CLUSTAL format seed alignment for MF_01590

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

CMOB_PSEAE      -------MIQHLALDALQRHLAGSP-LYGWATSLPAQISARI-EEGHGDLARWWSAVQRL
CMOB_PSEAB      -------MIQHLALDALQRHLAGSP-LYGWATSLPAQIAARI-EEGHGDLARWWSAVQRL
CMOB_PSEE4      ----------MIDLSPLVRRLAGTP-LATWSQGLQAQLEAKL-EKGHGDLDRWRGALESL
CMOB_PSEPK      ----------MIDLSPLVRRLAGTP-LASWSQGLQAQLDAKL-EKGHGDLDRWRGALEAL
CMOB_PSEF5      ----------MIDLSPLARRLAGTP-LATWANGLQAQLDAKM-EKGHGDLERWQSALDAL
CMOB_PSEPF      ----------MIDLSPLARRLAGTP-LAEWANTLQVQLDKKM-EKGHGDLERWQSALDAL
CMOB_PSE14      ----------MIDLAPLARRLAGTP-LADWANGLQAQLDTKM-AKGHGDLQRWQSALDAL
CMOB_PSEU2      ----------MIDLAPLVRRLAGTP-LADWANGLQAQLDTKM-AKGHGDLQRWQSALDAL
CMOB_PSESM      ----------MIDLAPLVRRLAGTP-LAEWANGLQAQLDTKM-SKGHGDLQRWQSALDAL
CMOB_PSEU5      ---------MNLDLTPLAWRLAGTP-LAAWANDVQQQLDAKL-AIGHGDLPRWRRAVDAL
CMOB_ALCBS      --------MLTDYLQACERGLEPLF-SPQILSAVMALSRQRLVERPHGDLPRWMAALDAL
CMOB_HAHCH      ----------MIRFDDFLAHADKNR-LQRFIPDFERVLDERYYSRTHGDYEGWWNALQQL
CMOB_MARHV      ----MALFDWHKHFDPVLSYLNETG-NTRWTTALKEQLTRRFEDNPHGDMERWHNALQSL
CMOB_GEOMG      ----------MSWYDALFPHLAAMG-QERWAEQLQVTLSESQLLQRYGDMPGWLSALQAL
CMOB_METCA      ----------MSDRDLFAGLLAPRS-FPGWVELLLPRIEARFQEGRHGDWPAWMQLLGEL
CMOB_SACD2      ----------MIDYTSFLEQEKEGP-LARWVEILPDQISEGLSTKRYGDLEQWLTAMQNL
CMOB_AERHH      ----------MIDFANFYQLIAKNR-LSHWLHTLPAQLHAWQHDNQHGDLPRWNRALNKL
CMOB_AERS4      ----------MIDFANFYQLIAKNR-LSHWLHTLPAQLHAWQHDNLHGDLPRWNRALNKL
CMOB_PSYIN      ----------MIDFTNFYSSIAKNR-LSHWLRTLPMQLHEWENTHVHGQLASWIRVLNKF
CMOB_SHEB5      ----------MISFSSFYQQIADSN-LQHWLETLPSILGKWQRDHKHGNLPKWEKVLNKL
CMOB_SHEB8      ----------MISFSSFYQQIADSN-LQHWLETLPSILGKWQRDHKHGNLPKWEKVLNKL
CMOB_SHEPC      ----------MISFSSFYQQIADSN-LQHWLETLPSILGKWQRDHKHGNLPKWEKVLNKL
CMOB_SHESW      ----------MISFSSFYQQIADSN-LQHWLETLPSILGKWQRDHKHGNLPKWEKVLNKL
CMOB_SHESA      ----------MISFSSFYQQIADSN-LQHWLETLPAILGKWQREHKHGNLPKWEKVLNKL
CMOB_SHESM      ----------MISFSSFYQQIADSN-LQHWLETLPAILGKWQREHKHGNLPKWEKVLNKL
CMOB_SHESR      ----------MISFSSFYQQIADSN-LQHWLETLPAILGRWQREHKHGNLPKWEKVLNKL
CMOB_SHEON      ----------MINFSSFYQQIADSN-LQHWLETLPAILGKWQREHKHGNLPKWEKVLNKL
CMOB_SHEDO      ----------MISFSSFYQQIADST-LQHWLEDLPAILGKWQREHKHGNLPKWEKVLNKL
CMOB_SHEFN      ----------MINFSSFYKDIADSN-LQHWLETLPAILGKWQRDHKHGNLPKWEKVLNKL
CMOB_SHELP      ----------MISFSSFYQQIADSN-LQHWLEELPAILGQWQREHKHGNLPKWEKVLNKL
CMOB_SHEAM      ----------MISFSSFYRQIADTQ-LQHWLESLPAILGEWQRQHKHGNLPKWEKVLAKL
CMOB_HAEI8      ----------MIDFRPFYQQIATTN-LSDWLETLPLQLKEWETQT-HGDYAKWSKIVDFL
CMOB_HAEIE      ----------MIDFRPFYQQIATTN-LSDWLETLPLQLKEWETQT-HGDYAKWSKIVDFL
CMOB_HAEIG      ----------MIDFRPFYQQIATTN-LSDWLETLPLQLKEWETQT-HGDYAKWSKIVDFL
CMOB_HAEIN      ----------MIDFRPFYQQIATTN-LSDWLETLPCQLKEWETQT-HGDYAKWSKIVDFL
CMOB_PASMU      ----------MIDFRPFYQHIATTH-LSAWLETLPLQLKQWEKQT-HGDYAKWAKIVDFL
CMOB_HAES1      ----------MFDFRPFYQQIATST-LSAWLETLPLQLKQWEKQT-HGDYIKWSKIIDFL
CMOB_MANSM      ----------MIDFRPFYQQIAVSE-LSSWLETLPSQLARWQKQT-HGEYAKWAKIVDFL
CMOB_ACTP2      ----------MIDFRPFYQQIATTN-LSAWLETLPLQLKQWEKTT-HGDYAKWAKIVDFM
CMOB_HAEDU      ----------MIDFRPFYQQIATSH-LSAWLETLPLQLKQWEKTA-HSDYAKWAKIATSM
CMOB_SALTY      ----------MIEFGNFYQLIAKNH-LSHWLETLPAQIASWQREQQHGLFKQWSNAVEFL
CMOB_SALCH      ----------MIEFGNFYQLIAKNH-LSHWLETLPAQIAAWQREQQHGLFKQWSNAVEFL
CMOB_SALPA      ----------MIEFGNFYQLIAKNH-LSHWLETLPAQIAAWQREQQHGLFKQWSNAVEFL
CMOB_SALTI      ----------MIEFGNFYQLIAKNH-LSHWLETLPAQIAAWQREQQHGLFKQWSNAVEFL
CMOB_ECOUT      ----------MIDFGNFYSLIAKNH-LSHWLETLPAQIANWQREQQHGLFKQWSNAVEFL
CMOB_ECOK1      ----------MIDFGNFYSLIAKNH-LSHWLETLPAQIANWQREQQHGLFKQWSNAVEFL
CMOB_ECOLI      ----------MIDFGNFYSLIAKNH-LSHWLETLPAQIANWQREQQHGLFKQWSNAVEFL
CMOB_ECOL6      ----------MIDFGNFYSLIAKNH-LSHWLETLPAQIANWQREQQHGLFKQWSNAVEFL
CMOB_ECOL5      ----------MIDFGNFYSLIAKNH-LSHWLETLPAQIANWQREQQHGLFKQWSNAVEFL
CMOB_SHIDS      ----------MIDFGNFYSLIAKNH-LSHWLETLPAQIANWQREQQHGLFKQWSNAVEFL
CMOB_ECO57      ----------MIDFGNFYSLIAKNH-LSHWLETLPAQIANWQREQQHGLFKQWSNAVEFL
CMOB_SHIBS      ----------MIDFGNFYSLIAKNH-LSHWLETLPAQIANWQREQQHGLFKQWSNAVEFL
CMOB_SHISS      ----------MIDFGNFYSLIAKNH-LSHWLETLPAQIANWQREQQHGLFKQWSNAVEFL
CMOB_SHIFL      ----------MIDFGNFYSLIAKNH-LSHWLETLPAQIANWQREQQHGLFKQWSNTVEFL
CMOB_SHIF8      ----------MIDFGNFYSLIAKNH-LSHWLETLPAQIANWQREQQHGLFKQWSNTVEFL
CMOB_CITK8      ----------MIEFGNFYQLIAKSP-LSHWLETLPAQIATWQRDQ-HGLFKQWSNAVEFL
CMOB_KLEP7      ----------MIDFSNFYQLIAKSP-LSHWLETLPAQVAAWQRDALHGKFREWERAVEFL
CMOB_CROS8      ----------MIDFGKFYQQIACGP-LAHWLETLPAQVAAWQRDALHGQFKQWKNSLDNL
CMOB_YERPE      ----------MIEFGDFYRLIAKGP-LSPWLDTLPAQLSAWQRESLHGKFKTWFNAVEHL
CMOB_YERPA      ----------MIEFGDFYRLIAKGP-LSPWLDTLPAQLSAWQRESLHGKFKTWFNAVEHL
CMOB_YERPN      ----------MIEFGDFYRLIAKGP-LSPWLDTLPAQLSAWQRESLHGKFKTWFNAVEHL
CMOB_YERPP      ----------MIEFGDFYRLIAKGP-LSPWLDTLPAQLSAWQRESLHGKFKTWFNAVEHL
CMOB_YERPS      ----------MIEFGDFYRLIAKGP-LSPWLDILPAQLSAWQRESLHGKFKTWFNAVEHL
CMOB_YERE8      ----------MIEFGDFYRLIAKGP-LSPWLDTLPAQLSAWQRESLHGKFKTWFNAVEHL
CMOB_PECAS      ----------MIDFGNFYQQIAKGP-LSHWLNTLPSQLSSWQQESLHGKFKLWFNSLEHL
CMOB_SODGM      ----------MSQFADFYQLIAKSP-LSHWLNTLPAQLSEWEQTSQHCKFSQWFNAVERL
CMOB_PHOLL      ----------MIDFGNFYQLIAKNN-LQHWLNCLPAQLQEWQKAALHGNFKSWVKTLENL
CMOB_VIBCB      ----------MFNFANFYQLIAQDTRLQPWLNVLPQQLTDWQNAE-HGDFGRWLKALNKI
CMOB_VIBPA      ----------MFNFANFYQLIAQDTRLQPWLNVLPQQLTDWQNAE-HGDFGRWLKALNKI
CMOB_VIBVU      ----------MFNFANFYQLIAQDTRLQPWLNVLPQQLTDWQNAE-HGDFPRWLKALNKI
CMOB_VIBVY      ----------MFNFANFYQLIAQDTRLQPWLNVLPQQLTDWQNAE-HGDFPRWLKALNKI
CMOB_ALIF1      ----------MFNFANFYQLIAQDTVLQPWLNTLPQQLTDWQNAE-HGDIERWIKALKKI
CMOB_VIBCH      ----------MFNFANVYQQIAQHPQLQLWLNTLPQQLTDWQAKQ-HGDLDRWMRNLKKI
CMOB_PHOPR      ----------MFSFSEFYKLIAQHETLRPWLNTLPKQLSDWEEAE-HGDMGRWIRALKKF
CMOB_PSEA6      --------MSVPWFNQFYKEIADSP-LSAWLELLPGQISTWQKEQLHGDFNKWVKLLGKL
CMOB_PSET1      ---------MSQWFNQFYAAIAQSP-LSHWLETLPAQLKHWQLEASHGDLPQWQKVLKNL
CMOB_COLP3      ----------MKQFNEFYQKIATNR-LGHWLNTLPAQLSHWHESELHGEFKHWQKTLDAL
CMOB_IDILO      ----------MVDFSKELRALVQSP-HSQWLDTLAPQLTAFKNNP-HGNLKRWQRVLTQL
CMOB_PSYA2      MLNNTILHAERELYLTLLAWAQQQPNAYEWLTQLPTWLNDIKDKANYAHAPAYQASVARL
CMOB_PSYCK      MLNDTITHAERELYLTLLELAQQQPSAYEWLTRLPTWLNDIKDKANYAHAPAYQASVARL
CMOB_CHRSD      MPDRSLPPAQRALFDALLDHGLS-----EWVARLPAQLADGLDRKRFGDLPAWEKAVAKL
CMOB_HYDCU      ------MKHYHQHYSSFWPKLEEAR-LGHWQNALEAALETALDPDANGNLPKWLPALETV
CMOB_DICNV      ---------MNAALRKWHRAVTLLPALSVYDETAQRVFTAAYDRR-HKSFEDWLTAIAQL
CMOB_RUTMC      ------------MLSDFYKYATSTQ--LDLICTQLINLSTHVFNTNNGNIPKWEQAIKQI
CMOB_PELCD      ----------MIELLSAAGQAIGNGPWQTALNTLLNE-KSRQLTDVDGNARRLTALMNQL
