRPGGALVLSEKFNFEDNDVGELLFNMHHDFKRANGYSELEI
CMOA_SODGM       QFLEPAQRQTLLNRIYAGLNTGGALVLSEKFSFQDQLIGGLLFDMHHDFKRANGYSELEI
CMOA_PECAS       QFLEPSQRQVLIERIYQGLNPGGVLVLSEKFNFADKDVGELLFNMHLDFKRANGYSELEI
CMOA_PHOLL       QFLNPQDRQGLLNRIYQGLRPGGVLVLSEKFSFEDQQIGELLFNMHHDFKRANGYSELEI
CMOA_COLP3       QFIEKSQRQALLSKIAQGLKPGGLLVLSEKISSDDNVIDDVLINLHHNFKRDNGYSELEV
CMOA_PSYIN       QFLTPEKRLNLLTNIYNGLLPGGVLVLSEKFVFEDPLNHQLLNDLHLDFKRSQGYSELEI
CMOA_SHEB5       QFLPPEDRETLIAKIYQGLNPGGILVLSEKIRFEDAPIQTLLEEQHLDFKRANGYSELEI
CMOA_SHEB8       QFLPPEDRETLIAKIYQGLNPGGILVLSEKIRFEDAPIQTLLEEQHLDFKRANGYSELEI
CMOA_SHEPC       QFLPPEDRETLIAKIYQGLNPGGILVLSEKIRFEDAPIQTLLEEQHLDFKRANGYSELEI
CMOA_SHESW       QFLPPEDRETLIAKIYQGLNPGGMLVLSEKIRFDDAPIQTLLEEQHLDFKRANGYSELEI
CMOA_SHESA       QFLPPEDREALIAKIYHGLNPGGLLVLSEKIRFDDAPIQSVLEELHLDFKRANGYSELEI
CMOA_SHESM       QFLPPEDREALIAKIYHGLNPGGLLVLSEKIRFDDAPIQSVLEELHLDFKRANGYSELEI
CMOA_SHESR       QFLPPEDREALIAKIYYGLNPGGLLVLSEKIRFDDAPIQSVLEELHLDFKRANGYSELEI
CMOA_SHEON       QFLPPEDRDALIAKIYQGLNPGGLLVLSEKIRFDDAPIQSVLEELHLDFKRANGYSELEI
CMOA_SHELP       QFLAPEDRQTLIAKIYQGLKPGGILVLSEKLVFEDEPVQHLLDELHLDFKRANGYSELEI
CMOA_SHEDO       QFLPPEDRDTLIKRIYDGMLPGGILVLSEKVKFDDACIQTLLDEQHLDFKRANGYSELEI
CMOA_SHEFN       QFLPTHDRDALIKRIYDGMLPGGILVISEKLFFEDNHIQQLLDEQHLDFKRANGYSELEI
CMOA_SHEAM       QFLPPDDRDTLLARIYQGLNPGGILLLSEKLKFDGVDVQALLDSLHLDFKRANGYSELEI
CMOA_PSEAE       QFVAPDQRLGLLRRIRQALLPGGALILSEKLRFADAQEHALLTDLHIAFKRANGYSELEI
CMOA_PSEAB       QFVAPDQRLGLLRRIRQALLPGGALILSEKLRFADAQEHALLTDLHIAFKRANGYSELEI
CMOA_PSEE4       QFIAPEQRLALLGRIRQALLPGGALILSEKLRFADDQEQQLLNELHLDFKRANGYSELEI
CMOA_PSEPK       QFIAPDQRLELLGRIRQALLPGGALILSEKLRFADEQEQDLLNELHLDFKRANGYSELEI
CMOA_PSEF5       QFIAPEQRLALLGRIRQSLLPGGALILSEKLRFNDDQEHALLTDLHIAFKRANGYSELEI
CMOA_PSEPF       QFIAPDQRTALLSRIRQSLLPGGALILSEKLRFNDAEEHALLTDLHVAFKRANGYSELEI
CMOA_PSE14       QFIAPEQRLILLGRIRDALVPGGALILSEKLRFDDEQEHALLTDLHIAFKRANGYSDLEI
CMOA_PSEU2       QFIAPEQRLALLGRIRDALVPGGALILSEKLRFDDPQEQALLTDLHIAFKRANGYSDLEI
CMOA_PSESM       QFVAPEQRLALLGRIRGALVPGGALILSEKLRFNDEQEHALLTDLHIAFKRANGYSDLEI
CMOA_PSEU5       QFIAPEQRPALLGRIRQALVPGGALILSEKLRFEDDEEQQLLTDLHIAFKRANGYSELEI
CMOA_PSEA6       QFIDPTQRDQIIQSIYDGLAPGGIFILSEKLRHASEQGNELLIDLHHEFKRRNGYSELEI