CMOB_DESPS      ----------------MKYLKHLSDAADREAIKALHDERQTWVNQEKKGFLRYREPYLQL
CMOB_TRIEI      ------MLNKNIGYISPDYLYKYNSPINTEAILKIRQERQ--AKLFKFSHEKYYKAVQTI
CMOB_ARCB4      ----------------------MNLEIL--------QKKKEECRTWKNVEPWFLQLKEAC
CMOB_SULNB      ----------------------MNLETL--------RQERRKWLTWKNIVPYQEAIKALP
CMOB_NITSB      ----------------------MEIEEI--------KIEREGWLRWKNIAPLREKLSQMP
CMOB_SULDN      ----------------------MNINEI--------RKERQKWMQWKNIAPLREVIEHLG
CMOB_CAMJE      ----------------------MQENLL--------EKQFLNHPLYAKIQELKAL-----
CMOB_CAMJR      ----------------------MQENLL--------EKQFLNHPLYAKIQELKAL-----
CMOB_CAMJJ      ----------------------MQENLL--------EKQFLNHPLYTKIQELKAL-----
CMOB_CAMFF      ------------------------MNLI--------NNA--NKKLFEKINNLK-------
CMOB_CAMHC      --------------------------MN--------ENE---KKLLSDIECLP-------
CMOB_WOLSU      ---------------------------------------------MKHLPQLE-------
CMOB_HELHP      ----------------------MQESLNSNDFKEYAAKKAKHITSAKNIAPLLECIASLP
CMOB_HELPY      ------------------------------------------------------------
CMOB_HELPJ      ------------------------------------------------------------
CMOB_HELPH      ------------------------------------------------------------
CMOB_HELAH      ------------------------------------------------------------
                                                                            

CMOB_PSEAE      PQVPAPKVDLAQRFALHS---DHDAALQAQMKEALQGLIPWRKGPFDFF-----------
CMOB_PSEAB      PQVPAPKVELAQRFALHS---DHDAALQAQVKEALQGLIPWRKGPFDFF-----------
CMOB_PSEE4      PKLTPSQVDLVDGLRLDC---DCDDATRAQMHQALMGLSPWRKGPFDLF-----------
CMOB_PSEPK      PALQPSEIDLVNGLRLDC---DCDDATRAQMRQALMGLSPWRKGPFDLF-----------
CMOB_PSEF5      PKIQPSEIDLINGLRLDT---DCDDATRAQMRTALMGLSPWRKGPFDLF-----------
CMOB_PSEPF      PKIQPTEVDLLDGLKLDT---NCDDETRAQMRTALMGLSPWRKGPFDLF-----------
CMOB_PSE14      PDLQPERIDLLDSFTLQA---ECNGETRTVLRKALLGLSPWRKGPFNVF-----------
CMOB_PSEU2      PDLQPERIDLIDSFTLEA---ECNGETRTVLRKALLGLSPWRKGPFNVF-----------
CMOB_PSESM      PALQPEKVDLTDSFTLET---ECDGETRTVLRKALLGLSPWRKGPFNVF-----------
CMOB_PSEU5      PTLMPTQIELRECFRLAA---PCDEATRQATREALMGLSPWRKGPFEVF-----------
CMOB_ALCBS      PAG-PTNCALDQNTLTIG---RAGEQNEEAVKLALQGLIPWRKGPFEFF-----------
CMOB_HAHCH      PTAQASQIQFDVDTLMIGAEGDLDPEEQESLIKGLRGLHPWRKGPFNFF-----------
CMOB_MARHV      PDVADARVDLNRSAITLTSPSGLDPDAMTRLENGLRGLMPWRKGPFDFF-----------
CMOB_GEOMG      PELHPSRIAL-QDTVTIGSGADLCSVTREDLILGLQAFHPWRKGPYSVF-----------
CMOB_METCA      PKVVPTRLDFAQNAVRIEGDTDCDGATRRSIETALRRLHPWRKGPYDIH-----------
CMOB_SACD2      PQVDNVQVSY-QSAVTLKSTAPLAQETHTLIEQQFRALIPWRKGPYNIF-----------
CMOB_AERHH      PQVAP-GHIELHSRVEIGSAESLGEGERKKVESLLRHFMPWRKGPFTVH-----------
CMOB_AERS4      PTTAP-GHIELQRGVEIGNSQSLSEGERKKVESLLRQFMPWRKGPFTVH-----------
CMOB_PSYIN      PDIKT-SHIELKDRVEIGSATELSPGETKKLENLLQKFHPWRKGPFVIH-----------
CMOB_SHEB5      HYPAP-DQVDFIDSVTVGSGEQLSPGEKEKLENLLRLFMPWRKGPFHIH-----------
CMOB_SHEB8      HYPAP-DQVDFVDSVTVGSGEQLSPGEKEKLENLLRLFMPWRKGPFHIH-----------
CMOB_SHEPC      HYPAP-DQVDFVDSVTVGSGEQLSPGEKEKLENLLRLFMPWRKGPFHIH-----------
CMOB_SHESW      HYPAP-DQVDFVDSVTVGSGEQLSPGEKEKLENLLRLFMPWRKGPFHIH-----------
CMOB_SHESA      HYPAP-DRVDFVSSVTVGTGEQLTPGEKEKLENLLRLFMPWRKGPFHIH-----------
CMOB_SHESM      HYPAP-DRVDFVSSVTVGTGEQLTPGEKEKLENLLRLFMPWRKGPFHIH-----------
CMOB_SHESR      HYPAP-DQVDFVSSVTVGTGEQLTPGEKEKLENLLRLFMPWRKGPFHIH-----------
CMOB_SHEON      HYPSP-DSVDLVDSVTIGTGEQLTPGEKEKLENLLRLFMPWRKGPFHIH-----------
CMOB_SHEDO      NYAEP-DSVDFVDSVTIGSGSQLSAGQQQKLENLLRLFQPWRKGPFNVH-----------
CMOB_SHEFN      HYPQP-DNIDFSSSVTIGTGEQLSPGQVEKLTNLLEVFQPWRKGPFSVH-----------
CMOB_SHELP      HYPAP-DRIDFTTRVEVGSGDQLSKGQQEKLKNLLKLFCPWRKGPFDLH-----------
CMOB_SHEAM      HYPAP-EFLDLKDSVTIGDGLQLDSGQTEKLENLLKILQPWRKGPFHVH-----------
CMOB_HAEI8      PDLHA-DEIDLKSAVKSDRTFPLSEGEKQRIIHHLKQLMPWRKGPYHLF-----------
CMOB_HAEIE      SDLHA-DEIDLKSAVKSDRTSPLSEGEKQRIIHHLKQLMPWRKGPYHLF-----------
CMOB_HAEIG      PDLHA-DEIDLKSAVKSDRTSPLSEGEKQRIIHHLKQLMPWRKGPYHLF-----------
CMOB_HAEIN      PNLHA-DEIDLKSAVKSDRTSPLSEGEKQRIIHHLKQLMPWRKGPYHLF-----------
CMOB_PASMU      PHLDA-DHIDLKSAVKSESVSPLSAGEQQRLVYHLKQLMPWRKGPYHLH-----------
CMOB_HAES1      PHLTA-DHIDLKSAVKAETKTPLSSGERQRIIHHLKQLMPWRKGPYHLY-----------
CMOB_MANSM      PHLKT-ARIDLKTAVKSEPVSPLSQGEQQRIIYHLKQLMPWRKGPYHLH-----------
CMOB_ACTP2      PN-ST-ACINLKDKVESIPHTPLSVGETKQLTHHLKQLMPWRKGPYHLH-----------
CMOB_HAEDU      PT-SP-TSINLTDKVEAVLAEALPEGEKQYLIYRLKQLMPWRKGPYHLH-----------
CMOB_SALTY      PEMTP-WRLDLLHSVTAESETPLSEGQLKRIDTLLRNLMPWRKGPFSLY-----------
CMOB_SALCH      PEMTP-WRLDLLHSVTAESETPLSEGQLKRIDTLLRNLMPWRKGPFSLY-----------
CMOB_SALPA      PEITP-WRLDLLHSVTAESETPLSEGQLKRIDTLLRNLMPWRKGPFSLY-----------
CMOB_SALTI      PEITP-WRLDLLHSVTAESETPLSEGQLKRIDTLLRNLMPWRKGPFSLY-----------
CMOB_ECOUT      PEIKP-YRLDLLHSVTAESEEPLSAGQIKRIETLMRNLMPWRKGPFSLY-----------
CMOB_ECOK1      PEIKP-YRLDLLHSVTAESEEPLSAGQIKRIETLMRNLMPWRKGPFSLY-----------
CMOB_ECOLI      PEIKP-YRLDLLHSVTAESEEPLSAGQIKRIETLMRNLMPWRKGPFSLY-----------
CMOB_ECOL6      PEIKP-YRLDLLHSVTAESEEPLSAGQIKRIETLMRNLMPWRKGPFSLY-----------
CMOB_ECOL5      PEIKP-YRLDLLHSVTAESEEPLSAGQIKRIETLMRNLMPWRKGPFSLY-----------
CMOB_SHIDS      PEIKP-YRLDLLHSVTAESEEPLSAGQIKRIETLMRNLMPWRKGPFSLY-----------
CMOB_ECO57      PEIKP-YRLDLLHSVTAESEEPLSAGQIKRIETLMRNLMPWRKGPFSLY-----------
CMOB_SHIBS      PEIKP-YRLDLLHSVTAESEEPLSTGQIKRIETLMRNLMPWRKGPFSLY-----------
CMOB_SHISS      PEIKP-YRLDLLHSVTAESEEPLSTGQIKRIETLMRNLMPWRKGPFSLY-----------
CMOB_SHIFL      PEIKP-YRLDLLHSVTAESEEPLSTGQIKRIETLMRNLMPWRKGPFSLY-----------
CMOB_SHIF8      PEIKP-YRLDLLHSVTAESEEPLSTGQIKRIETLMRNLMPWRKGPFSLY-----------
CMOB_CITK8      PELTP-YRLDLLHSVTAESETPLSEGQLKRIDTLLRNLMPWRKGPFSLY-----------
CMOB_KLEP7      PELTP-WRLDLLHSVTAESETPLSEGHQRRIENLLKNLMPWRKGPYSLY-----------
CMOB_CROS8      PALVP-DQLDLLHSVSAQSAEPLSDGQRKRIEQLLRTLMPWRKGPFSLY-----------
CMOB_YERPE      PQLTP-TTLDLHSGVRAEMSPPISAGQREGMENMLRALMPWRKGPFSLY-----------
CMOB_YERPA      PQLTP-TTLDLHSGVRAEMSPPISAGQREGMENMLRALMPWRKGPFSLY-----------
CMOB_YERPN      PQLTP-TTLDLHSGVRAEMSPPISAGQREGMENMLRALMPWRKGPFSLY-----------
CMOB_YERPP      PQLTP-TTLDLHSGVRAEMSPPISAGQREGMENMLRALMPWRKGPFSLY-----------
CMOB_YERPS      PQLTP-TTLDLHSGVRAEMSPPISAGQREGMENMLRALMPWRKGPFSLY-----------
CMOB_YERE8      PQLTP-TSLDLREGVRAEMTPPISSGQREGMENMLRALMPWRKGPFSLY-----------
CMOB_PECAS      PSLKP-TSLDLNDSVTARIEPDISVGQREGIEKLLRNLMPWRKGPFSLY-----------
CMOB_SODGM      PMLTP-ARLDLLHGVEADCDPPLSAGQQAGIESLLRQLMPWRKGPFSLY-----------
CMOB_PHOLL      PEISP-TQLDLKNGVIAERDPPLSAGEKICLTNILRIFMPWRKGPFSLY-----------
CMOB_VIBCB      PQGAP-NQVDIKNSVTISNDTPFHEGELKKLESLLRTFHPWRKGPYTVH-----------
CMOB_VIBPA      PEGSP-DQVDIKNSVTISNDTPFHEGELKKLENLLRTFHPWRKGPYTVH-----------
CMOB_VIBVU      PEGAP-DQIDIKHSVTISNDTPFHQGELKKLESLLRTFHPWRKGPYTVH-----------
CMOB_VIBVY      PEGAP-DQIDIKHSVTISNDTPFHQGELKKLESLLRTFHPWRKGPYTVH-----------
CMOB_ALIF1      PEGCA-DNIDLKSSVTLSNNTPLIDGERKKLENLLQTFHPWRKGPFTVH-----------
CMOB_VIBCH      PVGQP-EVIDLKNAVAAHNHQPLAQGEQKKLEAVLKTFHPWRKGPYHLH-----------
CMOB_PHOPR      PTDKP-DIIDIKNEVSVRYEDGIANGEQKRLESLLRLLHPWRKGPYNMH-----------
CMOB_PSEA6      PQTHP-SEIELKERVEFGLQSEINEYTQKQIIGLLKQFMPWRKGPFHIH-----------
CMOB_PSET1      PEVKT-QHVDITSQVKIGTPGEMTDGEQKQTLHLLKRMMPWRKGPFSVH-----------
CMOB_COLP3      PVVDANSAIDITNTVKVGESGDLDQGQFKRLENLMKKFKPWRKGPYHIH-----------
CMOB_IDILO      PNLTA-KHVKLSNTVQVGEADEASDADRARLTGLLQQLQPWRKGPFDLF-----------
CMOB_PSYA2      PTLT-VDNVQLNSDI-LTIDAQLSDSERKQATALLKQLMPWRKGPFKIG---------SS
CMOB_PSYCK      PNLT-VNNVDLNSDV-LTIEANLSESQRKQTMALLKQLMPWRKGPFQIGGQISSRQTVDT
CMOB_CHRSD      PTLPEARDVALDSDS-VRVDLALTESQQRQCENLLRKLMPWRKGPYTLG-----------
CMOB_HYDCU      MAFPSSDSAELSQSAIKAHSQPFSEDDKEKLTQALKAFMPWRKGPFEIE-----------
CMOB_DICNV      PLIEP-RAVHLNQAVVTAE----GAGDEIAIETLLKALMPWRKGPFSLC-----------
CMOB_RUTMC      KTQNTGSLDFITPYLNIS----AHHINNFTLEKSLKQLIPWRKGPYQIG-----------
CMOB_PELCD      PDLLPSHRNLASGRIEIGTPEDLTETQHQALYDTLMAFRPWRKGPFNIF-----------
CMOB_DESPS      ARFKADSINLENDVVTIGHGEQISHEEQAEIRQALRAYMPWRKGPFAVF-----------
CMOB_TRIEI      ADIQSNFFDCSSAVIKVGHPEEISPGQKQRLYHCLQTFCPWKKGPFELF-----------
CMOB_ARCB4      KIEKSNLKIDYGDWFSIGNRADLGDEEYEIIVQTAKKLIPWRKGPFKIF-----------
CMOB_SULNB      EYD--DVEVSLGDVVDI-QIADLSHKDAEQIRETALLMKPWRKGPFRIN-----------
CMOB_NITSB      KVE---CDVELGDVIKI--TGNIPRSLQEQVFETAWAMRPWRKGPFDVF-----------
CMOB_SULDN      DVT---CSVELGDVVTI--KGKPLKNIED----TARLMMPWRKGPFEVF-----------
CMOB_CAMJE      ---NLACNFSLGDSV----NLSTNSQAKDEILAIAKELKPWRKGPFKID-----------
CMOB_CAMJR      ---NLACNFSLDDSV----NLSTNSQAKDEILAIAKELKPWRKGPFKID-----------
CMOB_CAMJJ      ---NLTCNFSLDDSV----NLSTNSQAKDEILAITKELKPWRKGPFKID-----------
CMOB_CAMFF      ---NYSCQVKFSDAI----EIEIN-DFDDNIIDLAKDLKPWRKGPFKLN-----------
CMOB_CAMHC      ---NVDCKCDFGDIVRAFADYKINDELKFKVRQIALNLRPWRKGPFEIL-----------
CMOB_WOLSU      -----GVSVGLEGEAVSLFWGEIKEEERQEIYECAKALVPWRKGPFWVG-----------
CMOB_HELHP      TIPSHFYSDNGIHIVAQ--DKTLAQKYHKAIYTLATQLKPWRKGPFFLF-----------
CMOB_HELPY      -------MLICNDKS-----------NPKTLLEEIMALRPWRKGPFEIS-----------
CMOB_HELPJ      -------MLICNDKF-----------NPKTLLEEIMALRPWRKGPFEIS-----------
CMOB_HELPH      -------MLTCNDKI-----------NPKTLLEEIMALRPWRKGPFEIS-----------
CMOB_HELAH      -------MLICNDNL-----------NQKTLLEEIMALRPWRKGPFEIS-----------
                                                       **:***: .            

CMOB_PSEAE      --------GVQVDTEWRSDWKWERVSPHVE-LRGKRVLDVGCGNGYYQWRMLGAGA---E
CMOB_PSEAB      --------GVQVDTEWRSDWKWERVSPHVE-LRGKRVLDVGCGNGYYQWRMLGAGA---E
CMOB_PSEE4      --------GVHVDTEWRSDWKWSRVGPHLD-LKGKRVLDVGCGNGYYQWRMLGAGA---D
CMOB_PSEPK      --------GVHVDTEWRSDWKWSRVGPHLD-LQGKRVLDVGCGNGYYQWRMLGAGA---D
CMOB_PSEF5      --------GVHVDTEWRSDWKWSRVAPHLN-LEGKRILDVGCGNGYYMWRMLGAGA---H
CMOB_PSEPF      --------GVHVDTEWRSDWKWSRVSPHLD-LKGKRILDVGCGNGYYMWRMLGAGA---D
CMOB_PSE14      --------GVHIDTEWRSDWKWSRVSPHLD-LKGKRVLDVGCGNGYYQWRMLGAGA---D
CMOB_PSEU2      --------GVHIDTEWRSDWKWSRVSPHLD-LKGKRVLDVGCGNGYYQWRMLGAGA---D
CMOB_PSESM      --------GVHIDTEWRSDWKWSRVSPHLD-LKGKRVLDVGCGNGYYQWRMLGAGA---D
CMOB_PSEU5      --------GVHVDTEWRSDWKWARVAPHLD-LAGKRILDVGCGNGYYMWRMLGAGA---D
CMOB_ALCBS      --------GVPVETEWRSDWKWQRVAPHLSSLQGRRILDVGCGSGYHCWRMAAAGA---S
CMOB_HAHCH      --------GNHIDTEWRSDWKWTRVAPHLSPLKGRFVLDVGCGSGYHCWRMLGEGA---Q
CMOB_MARHV      --------GTYIDTEWRSDWKWDRVAPHLADLAGRTILDVGCGSGYHCWRMAGAGA---R
CMOB_GEOMG      --------GIEIDTEWRSDWKWERLLPHIQPLAGRKVLDVGCGNGYHGWRMRGAGA---D
CMOB_METCA      --------GIFIDAEWRSDLKWRRLEGAIAPLAGRRVLDVGCGNGYHAWRMLGAGA---K
CMOB_SACD2      --------DIEIDTEWHSDWKWDRVLPHLAPLKHRKILDVGCGNGYHCWRMYGEGA---S
CMOB_AERHH      --------GIHIDTEWRSDWKWDRVLPHISPLAGRYVLDVGCGSGYHLWRMVGEGA---K
CMOB_AERS4      --------GIHIDTEWRSDWKWDRVLPHISPLAGRYVLDVGCGSGYHLWRMVGEGA---K
CMOB_PSYIN      --------GIHIDTEWRSDWKWDRLLPHISPLKYRYVLDVGCGSGYHMWRMRGEGA---E
CMOB_SHEB5      --------GIHIDTEWRSDWKWDRVKQHISPLKNRTVLDVGCGSGYHMWRMLGSGA---K
CMOB_SHEB8      --------GIHIDTEWRSDWKWDRVKQHISPLKNRTVLDVGCGSGYHMWRMLGSGA---K
CMOB_SHEPC      --------GIHIDTEWRSDWKWDRVKQHISPLKNRTVLDVGCGSGYHMWRMLGSGA---K
CMOB_SHESW      --------GIHIDTEWRSDWKWDRVKQHISPLNNRTVLDVGCGSGYHMWRMLGAGA---K
CMOB_SHESA      --------GIHIDTEWRSDWKWDRVSPHISPLQNRTVLDVGCGSGYHMWRMLGAGA---K
CMOB_SHESM      --------GIHIDTEWRSDWKWDRVSPHISPLQNRTVLDVGCGSGYHMWRMLGAGA---K
CMOB_SHESR      --------GIHIDTEWRSDWKWDRVSPHISPLQNRTVLDVGCGSGYHMWRMLGAGA---K
CMOB_SHEON      --------GIHIDTEWRSDWKWDRVKPHISPLQNRTVLDVGCGSGYHMWRMLGAGA---K
CMOB_SHEDO      --------GIDIDTEWRSDWKWQRVRQHISPLAKRTVLDVGCGSGYHMWRMLGDGA---A
CMOB_SHEFN      --------GIQIDTEWRSDWKWDRVKNFISPLKNRTVLDVGCGSGYHMWRMLGDGA---T
CMOB_SHELP      --------GIHIDTEWRSDWKWERVQPHISPLKNRTVLDVGCGSGYHMWRMLGDGA---K
CMOB_SHEAM      --------GIHIDTEWRSDWKWDRVSPHLSPLTNRTVLDVGCGSGYHMWRMLGAGA---K
CMOB_HAEI8      --------GIHVDCEWRSDFKWDRVLPHLAPLQGRTILDVGCGSGYHMWRMVGEGA---K
CMOB_HAEIE      --------GIHVDCEWRSDFKWDRVLPHLSPLQGRTILDVGCGSGYHMWRMVGEGA---K
CMOB_HAEIG      --------GIHVDCEWRSDFKWDRVLPHLAPLQGRTILDVGCGSGYHMWRMVGEGA---K
CMOB_HAEIN      --------GIHVDCEWRSDFKWDRVLPHLSPLQGRTILDVGCGSGYHMWRMVGEGA---K
CMOB_PASMU      --------GIHIDCEWRSDFKWDRVLPHLAPLKDRTILDVGCGSGYHMWRMVGEGA---K
CMOB_HAES1      --------GIHIDCEWRSDFKWERVLPHLAPLQNRLVLDVGCGSGYHMWRMVGEGA---K
CMOB_MANSM      --------GIHVDCEWRSDFKWDRVLPHLAPLQDRLILDVGCGSGYHMWRMVGEGA---K
CMOB_ACTP2      --------GIHIDTEWRSDFKWDRVLPHLAPLKDRTILDVGCGSGYHMWRMVGEGA---K
CMOB_HAEDU      --------GVHIDTEWRSDFKWQRVLPHLAPLKDRTILDVGCGNGYHMWRMVGEDA---Q
CMOB_SALTY      --------GVDIDTEWRSDWKWDRVLPHLSDLTGRTILDVGCGSGYHLWRMIGAGA---H
CMOB_SALCH      --------GVDIDTEWRSDWKWDRVLPHLSDLTGRTILDVGCGSGYHLWRMIGAGA---H
CMOB_SALPA      --------GVDIDTEWRSDWKWDRVLPHLSDLTGRTILDVGCGSGYHLWRMIGAGA---H
CMOB_SALTI      --------GVDIDTEWRSDWKWDRVLPHLSDLTGRTILDVGCGSGYHLWRMIGAGA---H
CMOB_ECOUT      --------GVNIDTEWRSDWKWDRVLPHLSDLTGRTILDVGCGSGYHMWRMIGAGA---H
CMOB_ECOK1      --------GVNIDTEWRSDWKWDRVLPHLSDLTGRTILDVGCGSGYHMWRMIGAGA---H
CMOB_ECOLI      --------GVNIDTEWRSDWKWDRVLPHLSDLTGRTILDVGCGSGYHMWRMIGAGA---H
CMOB_ECOL6      --------GVNIDTEWRSDWKWDRVMPHLSDLTGRTILDVGCGSGYHMWRMIGAGA---H
CMOB_ECOL5      --------GVNIDTEWRSDWKWDRVMPHLSDLTGRTILDVGCGSGYHMWRMIGAGA---H
CMOB_SHIDS      --------GVNIDTEWRSDWKWDRVLPHLSDLTGRTILDVGCGSGYHMWRMIGAGA---H
CMOB_ECO57      --------GVNIDTEWRSDWKWDRVLPHLSDLTGRTILDVGCGSGYHMWRMIGAGA---H