CMOA_PSEHT       QFIPHAQRQAVLEKIYANLKPGGVLLLSEKIKAENELCDNLLIDLHHDFKRHNGYSELEI
CMOA_IDILO       QFISQDKRDEVIQNIFNGMNKGGALLVAEKVRHPDESMNDLLIELHHNFKRANGYSELEI
CMOA_RUTMC       QFIAPNNRQALINRIYKDLNTNGALIISEKIHFNDQQKQKQIAKLHLNFKRANGYSELEI
CMOA_PSYA2       QFLPAADRVAVLEKIYAALSEGGILVLTEKTHAFDEQYDAWLVERYYDFKRANGYTEMEI
CMOA_PSYCK       QFLPAADRVAVLEKIYVALSEGGILVLTEKTHAFDEQYDAWLVERYYDFKRANGYTEMEI
CMOA_CHRSD       QFLPPEDRRAVIERLYAALEPGGVLVLSEKIVLPDEQENAWLVERYHDFKRANGYSDMEI
CMOA_DICNV       QFIPPPARDALIAKIYQALTEGGILLLAEKTQPED----DLLRTWHEAFKASQGYSALAI
CMOA_PELCD       QFIPPADRQNILNRIFQALVPGGILLLTEKTVHAHAGLSELQQDFYYRFKAENGYSQMEI
CMOA_METCA       QFVRPLYRDRLVRAIHDGLEENGALVLVEKVLGESSLFNRSFIKYYYEFKKRNGYTELEI
CMOA_NITOC       QFIRPLHRTRMLQGLIEGMNEQGCLIIFEKVTLNDSLFNRLFIRYYYNMKKRQGYSDVEI
CMOA_STAEQ       QFINIEDREKTIKNVYQGLNKGGAFILVEKVNGEFVQSHEIMNQIYHDFKLENGLTYEEV
CMOA_TRIEI       QFLSLPQRQKLLRAIYQGLVPGGLLFISEKIRSDCPQFQETITHHYEAFKAKNGYAQNEI
CMOA1_YERPS      QFIRPPERKKFITNIKSLCSSSTLMLVFEKIIFNDAEINMKYIDSYLKWKGKNGYSESEV
                 **:    *   :  :         :.. **                   *  .* :   :

CMOA_ARCB4       SQKREALENVLIPYTEDENKKMIKDAGFSHCETIFKWVNFATFIAIK-------
CMOA_SULDN       VQKREALENVLIPYSEEENIKMAKNCGFSHCEVVFRWANFATFIAIK-------
CMOA_NITSB       AQKREALENVLVPYTLEENMEMVKKCGFGFVEPIFRWANFVTFVAIKRKK----
CMOA_SULNB       AQKREALENVLIPFTIEENIRMCRDAGFRNISTIFQWANFVTFVAKK-------
CMOA_CAMFF       AQKRQALENILIPYSENENKELCLNAGFKSVETIFKWANFATFIAFK-------
CMOA_CAMHC       AQKRKALENILIPFSETENRQMLKNAGFKIVEVIFKWANFAVFLAKK-------
CMOA_CAMJE       AAKREALENVLIPYSQKENLNMLEKAGFKKIESIFKWANFETFIAFKD------
CMOA_CAMJR       AAKREALENVLIPYSQKENLNMLEKAGFKKIESIFKWANFETFIAFKD------
CMOA_CAMJJ       AAKREALENVLIPYSQKENLNMLEKAGFKKIESIFKWANFETFIAFKD------
CMOA_CAMJD       AAKREALENVLIPYSQKENLNMLEKAGFKKIESIFKWANFETFIAFKD------
CMOA_CAMJ8       AAKREALENVLIPYSQKENLNMLEKAGFKKIESIFKWANFETFIAFKD------
CMOA_HELPY       AFKREALENVLVPYSLKENVALLESVGFKHVEALFKWVNFTLLVARKT------
CMOA_HELPJ       AFKREALENVLVPYSLKENIALLESVGFKHVEALFKWVNFTLLVARKT------
CMOA_HELPH       AFKREALENVLVPYSLKENIALLESVGFKHVEAVFKWVNFTLLVARKT------
CMOA_HELAH       AFKREALENVLVPYSLKENIALLESVGFKHVEALFKWVNFTLLVARKT------
CMOA_HELHP       SKKREALENVLVPFSLEENIAMLKDIGFSGIEVLFKWVNFGTLIAKK-------
CMOA_WOLSU       VKKREALENVLIPYTAKENEKMLLEAGFAHVETLFRWVNFATFIAKKGEA----
CMOA_DESPS       AQKREALENVLIPFSQNENKNLLKKVGFECVESYFQWFNFSSFMAIKPQP----
CMOA_ALCBS       SQKRNALENVLIPETLAAHETRLKKAGYRQIHVWFRCFNFVSLLAVR-------
CMOA_MARHV       SQKRAAIEKVLIPETLADHRDRLQRAGFDQVLVWYQCFNFVSMLAIKNS-----
CMOA_HAHCH       AQKRSALENVLVPETIEAHIERLQRAGFSQAYLWFQCFNFVSFLAIK-------
CMOA_GEOMG       SQKRSALEKVLIPETLACHHERLQAAGFSFSELWFQCFNFASLVAMK-------
CMOA_SACD2       AQKRTAIENVLVPETLTTHKNRLTEVGFRSVDLWFQCFNFASIVAFK-------
CMOA_HYDCU       SQKRASLENVLISDSEATHLNRLQQSGFKAANIWFQAYNFASFLAIKA------
CMOA_AERHH       SQKRTALENVMRTDSLPVHQARLRDAGFAHQDLWFQCFNFGSMIAIKSSEPAQP
CMOA_AERS4       SQKRNALENVMRTDSLETHRSRLQSAGFVHQDLWFQCFNFGSMIAIKSSDAN--
CMOA_ACTP2       SQKRTALENVMLTDSIETHKDRLKQAGFSQIELWFQCFNFGSMIAVK-------
CMOA_HAEDU       SQKRTALENVMLTDSIQTHKNRLQDAGFSQIELWFQCFNFGSMVAIKQSP----
CMOA_HAEI8       SQKRTALENVMRTDSIETHKVRLKNVGFSQVELWFQCFNFGSMIAVK-------
CMOA_HAEIG       SQKRTALENVMRTDSIKTHKVRLKNVGFSQVELWFQCFNFGSMIAVK-------
CMOA_HAEIN       SQKRTALENVMRTDSIETHKVRLKNVGFSQVELWFQCFNFGSMIAVK-------
CMOA_HAEIE       SQKRTALENVMRTDSIETHKVRLKNIGFSQVELWFQCFNFGSMIAVK-------
CMOA_MANSM       SQKRAALENVMRIDSINTHKVRLKNVGFSHVELWFQCFNFGSMIAIK-------
CMOA_PASMU       SQKRTALENVMRTDSIQAHKMRLAEVGFQQVELWFQCFNFGSMIAVK-------
CMOA_HAES1       SQKRTALENVMRTDSIETHKERLKSAGFSQIELWFQCFNFGSMVAIK-------
CMOA_PHOPR       SQKRSAIENVMRPDSIDTHKKRLTEIGFSSTEVWFQCFNFGSMFAIK-------
CMOA_ALIF1       SQKRSAIENVMLPDTIDVHKKRFNEIGFKSSEVWFQCFNFGSMFAIK-------
CMOA_VIBCB       SQKRSAIENVMRPDSKKDHKERFAEIGFSSYDVWFQCFNFGSMFAIK-------
CMOA_VIBPA       SQKRSAIENVMRPDSKKDHKERFAKIGFSSYDVWFQCFNFGSMFAIK-------
CMOA_VIBVU       SQKRSAIENVMRPDSKKQHKERFAQIGFSSYDVWFQCFNFGSMFAIK-------
CMOA_VIBVY       SQKRSAIENVMRPDSKKQHKERFAQIGFSSYDVWFQCFNFGSMFAIK-------
CMOA_VIBCH       SQKRSAIENVMRPDSIQTHKQRFATLGFSSFEVWFQCFNFGSMFAIK-------
CMOA_SHIBS       SQKRSMLENVMLTDSVETHKARLHKAGFEHSELWFQCFNFGSLVALKAEDAA--
CMOA_SHIF8       SQKRSMLENVMLTDSVETHKARLHKAGFEHSELWFQCFNFGSLVALKAEDAA--
CMOA_SHIFL       SQKRSMLENVMLTDSVETHKARLHKAGFEHSELWFQCFNFGSLVALKAEDAA--
CMOA_SHIDS       SQKRSMLENVMLTDSVETHKARLHKAGFEHSELWFQCFNFGSLVALKAEDAA--