CMOB_SHIBS      --------GVNIDTEWRSDWKWDRVLPHLSDLTGRTILDVGCGSGYHMWRMIGAGA---H
CMOB_SHISS      --------GVNIDTEWRSDWKWDRVLPHLSDLTGRTILDVGCGSGYHMWRMIGAGA---H
CMOB_SHIFL      --------GVNIDTEWCSDWKWDRVLPHLSDLTGRTILDVGCGSGYHMWRMIGAGA---H
CMOB_SHIF8      --------GVNIDTEWRSDWKWDRVLPHLSDLTGRTILDVGCGSGYHMWRMIGAGA---H
CMOB_CITK8      --------GINIDTEWRSDWKWDRVLPHLSDLTGRTILDVGCGSGYHMWRMIGAGA---H
CMOB_KLEP7      --------GINIDTEWRSDWKWERVLPHLSDLTGRTILDVGCGSGYHMWRMIGAGA---H
CMOB_CROS8      --------GIDIDTEWRSDLKWDRVLPHITPLAGRTILDVGCGSGYHLWRMVGAGA---Q
CMOB_YERPE      --------GLDIDTEWRSDWKWQRVLPHISPLAGRTILDVGCGSGYHLWRMIGEGA---H
CMOB_YERPA      --------GLDIDTEWRSDWKWQRVLPHISPLAGRTILDVGCGSGYHLWRMIGEGA---H
CMOB_YERPN      --------GLDIDTEWRSDWKWQRVLPHISPLAGRTILDVGCGSGYHLWRMIGEGA---H
CMOB_YERPP      --------GLDIDTEWRSDWKWQRVLPHISPLAGRTILDVGCGSGYHLWRMIGEGA---H
CMOB_YERPS      --------GLEIDTEWRSDWKWQRVLPHISPLAGRTILDVGCGSGYHLWRMIGEGA---H
CMOB_YERE8      --------GLDIDTEWRSDWKWQRVLPHVSPLAGRTILDVGCGSGYHLWRMIGEGA---H
CMOB_PECAS      --------GVDINTEWRSDWKWQRVLPHISPLKNRLILDVGCGSGYHLWRMVGEGA---T
CMOB_SODGM      --------GVSIDTEWRSDWKWERVLPHIAPLAGRLILDVGCGSGYHLWRMVGAGA---Q
CMOB_PHOLL      --------GINIDTEWRSDWKWDRVLPHISPLTGRTILDVGCGSGYHLWRMVGEGA---E
CMOB_VIBCB      --------GIHIDTEWRSDWKWDRVLPHISPLKNRSVLDVGCGNGYHMWRMLGEGA---R
CMOB_VIBPA      --------GIHIDTEWRSDWKWDRVLPHISPLKNRSVLDVGCGNGYHMWRMLGEGA---R
CMOB_VIBVU      --------GIHIDTEWRSDWKWDRVLPHISPLKNRSVLDVGCGNGYHMWRMLGEGA---R
CMOB_VIBVY      --------GIHIDTEWRSDWKWDRVLPHISPLKNRSVLDVGCGNGYHMWRMLGEGA---R
CMOB_ALIF1      --------DIHIDTEWRSDWKWDRLLPHITPLKNRSVLDVGCGNGYHMWRMLGEDA---R
CMOB_VIBCH      --------GIHIDTEWRSDWKWDRLLPHISPLKNRLVLDVGCGNGYHMWRMLGEGA---Q
CMOB_PHOPR      --------GIHIDTEWRSDWKWDRVLPHISPLQGRSVLDVGCGNGYHMWRMLGEGA---A
CMOB_PSEA6      --------GIHIDTEWRSDWKWERVQPHIQSLENRYVLDVGCGSGYHMWRMLGENA---K
CMOB_PSET1      --------GIEIDTEWRSDWKWDRLLPHIEPLKGRTVLDIGCGSGYHLWRMRGEGA---Q
CMOB_COLP3      --------GLHIDTEWRSDFKWDRLAEHISDLSGKYVLDIGCGSGYHLWRMRGAGA---K
CMOB_IDILO      --------GVFIDTEWRSDWKWQRVAPHLDDLSGRQVLDVGCGSGYHLWRMLEAGA---E
CMOB_PSYA2      QNEGEQAEPIFIDTEWHSDWKWQRVAPHLGNLKGRRVLDVGGGSGYHGWRMAGAGA---D
CMOB_PSYCK      QDNSDTNAPILIDTEWHSDWKWQRVAPHLGNLKGRRVLDVGGGSGYHGWRMAGSGA---D
CMOB_CHRSD      --------GIHIDTEWRSDWKWQRVAPHLSPLEGRRVLDVGGGNGYHGWRMVGAGA---A
CMOB_HYDCU      --------GIYIDTEWHSDWKWDRVSPHLSSLKGRKVLDIGCGSGYHLWRMLGDGA---E
CMOB_DICNV      --------GVSLDCEWRSDFKYQRLLDAGFSVSGKKVLDVGTGNGYFLYRFLGSGA---Q
CMOB_RUTMC      --------DLQLDSEWRGDMKWHRLIPHIKPLKDKVVLDVGSGNGYFTYLMAISGA---K
CMOB_PELCD      --------GIPVDTEWRSDLKWARIAPHLAPLQGRRILDVGSSCGYYLMRMAEANP---Q
CMOB_DESPS      --------GVDIDAEWRSERKWQRLEKHLPDLKGKVIADIGCNNGYYMFRMAAQEP---A
CMOB_TRIEI      --------GVNIDAEWRSDWKWDRILPHISSIKNRKVADIGCHNGYFMFRMVDQQP---E
CMOB_ARCB4      --------DLEIDSEWQSNIKYNLIRPYFN-LKDKVVADIGCNNGYYMFRMLEDCP---K
CMOB_SULNB      --------DLFIDSEWQSQIKYNLLEPHFD-LKGKVVGDIGCNNGYYLFRMLSQKP---E
CMOB_NITSB      --------GTYIDSEWKSFIKYNLLEPHFD-LEGKDVADIGCNNGYYMFRMLTHHP---R
CMOB_SULDN      --------GTYIDSEWRSNIKYNLLRKHFN-LKDRRVADIGCNNGYYLFRMQEDAP---K
CMOB_CAMJE      --------DLFIDTEWQSFIKFNILKPFMNEISQKCVADIGCNNGYYMFKMLEFNP---A
CMOB_CAMJR      --------DLFIDTEWQSFIKFNILKPFMNEISQKCVADIGCNNGYYMFKMLEFNP---A
CMOB_CAMJJ      --------DLFIDTEWQSFIKFNILKPFMNEISQKCVADIGCNNGYYMFKMLEFNP---A
CMOB_CAMFF      --------ATLIDSEWQSFIKFNGLKPFLN-LKDKIVADVGCNNGYYMFKMLELEP---K
CMOB_CAMHC      --------ETFIDSEWQSFMKFNLLKPFMD-LQGKKVADIGCNNGYYLFRMSNLGA---K
CMOB_WOLSU      --------DFLIDSEWVSAKKYALLEPHFD-LCNKDVADIGCNNGYYMFRMWGQKP---K
CMOB_HELHP      --------DIHIDSEWQSFMKWQLLAPHCN-LEGKYIADVGCNNGYYMFEMLLQGKKLYK
CMOB_HELPY      --------QIKIDSEWDSSIKWDLVKNATP-LKDKVVADVGCNNGYYLFKMLEHGP---K
CMOB_HELPJ      --------QIKIDSEWDSSIKWDLVKNATP-LKDKVVADVGCNNGYYLFKMLEHKP---K
CMOB_HELPH      --------QIKIDSEWDSSIKWDLVKNATL-LKDKVVADVGCNNGYYLFKMLEHGP---K
CMOB_HELAH      --------KIKIDSEWDSSIKWDLVKNATS-LKDKIVADVGCNNGYYLFKMLEHGP---K
                           :: ** .  *:  :      :  : : *:*   **.   :         

CMOB_PSEAE      SVVGVDPNWLFLCQFLAAKRYLP------------ELPAWHLPLALEDLPEK----LEGF
CMOB_PSEAB      SVVGVDPNWLFLCQFLAAKRYLP------------ELPAWHLPLALEDLPEK----LEGF
CMOB_PSEE4      MVIGVDPNWLFFCQFQAVQQYLP------------ELPAWHLPFALEELPAN----LEGF
CMOB_PSEPK      MVIGVDPNWLFFCQFQAVQQYLP------------ELPAWHLPFALEDLPAN----LEGF
CMOB_PSEF5      SVIGVDPNWLFFCQFQAVQRYLS------------EPSVWHLPFPFEDLPAN----LEGF
CMOB_PSEPF      SVIGVDPNWLFFCQFQAVQRYLS------------EPNAWHLPFPFEDLPPN----LEGF
CMOB_PSE14      SVIGVDPNWLFFCQFQAMQRYLP------------DLPAWHLPFALEDLPAN----LEGF
CMOB_PSEU2      SVIGVDPNWLFFCQFQAMQRYLP------------DLPAWHLPFALEDLPAN----LEGF
CMOB_PSESM      SVIGVDPNWLFFCQFQAMQRYLP------------DLPAWHLPFALEDLPAN----LEGF
CMOB_PSEU5      SVVGVDPNWLFFCQFHAMKRYLP------------ELPAWHLPFALEELPPK----LEGF
CMOB_ALCBS      CVVGIDPTILFLVQYLAVRRFAP------------DLPVWFLPLRMEELPAE----GGQF
CMOB_HAHCH      FVLGVDPSPKFLFQFHCVKKYAP------------TAPVYYLPLRSEDLPPN----MDAF
CMOB_MARHV      QVIGIDPGLLFMFQFLAVKGYLG------------QAPVDLLPVRMEDLPAD----MECF
CMOB_GEOMG      FVLGIEPFLVSVMQFQVMQRYLR------------DPRHHVIPIGIEDVPPN----PACF
CMOB_METCA      SVIGIDPTLLSVVQFLAVRHFAG------------DWPVAVLPLGIEDFPAE----TRAF
CMOB_SACD2      QVIGIDPSPRFVVQFYMLKHFIGS-----------NAPVDLLPVPMEAVPAN----LQAF
CMOB_AERHH      LAVGIDPSPLFLCQFEAIRHFAG--NDQR---------AHLLPLGIQELPE-----LRAF
CMOB_AERS4      LAVGIDPSPLFLCQFEAIRHFTG--GDQR---------AHLLPLGIQELPD-----LRAF
CMOB_PSYIN      FVVGIDPSELFLCQFEAVRHFAN--KEQN---------VHLLPLGIQELPK-----LGAF
CMOB_SHEB5      RVVGIDPSPLFLCQFEAVKRLAG--THHP---------VHLLPLGIEELPP-----LDAF
CMOB_SHEB8      RVVGIDPSPLFLCQFEAVKRLAG--THHP---------VHLLPLGIEELPP-----LDAF
CMOB_SHEPC      RVVGIDPSPLFLCQFEAVKRLAG--PHHP---------VHLLPLGIEELPP-----LDAF
CMOB_SHESW      RVVGIDPSPLFLCQFEAVKRLAG--AHHP---------VHLLPLGIEELPP-----LDAF
CMOB_SHESA      RVVGIDPSPLFLCQFEAVKRLSG--ENHP---------VHLLPLGIEELPP-----LDAF
CMOB_SHESM      RVVGIDPSPLFLCQFEAVKRLSG--ENHP---------VHLLPLGIEELPP-----LDAF
CMOB_SHESR      RVVGIDPSPLFLCQFEAVKRLSG--ENHP---------VHLLPLGIEELPP-----LDAF
CMOB_SHEON      RVVGIDPSPLFLCQFEAVKRLSG--ENHP---------VHLLPLGIEELPP-----LDAF
CMOB_SHEDO      RVVGIDPSPLFLCQFEAIKRLAG--NQHP---------VHLLPLGIEELPP-----LDAF
CMOB_SHEFN      RVVGIDPSPLFLCQFEAIKRVAG--NQHP---------VYLLPLGIEELPP-----LDAF
CMOB_SHELP      RVVGIDPSPLFLCQFEAVKRLAG--NDHP---------VHLLPLGIEQLPP-----LDAF
CMOB_SHEAM      RVVGIDPSALFLCQFEAIKRLID--TELP---------VHLLPLGIEELPP-----LDAF
CMOB_HAEI8      MVVGIDPTELFLCQFEAVRKLLN--NDRR---------ANLIPLGIEQMQP-----LAAF
CMOB_HAEIE      MVVGIDPTELFLCQFEAVRKLLN--NDRR---------ANLIPLGIEQMQP-----LAAF
CMOB_HAEIG      MVVGIDPTELFLCQFEAVRKLLN--NDRR---------ANLIPLGIEQMQP-----LAAF