CMOA_ECOL5       SQKRSMLENVMLTDSVETHKARLHKAGFEHSELWFQCFNFGSLVALKAEDAA--
CMOA_ECOL6       SQKRSMLENVMLTDSVETHKARLHKAGFEHSELWFQCFNFGSLVALKAEDAA--
CMOA_ECOK1       SQKRSMLENVMLTDSVETHKARLHKAGFEHSELWFQCFNFGSLVALKAEDAA--
CMOA_ECO57       SQKRSMLENVMLTDSVETHKARLHKAGFEHSELWFQCFNFGSLVALKAEDAA--
CMOA_ECOUT       SQKRSMLENVMLTDSVETHKARLHKAGFEHSELWFQCFNFGSLVALKAEDAA--
CMOA_SHISS       SQKRSMLENVMLTDSVETHKARLHKAGFEHSELWFQCFNFGSLVALKAEDAA--
CMOA_ECOLI       SQKRSMLENVMLTDSVETHKARLHNAGFEHSELWFQCFNFGSLVALKAEDAA--
CMOA_CITK8       SQKRSMLENVMLTDSVETHKARLHQAGFEHSELWFQCFNFGSLVALKSGVPA--
CMOA_SALPA       SQKRSMLENVMLTDSVETHKARLRQAGFEHSELWFQCFNFGSLVALKAGVAA--
CMOA_SALTI       SQKRSMLENVMLTDSVETHKARLRQAGFEHSELWFQCFNFGSLVALKAGVAA--
CMOA_SALTY       SQKRSMLENVMLTDSVETHKARLRQAGFEHSELWFQCFNFGSLVALKAGVAA--
CMOA_SALCH       SQKRSMLENVMLTDSVETHKSRLRKAGFEHSELWFQCFNFGSLVALKAGVAA--
CMOA_KLEP7       SQKRSMLENVMLTDSVETHKARLRQAGFEHAELWFQCFNFGSLVAVKAGEQA--
CMOA_CROS8       SQKRSMLENVMLTDSVETHKARLRKAGFEHSELWFQCFNFGSLVAVKGGSAT--
CMOA_YERPE       SQKRSMLENVMLTDSVETHKNRLHQAGFEHAEVWFQCFNFGSLIALKAGEAQ--
CMOA_YERPA       SQKRSMLENVMLTDSVETHKNRLHQAGFEHAEVWFQCFNFGSLIALKAGEAQ--
CMOA_YERPN       SQKRSMLENVMLTDSVETHKNRLHQAGFEHAEVWFQCFNFGSLIALKAGEAQ--
CMOA_YERPP       SQKRSMLENVMLTDSVETHKNRLHQAGFEHAEVWFQCFNFGSLIALKAGEAQ--
CMOA2_YERPS      SQKRSMLENVMLTDSVETHKNRLHQAGFEHAEVWFQCFNFGSLIALKAGEAQ--
CMOA_YERE8       SQKRSMLENVMLTDSVETHKKRLHQAGFEHAEVWFQCFNFGSLIALKAGEAQ--
CMOA_SODGM       SQKRSMLENVMLTDTVEVHKQRLVEAGFGHAELWFQCFNFGSLISIKPESGQ--
CMOA_PECAS       SQKRSMLENVMLTDSVETHKARLADAGFEHSEIWFQCFNFGSLLAVKAEEKA--
CMOA_PHOLL       SQKRSMLENVMLTDSVETHKSRLHQSGFNHVEVWFQCFNFGSLLAIKGADE---
CMOA_COLP3       AQKRSALEKVMLTDSLDVHKERLTQAGFQHVSLWFQCFNFTSLIAIK-------
CMOA_PSYIN       SQKRASLDNVLIADTVEQHYLRLRKAGFKHNNLWYQYFNFGSIISIK-------
CMOA_SHEB5       SQKRSALENVMKPDTLTTHQQRLTSQGFSHFSLWFQCFNFASMVAIK-------
CMOA_SHEB8       SQKRSALENVMKPDTLTTHQQRLTSQGFSHFSLWFQCFNFASMVAIK-------
CMOA_SHEPC       SQKRSALENVMKPDTLTTHQQRLTSQGFSHFSLWFQCFNFASMVAIK-------
CMOA_SHESW       SQKRSALENVMKPDTLTTHQQRLTRQGFSHFSLWFQCFNFASMVAIK-------
CMOA_SHESA       SQKRSALENVMKPDTLTLHQQRLTRQGFSHFSLWFQCFNFSSMVAIK-------
CMOA_SHESM       SQKRSALENVMKPDTLTLHQQRLTRQGFSHFSLWFQCFNFSSMVAIK-------