CMOB_HAEIN      MVVGIDPTELFLCQFEAVRKLLN--NDRR---------ANLIPLGIEQMQP-----LAAF
CMOB_PASMU      IVVGIDPTELFLCQFEAVRKLLN--NDRR---------ANLIPLGIEQMQP-----LAAF
CMOB_HAES1      MVVGIDPTELFLCQFEAVRKLLN--NDRR---------ANLIPLGIEEMQP-----LAAF
CMOB_MANSM      MVVGIDPTELFLCQFEAVRKLLN--NDRR---------ANLIPLGIEEMQP-----LGVF
CMOB_ACTP2      MVVGIDPTELFLCQFEVVRKLLG--NDRR---------ANLIPLGIEQMQP-----LAAF
CMOB_HAEDU      MVVGIDPTELFLCQFEAVRQLLG--NDRR---------ANLIPLGLEQMQP-----LAAF
CMOB_SALTY      LAVGIDPTQLFLCQFEAVRKLLG--NDQR---------AHLLPLGIEQLPA-----LKAF
CMOB_SALCH      LAVGIDPTQLFLCQFEAVRKLLG--NDQR---------AHLLPLGIEQLPA-----LKAF
CMOB_SALPA      LAVGIDPTQLFLCQFEAVRKLLG--NDQR---------AHLLPLGIEQLPA-----LKAF
CMOB_SALTI      LAVGIDPTQLFLCQFEAVRKLLG--NDQR---------AHLLPLGIEQLPA-----LKAF
CMOB_ECOUT      LAVGIDPTQLFLCQFEAVRKLLG--NDQR---------AHLLPLGIEQLPA-----LKAF
CMOB_ECOK1      LAVGIDPTQLFLCQFEAVRKLLG--NDQR---------AHLLPLGIEQLPA-----LKAF
CMOB_ECOLI      LAVGIDPTQLFLCQFEAVRKLLG--NDQR---------AHLLPLGIEQLPA-----LKAF
CMOB_ECOL6      LAVGIDPTQLFLCQFEAVRKLLG--NDQR---------AHLLPLGIEQLPA-----LKAF
CMOB_ECOL5      LAVGIDPTQLFLCQFEAVRKLLG--NDQR---------AHLLPLGIEQLPA-----LKAF
CMOB_SHIDS      LAVGIDPTQLFLCQFEAVRKLLG--NDQR---------AHLLPLGIEQLPA-----LKAF
CMOB_ECO57      LAVGIDPTQLFLCQFEAVRKLLG--NDQR---------AHLLPLGIEQLPA-----LKAF
CMOB_SHIBS      LAVGIDPTQLFLCQFEAVRKLLG--NDQR---------AHLLPLGIEQLPA-----LKAF
CMOB_SHISS      LAVGIDPTQLFLCQFEAVRKLLG--NDQR---------AHLLPLGIEQLPA-----LKAF
CMOB_SHIFL      LAVGIDPTQLFLCQFEAVRKLLG--NDQR---------AHLLPLGIEQLPA-----LKAF
CMOB_SHIF8      LAVGIDPTQLFLCQFEAVRKLLG--NDQR---------AHLLPLGIEQLPA-----LKAF
CMOB_CITK8      LAVGIDPTQLFLCQFEAVRKLLG--NDQR---------AHLLPLGIEQLPA-----LNTF
CMOB_KLEP7      LAVGIDPTQLFLCQFEAVRKLLG--NDQR---------AHLLPLGIEQLPA-----LEAF
CMOB_CROS8      LAVGIDPTQLFLCQFEAVRKLLG--GDNR---------AHVLPLGIEQMPA-----LNAF
CMOB_YERPE      LAVGIDPMQLFLCQFEAIRKLLG--GDQR---------AHVLPLGIEQLPE-----LAAF
CMOB_YERPA      LAVGIDPMQLFLCQFEAIRKLLG--GDQR---------AHVLPLGIEQLPE-----LAAF
CMOB_YERPN      LAVGIDPMQLFLCQFEAIRKLLG--GDQR---------AHVLPLGIEQLPE-----LAAF
CMOB_YERPP      LAVGIDPMQLFLCQFEAIRKLLG--GDQR---------AHVLPLGIEQLPE-----LAAF
CMOB_YERPS      LAVGIDPMQLFLCQFEAIRKLLG--GDQR---------AHVLPLGIEQLPE-----LAAF
CMOB_YERE8      LAVGIDPMQLFLCQFEAIRKLLG--GDQR---------AHVLPLGIEQLPE-----LAAF
CMOB_PECAS      MAVGIDPMQLFLCQFEAVRKLLG--DDQR---------AHVLPLGIEQLPE-----LAAF
CMOB_SODGM      LAVGIDPMQLFYCQFAAVRKLLG--GDQR---------AHLLPLGIEQLPA-----LAAF
CMOB_PHOLL      LAVGIDPTQLFLCQFEAVRKLLG--NDQR---------AHLLPLGIEQLPA-----LAAF
CMOB_VIBCB      LTVGIDPSHLFLIQFEAIRKLMG--DDQR---------AHLLPLGIEQLPK-----LEAF
CMOB_VIBPA      LCVGIDPSHLFLIQFEAIRKLMG--GDQR---------AHLLPLGIEQLPK-----LEAF
CMOB_VIBVU      LCVGIDPSHLFLIQFEAIRKLMG--GDQR---------AHLLPLGIEQLPK-----LEAF
CMOB_VIBVY      LCVGIDPSHLFLIQFEAIRKLMG--GDQR---------AHLLPLGIEQLPK-----LEAF
CMOB_ALIF1      LCVGIDPSHLFLIQFEAIRKLMG--NDQR---------AHLLPLGIEQLPE-----LNAF
CMOB_VIBCH      QVFGIDPSELFLIQFEAVRKLLG--DDQR---------VHLLPLGIEQMPE-----LNAF
CMOB_PHOPR      LTVGIDPSNLFLIQFEAIRRLMG--DDNR---------AFLLPLGIEQLPE-----LKAF
CMOB_PSEA6      MVVGADPSQLFLMQFQATKHFN---PDPR---------IHLLPVGVEQLPE-----KNAF
CMOB_PSET1      FVVGIDPSDLFLCQFQAIKHFN---PDEN---------VHLLPLGVEALPE-----LKAF
CMOB_COLP3      FVVGIDPTQLFLMQFNAIKHFI---DDSP---------VHLLPLGVEQLPE-----LKAF
CMOB_IDILO      QVWGIDPGELFLMQFRAISQLMPLSWQQR---------AHFFPVGIEHMPE-----LKSF
CMOB_PSYA2      TVIIIDPSCLFYHQFMAIRHFVGSADAHD----IGRYRTHYIPVPLEALPDN----SQLF
CMOB_PSYCK      TVIIIDPSCLFYHQFMAIRHFVGSADAHTYTHGTGRYRTHYIPVPLEALPEH----SQLF
CMOB_CHRSD      FVLIVDPSPRFYYQFQAVRHFVGDADGWR---------THFLPVGIEAVPPK----LEAF
CMOB_HYDCU      LALGVDPGLLFMTQFLAIKHFVGESLP-----------AYFLPLTLEQLPKTQP--SEVF
CMOB_DICNV      CAVGVDPSWLYFAQFLALQKFFQ---QNR---------AVYLPTTLDDLSL------EGF
CMOB_RUTMC      IALGIEPFLLFNYQFQAIRTLINNLPN-----------VFVLPLSLDKIPK-----KPLF
CMOB_PELCD      LALGLEPYPPLFCQYVLLQRWLKL------------PQVHCLPLKLEELPPM----DGYF
CMOB_DESPS      FVLGIEPSVQHYYCFKALEEMSGL------------TNLEIDLLGVEHLPLF----TESF
CMOB_TRIEI      LVIGFEPYSKHFWNFQLIQNIVKQ------------KMLAFELLGVEHIHYY----PQFF
CMOB_ARCB4      RLIGFDPSPLTLHQFEFVNHFV-------------KSDIVYEMLGVEHLEFY----NHKF
CMOB_SULNB      KLIGFDPSAIYYSQFRFLEHFI-------------KSDIVYELLGVEHVEFY----EHKF
CMOB_NITSB      SLTGFDPSPLFRTQFDFINHFV-------------QSSIVYELLGVEHVPRY----GKKF
CMOB_SULDN      LLVGFDPSPLFKTQFDFINRFV-------------KSDIVYELLGVEHLEFY----EDKF
CMOB_CAMJE      KLIGFDPSIKYRLQFELINALA-------------KTPIKYELLGVEDLPSY----SLKF
CMOB_CAMJR      KLIGFDPSIKYRLQFELINALA-------------KTPIKYELLGVEDLPSY----GLKF
CMOB_CAMJJ      KLIGFDPSIKYRLQFELINALA-------------KTPIKYELLGVEDLPSY----SLKF
CMOB_CAMFF      SIVGFDPSVLSFLQFSFINHFV-------------KSNIKFELLGVQDLPNY----NIKF
CMOB_CAMHC      KLIGFDPGVRTFLQFRFLEHFL-------------KSGVIYELLGVENLPDY----GEKF
CMOB_WOLSU      SLTGFDPSPLCRTQFDFINHFI-------------QAPIRFELLGVEHLEGY----GKLF
CMOB_HELHP      KIIGFDPSGIFKCQFDFINHFI-------------NAPIEFELLGVEDLLAYSQAHNQSF
CMOB_HELPY      SLVGFDPGVLVKKQFEFLAPFFDK-----------EKKIIYESLGVEDLHEK---YPNAF
CMOB_HELPJ      SLVGFDPGVLVKKQFEFLAPFFDK-----------EKKIIYESLGVEDFHEK---YPNAF
CMOB_HELPH      SLVGFDPGVLVKKQFEFLAPFFDK-----------EKKIIYESLGVEDLHEK---YPNAF
CMOB_HELAH      SLVGFDPGVLVKKQFEFLAPFFDK-----------EKKIIYKSLGVEDLNEK---YPNAF
                     :*       :                               : .          *

CMOB_PSEAE      DTVFSMGVLYHRRSPIDHLLALKDCLKRGGELVLETLVVEGDASTVLVPEDRYAQMRNVW
CMOB_PSEAB      DTVFSMGVLYHRRSPIDHLLALKDCLKRGGELVLETLVVEGDASTVLVPEDRYAQMRNVW
CMOB_PSEE4      DTVFSMGVFYHRRSPIEHLLALKDCLVKGGELVLETLVIEGDENQVLVPEDRYAQMRNVW
CMOB_PSEPK      DTVFSMGVFYHRRSPIEHLLALKDCLVKGGELVLETLVIEGDENQVLVPEDRYAQMRNVW
CMOB_PSEF5      DTVFSMGVFYHRRSPIEHLLALKDCLVKGGELVLETLVVEGDQHQVLVPEDRYAQMRNVW
CMOB_PSEPF      DTVFSMGVFYHRRSPIEHLLALKDCLVKGGELVLETLVVEGDKHQVLVPEDRYAQMRNVW
CMOB_PSE14      DTVFSMGVLYHRKSPIDHLLALKDCLVKGGELVMETLVVPGDVHQVLVPEDRYAQMRNVW
CMOB_PSEU2      DTVFSMGVLYHRKSPIDHLLALKDCLVKGGELVMETLVVPGDVHQVLVPEDRYAQMRNVW
CMOB_PSESM      DTVFSMGVLYHRKSPIDHLLALKDCLVKGGELVMETLVIPGDVHQVLVPEDRYAQMRNVW
CMOB_PSEU5      ETVFSMGVLYHRRSPVDHLLDLKDCLVRGGELVLETLVVEGDENTALVPEDRYAQMRNVW
CMOB_ALCBS      DTVFSMGVLYHRRSPLDHLLELKGALCAGGELVLETLVVEGDECTVLMPQDRYAMMRNVF
CMOB_HAHCH      DTVFSMGVLYHRRSPFDHIDELKAALRPGGELVLETLIVPGDENTVLTPLDRYAQMRNVW
CMOB_MARHV      DTTFSMGVLYHRRSPLDHLLELKGTLRRGGELVLETLVVDGPEGYSLMPEDRYGQMRNVW
CMOB_GEOMG      DSVFSMGVLYHRRSPLDHLLELKGCLRPGGELILETLIVEGGQETIFMPPGRYAKMRNVW
CMOB_METCA      DTVFSMGVLYHRRSPFDHLVELKGCLRPGGELVLETLVVEGEAGRVLVPEGRYAQMRNVW
CMOB_SACD2      DTTFSMGVLYHRRSPMDHLRELKATLRPGGQLVLETLVIEGKLGEVLVPEGRYAMMNNVW
CMOB_AERHH      DTVFSMGVLYHRKSPIEHIEQLRNQLKDDGELVLETLVIDGGVNDVLVPTDRYGKMRNVW