CMOA_SHESR       SQKRSALENVMKPDTLSIHQQRLTGQGFSHFSLWFQCFNFSSMVAIK-------
CMOA_SHEON       SQKRSALENVMKPDTLSTHQQRLTHQGFSHFSTWFQCFNFASMVAIK-------
CMOA_SHELP       SQKRSSLEHVMKPDTLPQHQQRLKAQGFSHFSVWFQCFNFASMVAIK-------
CMOA_SHEDO       SQKRSALENVMRTDTLVQHQQRITDSGFSHFSVWFQCFNFASMVAIK-------
CMOA_SHEFN       SQKRSALENVMRPDSLNVHQQRLTENGFSHFSVWFQCFNFASMVAIK-------
CMOA_SHEAM       SQKRSAIENVLIPDTLEQHKTRLNQAGFTQADLWFQCFNFASMVAIK-------
CMOA_PSEAE       AQKRSALENVMLPDTFEEHRERLLAAGFSRVSQWFQCLNFASMIALP-------
CMOA_PSEAB       AQKRSALENVMLPDTFEEHRERLLAAGFSRVSQWFQCLNFASMIALP-------
CMOA_PSEE4       AQKRSAIENVMKPDTLETHKERLHAAGFSKVVPWFQCLNFASLIALP-------
CMOA_PSEPK       AQKRSAIENVMKPDTLETHQERLRAAGFSKVVPWFQCLNFASLIALP-------
CMOA_PSEF5       AQKRSAIENVMKPDSLEEHRERLLAAGFSKVVPWFQCLNFASLIALP-------
CMOA_PSEPF       AQKRSAIENVMKPDSLEEHRERLLAAGFSKVVPWFQCLNFASLIALP-------
CMOA_PSE14       AQKRSAIENVMKPDSLEEHRQRLLAAGFSKVVPWFQCLNFTSLIALP-------
CMOA_PSEU2       AQKRSAIENVMKPDSLEEHRQRLLAAGFSKVVPWFQCLNFTSLIALP-------
CMOA_PSESM       AQKRSAIENVMKPDSLEEHRQRLLAAGFSKVVPWFQCLNFASLIALP-------
CMOA_PSEU5       AQKRSAIENVMKPDSLETHRQRLLEAGFSKVVPWFQCLNFASLIALP-------
CMOA_PSEA6       SQKRESIENILRAETFEAHQTRLQNAGFDDVVLWFQCFNFASIVAIKS------
CMOA_PSEHT       SQKRTAIENVMRPDTLSTHFTRLKDIGFSQTQAWYQCFNFCSMIAIK-------
CMOA_IDILO       SQKRAAIENVMKVDTLQAHQQRFQKAGFQHSSVWFQCFNFAAMLAVK-------
CMOA_RUTMC       TNKRQSIENVLITDSKQTHFKRFNMAGFKNSICHFQCLNFVSFLAVK-------
CMOA_PSYA2       SGKRNALENVLITDTLDEHHTRLAQVGFQRHLTWFQFLNFVSIVAFK-------
CMOA_PSYCK       SGKRNALENVLITDTLDEHHARLSDVGFQRHLTWFQFLNFVSIVAFK-------
CMOA_CHRSD       SQKRTALENVLVPDTLDAHHERLHEAGFTRVSTWFQYLNFASMVAFKDA-----
CMOA_DICNV       AQKREALENVMKIETETAERVRLQAAGFRRVLPYFQGMMFKAWVAIK-------
CMOA_PELCD       SQKREALENVLIPETMESHRKRLDQAGFKAVDTWLKWFNFASFIALKEKS----
CMOA_METCA       AQKREALENVLVPYKLAENLEMLESAGFRYVDVFFKWYNFVGIVAVK-------
CMOA_NITOC       ARKREALENVLIPYRPEENYELLASVGFSHVEEFFRWYNFSGILAVK-------
CMOA_STAEQ       IKKSQSIRGVLKPLTLKQNKRMLEKAGFKDIDTWFKWNNFVGIIAVK-------
CMOA_TRIEI       ERKKEALENVLIPLSEAEQLQMLKQSGFSYIESLIKLHNFVSFVAFKSD-----
CMOA1_YERPS      SNKRKALENKLIPYLHEENIELFKSSGFNSVEICFSFLNFRGYLCRC-------
                   *   :   :       .       *:           *   ..