CMOB_AERS4      DTVFSMGVLYHRKSPIEHIEQLRNQLKDDGELVLETLVVDGGVNEVLVPTDRYGKMRNVW
CMOB_PSYIN      DTVFSMGVLYHRKSPMDHITQLQDQLVEGGELVLETLVIGGDENAVLVPQDRYAKMRNIW
CMOB_SHEB5      DTVFSMGVLYHRRSPIDHLLQLRDQLRTGGELVLETLVIDGDENAVLVPQDRYGKMNNVW
CMOB_SHEB8      DTVFSMGVLYHRRSPIDHLLQLRDQLRTGGELVLETLVIDGDENAVLVPQDRYGKMNNVW
CMOB_SHEPC      DTVFSMGVLYHRRSPIDHLLQLRDQLRTGGELVLETLVIDGDENAVLVPQDRYGKMNNVW
CMOB_SHESW      DTVFSMGVLYHRRSPIDHLLQLRDQLRTGGELVLETLVIDGDENAVLVPQDRYGKMNNVW
CMOB_SHESA      DTVFSMGVLYHRRSPIDHLLQLRDQLRMGGELVLETLVIDGDENAVLVPQDRYGKMNNVW
CMOB_SHESM      DTVFSMGVLYHRRSPIDHLLQLRDQLRMGGELVLETLVIDGDENAVLVPQDRYGKMNNVW
CMOB_SHESR      DTVFSMGVLYHRRSPIDHLLQLRDQLRMGGELVLETLVIDGDENAVLVPQDRYGKMNNVW
CMOB_SHEON      DTVFSMGVLYHRRSPIDHLLQLRDQLRMGGELVLETLVIDGDENAVLVPQDRYGKMNNVW
CMOB_SHEDO      DTVFSMGVLYHRRSPIDHLYQLRDQLRMGGELVLETLVIDGDENTVLVPEDRYGKMNNVW
CMOB_SHEFN      DTVFSMGVLYHRRSPIDHLLQLRDQLRVGGELVLETLVIDGDENAVLVPQDRYGKMNNVW
CMOB_SHELP      DTVFSMGVLYHRRSPIDHLLQLRDQLRTGGELVLETLVVDGDENTVLVPGERYGKMNNVW
CMOB_SHEAM      DTVFSMGVLYHRRSPIDHLLQLRDQLRMGGELVLETLVVDGDKDTVLVPQDRYGKMNNVW
CMOB_HAEI8      DTVFSMGVLYHRKSPLDHLSQLKNQLVKGGELVLETLVVDGDVNTVLIPADRYAKMKNVY
CMOB_HAEIE      DTVFSMGVLYHRKSPLDHLSQLKNQLVKGGELVLETLVVDGDVNTVLIPADRYAKMKNVY
CMOB_HAEIG      DTVFSMGVLYHRKSPLDHLSQLKNQLVKGGELVLETLVVDGDVNTVLVPIDRYAKMKNVY
CMOB_HAEIN      DTVFSMGVLYHRKSPLDHLSQLKNQLVKGGELVLETLVVDGDINTVLVPADRYAKMKNVY
CMOB_PASMU      DTVFSMGVLYHRKSPLDHLSQLKNQLVRGGELVLETLVVDGDINTVLVPADRYAKMKNVY
CMOB_HAES1      DTVFSMGVLYHRKSPLDHLTQLKNQLVKDGELVLETLVVEGDINTTLVPTDRYAKMKNVY
CMOB_MANSM      DTVFSMGVLYHRKSPLDHLSQLKNQLRKGGELVLETLVTDGDEHHVLVPAERYAKMKNVY
CMOB_ACTP2      DTVFSMGVLYHRKSPLDHLSQLKAQLVKGGELVLETLVIDGDVNTCLVPADRYAKMKNVY
CMOB_HAEDU      DTVFSMGVLYHRKSPLDHLSQLKAQLVKGGELVLETLIIDGDINDILTPADRYAKMKNVY
CMOB_SALTY      DTVFSMGVLYHRRSPLEHLWQLKDQLVNEGELVLETLVIDGDENTVLVPGDRYAQMRNVY
CMOB_SALCH      DTVFSMGVLYHRRSPLEHLWQLKDQLVNEGELVLETLVIDGDENTVLVPGDRYAQMRNVY
CMOB_SALPA      DTVFSMGVLYHRRSPLEHLWQLKDQLVNEGELVLETLVVDGDENTVLVPGDRYAQMRNVY
CMOB_SALTI      DTVFSMGVLYHRRSPLEHLWQLKDQLVNEGELVLETLVVDGDENTVLVPGDRYAQMRNVY
CMOB_ECOUT      DTVFSMGVLYHRRSPLEHLWQLKDQLVNEGELVLETLVIDGDENTVLVPGDRYAQMRNVY
CMOB_ECOK1      DTVFSMGVLYHRRSPLEHLWQLKDQLVNEGELVLETLVIDGDENTVLVPGDRYAQMRNVY
CMOB_ECOLI      DTVFSMGVLYHRRSPLEHLWQLKDQLVNEGELVLETLVIDGDENTVLVPGDRYAQMRNVY
CMOB_ECOL6      DTVFSMGVLYHRRSPLEHLWQLKDQLVNEGELVLETLVIDGDENTVLVPGDRYAQMRNVY
CMOB_ECOL5      DTVFSMGVLYHRRSPLEHLWQLKDQLVNEGELVLETLVIDGDENTVLVPGDRYAQMRNVY
CMOB_SHIDS      DTVFSMGVLYHRRSPLEHLWQLKDQLVNEGELVLETLVIDGDENTVLVPGDRYAQMRNVY
CMOB_ECO57      DTVFSMGVLYHRRSPLEHLWQLKDQLVNEGELVLETLVIDGDENTVLVPGDRYAQMRNVY
CMOB_SHIBS      DTVFSMGVLYHRRSPLEHLWQLKDQLVNEGELVLETLVIDGDENTVLVPGDRYAQMRNVY
CMOB_SHISS      DTVFSMGVLYHRRSPLEHLWQLKDQLVNEGELVLETLVIDGDENTVLVPGDRYAQMRNVY
CMOB_SHIFL      DTVFSMGVLYHRRSPLEHLWQLKDQLVNEGELVLETLVIDGDENTVLVPGDRYAQMRNVY
CMOB_SHIF8      DTVFSMGVLYHRRSPLEHLWQLKDQLVNEGELVLETLVIDGDENTVLVPGDRYAQMRNVY
CMOB_CITK8      DTVFSMGVLYHRRSPLEHLWQLKDQLVKDGELVLETLVVEGDENTVLVPGDRYAQMRNVY
CMOB_KLEP7      DTVFSMGVLYHRRSPLDHLWQLKDQLAPGGELVLETLVVEGDENTVLVPGDRYAQMRNVY
CMOB_CROS8      DTVFSMGVLYHRRSPLDHLWQLKDQLVKDGELVLETLVVEGDENTVLVPGERYAQMRNVY
CMOB_YERPE      DTVFSMGVLYHRRSPLDHLYQLKNQLVTDGELVLETLVVEGDSQQVLVPGDRYAQMRNVY
CMOB_YERPA      DTVFSMGVLYHRRSPLDHLYQLKNQLVTDGELVLETLVVEGDSQQVLVPGDRYAQMRNVY
CMOB_YERPN      DTVFSMGVLYHRRSPLDHLYQLKNQLVTDGELVLETLVVEGDSQQVLVPGDRYAQMRNVY
CMOB_YERPP      DTVFSMGVLYHRRSPLDHLYQLKNQLVTDGELVLETLVVEGDSQQVLVPGDRYAQMRNVY
CMOB_YERPS      DTVFSMGVLYHRRSPLDHLYQLKNQLVTDGELVLETLVVEGDSQQVLVPGDRYAQMRNVY
CMOB_YERE8      DTVFSMGVLYHRRSPLDHLYQLKNQLVNEGELVLETLVVEGDSQQVLVPGDRYAQMRNVY
CMOB_PECAS      DTVFSMGVLYHRRSPLDHLWQLKNQLVAGGELVLETLVIEGDENQVLVPGERYAQMRNVY
CMOB_SODGM      DTVFSMGVLYHRRSPLDHLLQLKNQLVSGGELVLETLVIEGDSQQVLVPGERYAQMRNVY
CMOB_PHOLL      DTVFSMGVLYHRRSPLDHLWQLKNQLISDGELILESLVVEGDEHTCLIPGERYAQMRNVY
CMOB_VIBCB      DTVFSMGVLYHRRSPLDHLVQLKDQLVSGGELVLETLVIEGDENAVLVPTSRYAQMRNVY
CMOB_VIBPA      DTVFSMGVLYHRRSPLDHLIQLKDQLVSGGELVLETLVIEGDENAVLVPTSRYAQMRNVY
CMOB_VIBVU      DTVFSMGVLYHRRSPLDHLIQLKDQLVSGGELILETLVIEGDETAVLVPKERYAQMRNVY
CMOB_VIBVY      DTVFSMGVLYHRRSPLDHLIQLKDQLVSGGELILETLVIEGDETAVLVPKERYAQMRNVY
CMOB_ALIF1      DTVFSMGVLYHRRSPLDHLIQLKNQLVAGGELVLETLVIDGDENAVLMPVDRYAQMRNVY
CMOB_VIBCH      DTVFSMGVLYHRRSPLDHLLQLKNQLVAGGELILETLVVEGDEHTVLVPFDRYAQMRNVY
CMOB_PHOPR      DTVFSMGVLYHRRSPLDHIIQLKNQLRKDGEVILETLVIEGDENAVLVPTGRYAQMHNVY
CMOB_PSEA6      DTVFSMGVLYHRKSPLDFLQQLKNQLRPGGELILETLVVEGDENTVLMAGDRYAQMRNVW
CMOB_PSET1      DTVFSMGVLYHRRSPIDFLAQLKAQLRPGGELVLETLVIEGDENTVLVPTDRYAKMRNVW
CMOB_COLP3      DTVFAMGVLYHRRSPIDFLYQLKAQLVKGGELVLETLIVDGDENTVLVPGERYAKMRNVW
CMOB_IDILO      DTVFSMGVLYHRRSPVEFLQQLKSLIRPGGQLVLETIVVEGDETTVMMPGERYAQMRNVW
CMOB_PSYA2      DTVFSMGVLYHRQSPFEHLQQLKGQLVKGGELVLETLVIEGDANTVLVPHDRYAQMNNVY
CMOB_PSYCK      DTVFSMGVLYHRQSPFEHLQQLKGQLVKGGELVLETLVIEGDANTVLVPHDRYAQMNNVY
CMOB_CHRSD      DTTFSMGVLYHRPSPLEHLMQLRDTLRPGGELVLETLVVEGDANTVFMPGERYAAMPNVY
CMOB_HYDCU      DTVFSMGVLYHRRSPIDHIMDLKRYLKPGGELVLETLVIPDAQGQLLVPKERYAQMNNVW
CMOB_DICNV      DCVLAMGVLYHRRDPLAFLAQLRNAVVCGGDLVIETLVVDGDAQTVYMPKQEYVGMHNVW
CMOB_RUTMC      DTVFSMGVLYHQKDYELHLNQLKDVMKPSGELILETLIIDLEKVKKIIPKGRYAKMRNVY
CMOB_PELCD      DTIFHMGVLYHQRSPHEALKQLASLLRPGGELVLETLVLDGDQDLALCPRDRYAKMRNVF
CMOB_DESPS      DVVFLMGIIYHRSAPIETLRAVLDSLKPGGTLILETQGIPGEQPYALFPDKTYAKVPGTY
CMOB_TRIEI      DTIFCLGILYHHTDPIGLLRKMRQALGPKGEVIIDCQGIPGDLPVALTPQKRYAQARGIW
CMOB_ARCB4      DFIFMLGVLYHRPDPVGTLKSLARGLNSKGEILIDTFMIDGEEEICLTPNKRYSKIPNIY
CMOB_SULNB      DTLFCLGVLYHRSDPVAMLKSLFKGLNKGGELILDTFMIDGEGEMCLTPRDRYSKIPNIY
CMOB_NITSB      DVIFCLGVLYHRSDPIAMLKWLKQGLKEGGEIFLDTFYIEGEDPVALCPGKTYSKIPNVH
CMOB_SULDN      DTIFCLGVLYHRSDPVSMLKSLYKGLDKEGEVILDTFYIEGDEEICLSPASSYSKIPNIY
CMOB_CAMJE      DVIFCLGVIYHRSDPIKMLKDLKAGLNKNGVVFLDTMYIEDEREIALVPNKTYSKIPNIY
CMOB_CAMJR      DVIFCLGVIYHRSDPIKMLKDLKAGLNKNGVVFLDTMYIEDEREIALVPNKTYSKIPNIY
CMOB_CAMJJ      DVIFCLGVIYHRSDPVKMLKDLKAGLNKNGVVFLDTMYIEDEREIALVPNKTYSKIPNIY
CMOB_CAMFF      DTILCLGVLYHRSDPIKTLKELKSSLNKGGEVFIDTMFIQRDDEFVLSPKSTYSKIPNIY
CMOB_CAMHC      DSIFCLGVLYHRSDPVRALKELKSSLNSGGEVFLDTMFIDGDDEICLFPRLSYAKISNIY
CMOB_WOLSU      DVIFCLGVLYHRSDPIQTLKSLYKGLAKGGELLLDTLMIEGEEEVALTPKDRYAKMSNVY
CMOB_HELHP      DVIFCLGVLYHRFDPINTLKILSQSLNKGGELILDTLIYESNEEICLCPAQSYAKMSNVY
CMOB_HELPY      DVIFCLGVLYHRKSPLEALKALYHALKIKGELVLDTLIIDSPLDIALCPKKTYAKMKNVY
CMOB_HELPJ      DVIFCLGVLYHRKSPLEALKALYHALKIKGELVLDTLIIDSPLDIALCPKKTYAKMKNVY
CMOB_HELPH      DVIFCLGVLYHRKSPLEALKALYHALKIKGELVLDTLIIDSPLDIALCPKKTYAKMKNVY
CMOB_HELAH      DVIFCLGVLYHRKSPLETLKALYHALKIGGELVLDTLIIDSPLDIALCPKKTYAKMKNAY
                :  : :*::**:      :  :   :   * :.::             .   *    .  

CMOB_PSEAE      FLPSVAALELWLRRAGFADARCVDVSLTSVEEQRSTEWMRF--QSLPEFLDPQDRSRTVE
CMOB_PSEAB      FLPSVAALELWLRRAGFADARCVDVSLTSVEEQRSTEWMRF--QSLPEFLDPQDRSRTVE
CMOB_PSEE4      FLPSVPALERWLRRAGFSDVHCVDVSVTSVEEQRSTEWMRY--QSLGDFLDPNDHGKTVE
CMOB_PSEPK      YLPSVPALARWLRRAGFSDVRCVDVSVTSVEEQRSTDWMRY--QSLSDFLDPNDHSKTVE
CMOB_PSEF5      FLPSVPALELWLRRAGFSDVRCVDVSVTSIEEQRGTEWMKY--QSLSDFLDPNDHSKTIE
CMOB_PSEPF      FLPSVPALELWLRRAGFTDVRCVDVSMTTVDEQRGTEWMKY--QSLSDFLDPDDHSKTIE
CMOB_PSE14      FLPSVPALELWMRRAGFTDVRCVDVSHTTIEEQRSTEWMRF--QSLSDYLDPADHSKTVE
CMOB_PSEU2      FLPSVPALELWMRRAGFTDVRCVDVSHTTVDEQRSTEWMRF--QSLSDYLDPTDHSKTVE
CMOB_PSESM      FLPSVPALELWMRRAGFTDVRCVDVSHTTVEEQRSTEWMRF--QSLGDYLDPNDHSKTVE
CMOB_PSEU5      FLPSVPALERWLRRAGFVDVRCVDVSVTSVEEQRSTYWMRY--QSLPDFLDPQDHGRTVE
CMOB_ALCBS      FLPSVAMLSRWLERCGFVDVRCVDESNTSVQEQRSTDWMRF--QSLPDFLDPEDHSLTRE
CMOB_HAHCH      FIGSSLATKRWLERCGFEDVRIVDEGVTSLDEQRQTDWMTF--QSLKDFLDPEDFSRTVE
CMOB_MARHV      FLPSCPTLLRWLDRTGFRNARVVDVSETTTDEQRQTDWMRF--NSLADFLDPDNPSKTIE
CMOB_GEOMG      FLPSIAALTLWLQRCGFTEIACVDATRTTCEEQRATEWMRF--ESLADFLDPDDGGKTME
CMOB_METCA      FVPSPPTLSSWLTRAGFRQARLIDVSPTTTQEQRSTGWMRF--QSLADFLDPEDPSRTIE
CMOB_SACD2      FLPSVPTLISWLTKCGFKNARCVDVNQTSTDEQRSTEWMTF--QSLSDFLDPNDPTLTAE
CMOB_AERHH      FIPSSAALKLWVERCGFTDVRIVDENMTSTDEQRRTDWMIN--ESLSDYLDPTNPALTVE
CMOB_AERS4      FIPSSAALKLWVERCGFTDVRIVDENMTSTDEQRRTDWMIN--ESLSDYLDPADPALTVE
CMOB_PSYIN      FLPSAQALKLWVEKCGFENVRIADINDTLTGEQRSTAWMTN--ESLEDYLDPNDPSRTVE
CMOB_SHEB5      FIPSVAALMLWLKKCDFTDIRCVDTDVTALAEQRRTDWMPN--ESLVEYLDPNDITKTVE
CMOB_SHEB8      FIPSVAALMLWLKKCDFTDIRCVDTDVTALAEQRRTDWMPN--ESLVEYLDPNDITKTVE
CMOB_SHEPC      FIPSVAALMLWLKKCDFTDIRCVDTDVTALAEQRRTDWMPN--ESLVEYLDPNDITKTVE
CMOB_SHESW      FIPSVAALMLWLKKCDFTDIRCVDTDVTALAEQRRTDWMPN--ESLLEYLDPTDITKTIE
CMOB_SHESA      FIPSVAALMLWLKKCDFTDIRCVDTDVTALAEQRRTDWMPN--ESLVEYLDPNDITKTIE
CMOB_SHESM      FIPSVAALMLWLKKCDFTDIRCVDTDVTALAEQRRTDWMPN--ESLVEYLDPNDITKTIE
CMOB_SHESR      FIPSVAALMLWLKKCDFTDIRCVDTDVTALAEQRRTDWMPN--ESLVEYLDPNDITKTIE
CMOB_SHEON      FIPSVAALMLWLKKCDFTDIRCVDTDVTALAEQRRTDWMPN--ESLVEYLDPKDITKTVE
CMOB_SHEDO      FLPSVAALMLWLKKCDFTNIRCVDVDTTSLAEQRSTTWMPN--ESLVDYLDPKDINLTIE
CMOB_SHEFN      FIPSVAALMLWLKKCEFIDIRCVDIDITSLAEQRSTHWMKN--ESLVDYLDPNDVSLTVE
CMOB_SHELP      FLPSAKALEAWLKKADFVDVRCVDIDVTSLAEQRSTEWMPN--ESLVDYLDPNDVSLTVE
CMOB_SHEAM      FLPSIDALKLWLEKCDFTDVRCVNVDVTSLAEQRSTPWMQN--ESLVDYLDPKDVNLTVE
CMOB_HAEI8      FIPSVAALINWLEKVGFTNVRCVDVATTTLEEQRKTDWLEN--ESLIDFLDSNDHSKTIE
CMOB_HAEIE      FIPSVAALINWLEKVGFTNVRCVDVATTTLEEQRKTDWLEN--ESLIDFLDPNDHSKTIE
CMOB_HAEIG      FIPSVAALINWLEKVGFTNVRCVDVATTTLEEQRKTDWLEN--ESLIDFLDPNDHSKTIE
CMOB_HAEIN      FIPSVATLINWLEKVGFTNVRCVDVATTTLEEQRKTDWLEN--ESLIDFLDPNDHSKTIE
CMOB_PASMU      FIPSVPALINWLEKVGFKNVRCVDVAPTSLAEQRKTDWLEN--ESLIDFLDPCDHTKTIE
CMOB_HAES1      FIPSVLALINWLEKCGFHNIRCVDVETTGLEEQRKTDWLEN--ESLIDFLNPQDHSKTIE
CMOB_MANSM      FIPSVPCLINWLEKSGFSNVRCVDVEVTSLEEQRKTEWLEN--ESLIDFLDPNDHSKTIE
CMOB_ACTP2      FIPSIDCLINWLEKVGFKNVRCVDQAVTTLEEQRKTDWLEN--ESLVDFLDPNDHSKTIE
CMOB_HAEDU      FIPSVAALINWLKKIGFKNARCVDQSVTTLAEQRKTEWLEN--ESLVDFLDPTDQRKTIE
CMOB_SALTY      FIPSAPALKKWLEKCGFIDVRIADVCVTTTEEQRRTEWMVT--ESLADFLDPNDRSKTVE
CMOB_SALCH      FIPSAPALKKWLEKCGFIDVRIADVCVTTTEEQRRTEWMVT--ESLADFLDPNDRSKTVE
CMOB_SALPA      FIPSAPALKKWLEKCGFVDVRIADVCVTTTEEQCRTEWMVT--ESLADFLDPNDRSKTVE
CMOB_SALTI      FIPSAPALKKWLEKCGFVDVRIADVCVTTTEEQRRTEWMVT--ESLADFLDPNDRSKTVE
CMOB_ECOUT      FIPSALALKNWLKKCGFVDIRIADVSVTTTEEQRRTEWMVT--ESLADFLDPHDPGKTVE
CMOB_ECOK1      FIPSALALKNWLKKCGFVDIRIADVSVTTTEEQRRTEWMVT--ESLADFLDPHDPGKTVE
CMOB_ECOLI      FIPSALALKNWLKKCGFVDIRIADVSVTTTEEQRRTEWMVT--ESLADFLDPHDPGKTVE
CMOB_ECOL6      FIPSALALKNWLKKCGFVDIRIADVSVTTTEEQRRTEWMVT--ESLADFLDPHDPGKTVE
CMOB_ECOL5      FIPSALALKNWLKKCGFVDIRIADVSVTTTEEQRRTEWMVT--ESLADFLDPHDPGKTVE
CMOB_SHIDS      FIPSALALKNWLKKCGFVDIRIADVSVTTTEEQRRTEWMVT--ESLADFLDSHDPGKTVE
CMOB_ECO57      FIPSALALKNWLKKCGFVDIRIADVSVTTTEEQRRTEWMVT--ESLSDFLDPHDPSKTVE
CMOB_SHIBS      FIPSALALKNWLKKCGFVDIRVVDVCVTTTEEQRRTEWMVT--ESLSDFLDPHDPSKTVE
CMOB_SHISS      FIPSALALKNWLKKCGFVDIRIVDVCVTTTEEQRRTEWMVT--ESLSDFLDPHDPSKTVE
CMOB_SHIFL      FIPSALALKNWLKKCGFVDIRIVDVCVTTTEEQRRTEWMVT--ESLSDFLDPHDPSKTVE
CMOB_SHIF8      FIPSALALKNWLKKCGFVDIRIVDVCVTTTEEQRRTEWMVT--ESLSDFLDPHDPSKTVE
CMOB_CITK8      FIPSALALKNWLEKCGFVDVRIADVCVTSTEEQRRTGWMVT--ESLADFLDPNDHSKTVE
CMOB_KLEP7      FIPSAAALKMWLEKCGFIDVRIVDACVTSTEEQRRTEWMTT--ESLADFLDPQDQRKTVE
CMOB_CROS8      FIPSAAALKNWLEKCGFVDVKIADFSVTTVEEQRRTAWMET--ESLADFLDPHDATKTRE
CMOB_YERPE      FIPSAPALKAWLEKCGFVDVRIADMAVTTTEEQRRTDWMTS--ESLAEFLDPHDHSKTVE
CMOB_YERPA      FIPSAPALKAWLEKCGFVDVRIADMAVTTTEEQRRTDWMTS--ESLAEFLDPHDHSKTVE
CMOB_YERPN      FIPSAPALKAWLEKCGFVDVRIADMAVTTTEEQRRTDWMTS--ESLAEFLDPHDHSKTVE
CMOB_YERPP      FIPSAPALKAWLEKCGFVDVRIADMAVTTTEEQRRTDWMTS--ESLAEFLDPHDHSKTVE
CMOB_YERPS      FIPSAPALKAWLEKCGFVDVRIADMAVTTTEEQRRTDWMTS--ESLAEFLDPHDHSKTVE
CMOB_YERE8      FIPSAPALKAWLEKCGFVDVKIADMAVTTTDEQRRTDWMTS--ESLAEFLDPNDPTKTVE
CMOB_PECAS      FIPSAVALTTWLEKCGFVDVRIVDICTTTTQEQRRTDWMIT--ESLAEFLDPEDPTKTVE
CMOB_SODGM      FIPSATALVSWLEKCGFVNVRHVDMSVTSTDEQRRTAWMTS--ESLADFLHSDDPRLTVE
CMOB_PHOLL      FIPSAKMVKIWLEKCGFVDVKIVDQAVTATEEQRRTDWMKT--ESLSDFLDPTDSNKTIE
CMOB_VIBCB      FFPSAKALKVWLELVGFKDVRIVDENVTTVGEQRTTDWMTH--NSLPDYLDPNDPSKTVE
CMOB_VIBPA      FFPSAKALKVWLELVGFEDVHIVDENVTSVDEQRTTDWMTH--NSLPDYLDPNDPSKTVE
CMOB_VIBVU      FFPSARALKVWLELVGFEDVRIVDENVTSVDEQRTTNWMTH--NSLPDYLDQNDPSKTVE
CMOB_VIBVY      FFPSARALKVWLELVGFEDVRIVDENVTSVDEQRTTNWMTH--NSLPDYLDQNDPSKTVE
CMOB_ALIF1      FFPSARALKVWLESVGFVDVKIVDECVTTTGEQRSTEWMKH--NSLPEYLDPNDSTKTIE
CMOB_VIBCH      FFPSALALKVWLEKTGFVDVRIVDENITSLGEQRTTEWMTH--NSLPDYVDPQDPSKTIE
CMOB_PHOPR      FFPSAKALKVWMEKCGFVDVRIVDESVTTTDEQRSTDWMTN--NSLPEYLSPDDPTKTIE
CMOB_PSEA6      FLPSTDALCLWMKRLGFKNVRVVDLAKTTIEEQRATQWMDS--QSLVDFLDPNDHSKTIE
CMOB_PSET1      FIPSTAALKLWMERVGFKNVQIKDCAITTLDEQRKTAWMEN--ESLVDFLDPNDTSKTIE
CMOB_COLP3      FLPSEKAMCAWLERCGFNNVRVVNTDITALDEQRKTEWIDT--ESLQDFLDPNDSSKTIE
CMOB_IDILO      FLPSASALSVWLERLGFKDISVVDHNTTSIDEQRRTDWMTG--ESLADFLDPNDTNKTIE
CMOB_PSYA2      FLPSVAALIGWLEKAGFTEVRCVDVAVTSTDEQRKTEWMNY--HSLADFLDPNDPTKTIE
CMOB_PSYCK      FLPSVAALIGWLEKAGFTEVRCVDVAVTSTEEQRKTEWMTY--HSLADFLDPNDSSKTLE
CMOB_CHRSD      FLPSSKALAHWLERCGFEDVRVVDEAPTSLAEQRSTEWMTF--HSLADFLDPEDATLTLE
CMOB_HYDCU      FIPSVQELGHWLEKCGFKNVRCVDLDQTSVKEQRTTEWMNW--NSLADFLDPNDSNKTIE
CMOB_DICNV      FLPSIAALCRWLERLNFRIELCSEAVETTINEQRRTRWVNS--FSLADFLQRAPSA----
CMOB_RUTMC      CLPSKNTLRTWLEDAEFKNIKLLDVTKTTSKEQRATHWIGNNTQSLKNFLDPNNRDLTIE
CMOB_PELCD      FLPTVPCLEAWLNKAGFEDIRCVDRSWTTIEEQHPTPWINT--ESLPDFLDPSDPTRTIE
CMOB_DESPS      FVPSASCLINWMHKAGFIDVDLFCDHPMSPEEQRQTEWMEF--ESYKDFLDPENPELTLE
CMOB_TRIEI      FLPTQSCLENWIGRAGFSDINCFFAAPLSVEEQRRTIWANI--DSLPEFLDPHNPSLTVE
CMOB_ARCB4      FIPTIPALKNWLERAGFENIEVLATTITTSQEQRKTPWSFD--ESLEDFLDPNDSSKTVE
CMOB_SULNB      FVPTVNALKNWCLRAGFESVEVLEIMKTDLNEQRKTEWIDT--QSLEDFLDPDDPEKTVE
CMOB_NITSB      FVPTIKALQNWCQKAGFEYFEILATKPTTFEEQRKTEWILG--ESLENFLDPADPKRTVE
CMOB_SULDN      FVPTISALKNWCLRAGFSSFEVLETSLTSSDEQRKTSWIEG--ESLEDFLDKNDNTKTVE
CMOB_CAMJE      FVPSISALKNWCERAGFKEFEVLATKKTDENEQRKTEWIDS--FSLENFLDPKDKNLTIE
CMOB_CAMJR      FVPSISALKNWCERAGFKEFEVLATKKTDENEQRKTEWIDS--FSLENFLDPKDKNLTIE
CMOB_CAMJJ      FVPSISALKNWCERAGFKEFEVLATKKTDENEQRKTEWIDS--FSLENFLDPKDKNLTIE
CMOB_CAMFF      FIPSIKALRNWCERAKFKTFDILSIKNTDFNEQRKTQWIYG--ESLENFLDPNDPKLTIE
CMOB_CAMHC      FLPTIRTLQNWCERAKFKDFEILAVKATDENEQRKTDWIYG--QSLGDFLDPFDKTRTIE
CMOB_WOLSU      FIPTFKALSHWLHRAGFERVEKLEIAKTGLDEQRKTEWINS--QSLEDFLDPCSHDRTIE
CMOB_HELHP      FIPSIPTLKGWCERANLYDFEVINLTPTTTQEQRQSAWVDS--QSLSAFLN-ETQTRTIE
CMOB_HELPY      FIPSVSALKGWCERVGFENFEILSVLKTTPKEQRKTDFILG--QSLEDFLDKTDPSKTLE
CMOB_HELPJ      FIPSVSALKGWCERVGFENFEILSVLKTTPKEQRKTDFILG--QSLEDFLDKTDHSKTLE
CMOB_HELPH      FIPSVSALKGWCERVGFENFEILSVLKTTPKEQRKTDFILG--QSLEDFLDETDHSKTLE
CMOB_HELAH      FIPSISALKGWCERVGFGDFEIISVLKTTPKEQRKTDFILG--QSLEDFLDKKDHSKTLE
                 . :      *     :              **  : :      *   ::          

CMOB_PSEAE      GLPAPMRATLVARKP-----------
CMOB_PSEAB      GLPAPMRATLVARKP-----------
CMOB_PSEE4      GLPAPRRATLLARK------------
CMOB_PSEPK      GLPAPRRATLLARK------------
CMOB_PSEF5      GLPAPMRAVIVAKK------------
CMOB_PSEPF      GLPAPMRAVIVAKK------------
CMOB_PSE14      GLPAPMRAVIVGRKP-----------
CMOB_PSEU2      GLPAPMRAVIVGRKP-----------
CMOB_PSESM      GLPAPMRAVIVGRKP-----------
CMOB_PSEU5      GLPAPMRAVLLARKP-----------
CMOB_ALCBS      GYPAPRRAVLVARKP-----------
CMOB_HAHCH      GYPAPARAVLVARKP-----------
CMOB_MARHV      GYPGPKRATLIAEKP-----------
CMOB_GEOMG      GHPAPLRAIFTATKP-----------
CMOB_METCA      GHPAPRRAIFLAEAP-----------
CMOB_SACD2      GHPAPLRAVILAEAPE----------
CMOB_AERHH      GHPAPKRAVLIARKAKD---------
CMOB_AERS4      GHPAPKRAVLIARKAKD---------
CMOB_PSYIN      GYPAPKRALLIAKKAIKALS------
CMOB_SHEB5      GYPAPKRATIIAVKNQPNQDLIS---
CMOB_SHEB8      GYPAPKRATIIAVKNQPNQDLIS---
CMOB_SHEPC      GYPAPKRATIIAIKNQPNQETVNG--
CMOB_SHESW      GYPAPKRATIIAIKNQPNQETVNG--
CMOB_SHESA      GYPAPKRATIIAVKNQPNQDLT----
CMOB_SHESM      GYPAPKRATIIAVKNQPNQDLT----
CMOB_SHESR      GYPAPKRATIIAVKNQPNQDLT----
CMOB_SHEON      GYPAPKRATIIAVKNQPNQDLS----
CMOB_SHEDO      GYPAPKRATIIATKNQPNFDLI----
CMOB_SHEFN      GYPAPKRAIIIATKNQPNHDLV----
CMOB_SHELP      GYPAPKRATFIAVKNQPNKDLV----
CMOB_SHEAM      GYPAPKRATFIAVKNRSPQDAD----
CMOB_HAEI8      GYQAPKRAVILANK------------
CMOB_HAEIE      GYQAPKRAVILANK------------
CMOB_HAEIG      GYHAPKRAVILANK------------
CMOB_HAEIN      GYQAPKRAVILANK------------
CMOB_PASMU      GYQAPTRAVILANK------------
CMOB_HAES1      GYPAPKRAVILANK------------
CMOB_MANSM      GYPAPKRAVILANK------------
CMOB_ACTP2      GYPAPKRAVILANA------------
CMOB_HAEDU      GLPAPKRAVILANA------------
CMOB_SALTY      GYPAPQRAVLIARKP-----------
CMOB_SALCH      GYPAPQRAVLIARKP-----------
CMOB_SALPA      GYPAPQRAVLIARKR-----------
CMOB_SALTI      GYPAPQRAVLIARKP-----------
CMOB_ECOUT      GYPAPKRAVLIARKP-----------
CMOB_ECOK1      GYPAPKRAVLIARKP-----------
CMOB_ECOLI      GYPAPKRAVLIARKP-----------
CMOB_ECOL6      GYPAPKRAVLIARKP-----------
CMOB_ECOL5      GYPAPKRAVLIARKP-----------
CMOB_SHIDS      GYPAPKRAVLITRKP-----------
CMOB_ECO57      GYPAPKRAVLIARKP-----------
CMOB_SHIBS      GYPAPKRAVLIARKP-----------
CMOB_SHISS      GYPAPKRAVLIARKP-----------
CMOB_SHIFL      GYPAPKRAVLIARKP-----------
CMOB_SHIF8      GYPAPKRAVLIARKP-----------
CMOB_CITK8      GYPAPLRAVLIARKP-----------
CMOB_KLEP7      GYPAPLRAVIIATKPETQQSLAKKAR
CMOB_CROS8      GYPAPLRAVLVARKP-----------
CMOB_YERPE      GYPAPLRAVLIARKP-----------
CMOB_YERPA      GYPAPLRAVLIARKP-----------
CMOB_YERPN      GYPAPLRAVLIARKP-----------
CMOB_YERPP      GYPAPLRAVLIARKP-----------
CMOB_YERPS      GYPAPLRAVLIARKP-----------
CMOB_YERE8      GYPAPLRAVLIARKP-----------
CMOB_PECAS      GYPAPVRAVLVARKPGAEL-------
CMOB_SODGM      GHPAPLRAVIVAEKH-----------
CMOB_PHOLL      GYPAPLRAILIARKP-----------
CMOB_VIBCB      GYPAPRRAVLVATKP-----------
CMOB_VIBPA      GYPAPRRAVLVARKP-----------
CMOB_VIBVU      GYPAPRRAILVAKKP-----------
CMOB_VIBVY      GYPAPRRAILVAKKP-----------
CMOB_ALIF1      GHPAPKRAILIAKKPD----------
CMOB_VIBCH      GYPAPRRAILIAKKP-----------
CMOB_PHOPR      GYPAPKRAILVARNPD----------
CMOB_PSEA6      GYPAPLRAVVVAER------------
CMOB_PSET1      GYPAPLRAILTAKA------------
CMOB_COLP3      GYPAPKRAIFIANA------------
CMOB_IDILO      GYQAPIRAVITARV------------
CMOB_PSYA2      GYPAPMRATLIAKK------------
CMOB_PSYCK      GYPAPLRATLIAKK------------
CMOB_CHRSD      GYPAPRRAVLVARKPE----------
CMOB_HYDCU      GYSAPLRAVMIADKPC----------
CMOB_DICNV      --PPPKRAFVIAKRL-----------
CMOB_RUTMC      GFPAPKRAIFICQK------------
CMOB_PELCD      GYQAPLRAAVIARRR-----------
CMOB_DESPS      GYPAPHRFFVKATKKM----------
CMOB_TRIEI      GYPAPWRYYAIARK------------
CMOB_ARCB4      GYPAPKRVYVKARKIM----------
CMOB_SULNB      GYPAPKRVYIKAIKKA----------
CMOB_NITSB      GYPAPQRVYVRLRRKR----------
CMOB_SULDN      GYPAPSRVYVRLKKGIK---------
CMOB_CAMJE      GYEAPKRVYIRIKI------------
CMOB_CAMJR      GYEAPKRVYIRIKI------------
CMOB_CAMJJ      GYEAPKRVYIRIKI------------
CMOB_CAMFF      GYPAPKRVYVRLS-------------
CMOB_CAMHC      GYPAPKRVYVRVKI------------
CMOB_WOLSU      GYPAPRRIYVKAYKGA----------
CMOB_HELHP      GYQAPLRGYFKLKKR-----------
CMOB_HELPY      GYDAPLRGYFKMLKPS-KR-------
CMOB_HELPJ      GYDAPLRGYFKMLKPS-KR-------
CMOB_HELPH      GYDAPLRGYFKMLKPS-KR-------
CMOB_HELAH      GYDAPLRGYFKMLKSSSKR-------
                    * *