CLUSTAL format seed alignment for MF_01595

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

PNP_FERNB       --------------------MKEWRKNLFGRE---WLFQHGKVAKQSAGSIWARFGD-SV
PNP_THEM4       -----------------MLKFREWSKEFFGRK---LTIQYGKVAKQSSGAAWVQFGD-SV
PNP_THEP1       --------------------MKEWRRNILGRE---LVVQYGKVAKQSSGSALVRFGD-TV
PNP_PSELT       --------------------MKTWKREILGRE---FIVEHGKVAKQANGAVVARIGD-TT
PNP_PETMO       --------------------MKVLEKELFGRK---LRIEHGKVAKQSLGSVMLTFNE-ST
PNP_AQUAE       --------------------MSVEEKARIGNSEEPIIIETGKYAKLTDGSVVVRQGG-TA
PNP_TREDE       --------------------MRKRVTYKIGEHD--LILETGYLAKQANGSIYAEYAG-SA
PNP_TREPA       --------------------MKHSITGTIGDHP--LLLESGYLARQANGSVYLQCEG-TA
PNP_BORBU       --------------------------MKIGRDE--LVFETGFMAKQANGSVLATYGG-SS
PNP_DESVV       -----------------MTNIFNAMRVTATVGGKEIVFETGRLANQADGAVWIQCGG-TV
PNP_DESAG       -----------------MENLFGAKRLTATVGGKEIIMETGRLANQADGAVWIQCGG-TV
PNP_LAWIP       -----------------MSFRKPPIRLATQVGGKEIIFETGYMATQANGSLTVQCGG-TI
PNP_SYNFM       ----------------------MKHSVQVEVGGRPMVFEAGEIARQAGGSVLMRYGD-TV
PNP_ANADF       ---------------------MTPIQKTARVGAQEILLETGKVAKQAHGSVWVRMGD-SI
PNP_MYXXD       -----------------------MLKKSVKIGESELSIEVGRLAKQADGSVVVRYGD-TM
PNP_SORC5       ----------------------MFVRESVMVGGRALTLETGRLAKQAHGAVLVTYGD-TM
PNP_GEOUR       ----------------------METKVQVEFGGRTITIETGKMAKQASGAVVVSSGD-TM
PNP_PELPD       ----------------------MEHVVDVEFGGKMVTISTGKMAKQANGAVVVKSGD-TM
PNP_PELCD       ---------------------MAYQKVECQFNGQTLTLETGKMARQADGAVVVSFGG-TK
PNP_SYNAS       ----------------------MSTIFSAEFAGRNISIKTGYVAGQADGAVMVIYGD-TV
PNP_DESPS       ----------------------MFNKVEADIDGKLISIETGKLAKQASGSIVISCGG-TV
PNP_BDEBA       ----------------------MKTTVTTSVGGKQITIETGRLAKQADGAALVSSGN-NM
PNP_BACV8       -------------------MINPIVKTIELPDGRTITLETGKLAKQADGSVMLRMGN-TM
PNP_PORGI       -------------------MLNVVSKTIDLGDGRSIKIETGKLAKQADGAVTVTMGN-TV
PNP_CYTH3       ---------------MSYPGLTIINKTITLPDGREIQIETGKLAKQADGSAVVKLGN-AM
PNP_FLAPJ       ------------------MIPQLFVESIDLGDGRNITIETGRLAKQADGSVVVRIGK-TV
PNP_GRAFK       ------------------MIPKTFKEVIDLGDGREISIETGKLAKQAHGSVVVQSGK-CM
PNP_SULMW       ------------------MIPELIKENLFLEDGRALSIETGELARKANGSAVVRMGN-TS
PNP_CHLPD       ---------------------MIINKAIDLGKGKILSIETGKMAKQADGAALVRLGD-TM
PNP_CHLTE       ---------------------MFIKKKIDLGHGKVITIETGKMAKQADGSAVVTMND-TM
PNP_PELLD       ---------------------MIITKEINLGQGKTISIETGRMAKQADGATVVRMGD-TM
PNP_CHLCH       ---------------------MFVQKSIDLGHGRILSIETGKMAKQADGAAIVRLGD-TM
PNP_SALRD       ------------------MKPEAHIEDIEFVPDRSLSLETGRIAKQADGSVVARLGD-TM
PNP_KORVE       ------------------MKPEPKVATVEFTGGKSLSFETGKLAKQAHGSAIVRSGQ-SV
PNP_SOLUE       ---------------------MHHIVEVDLGDRK-ITLETGKMAKQANGAVVVRSGD-AV
PNP_RHOBA       -------------------MSVQKVRVERKIGDSVLSFETGHIAKQAAGSVLVQYGE-TV
PNP_ECOLI       --------------------MLNPIVRKFQYGQHTVTLETGMMARQATAAVMVSMDD-TA
PNP_PHOPR       ---------------------MNPIVKTFQYGNHTVTLETGVMARQATAAVMASMDD-TS
PNP_HAEDU       ---------------------MTPIVKQFKYGQHTVTLETGAIARQATAAVMASMDD-TT
PNP_COLP3       --------------------MLNPITKKFQLGKHTVTLETGAIARQASAAVMASMDD-TC
PNP_PSYIN       ---------------------MTPIVKSFQYGEHTVTLETGVMARQATAAVMCSMDD-TC
PNP_PSEA6       ---------------------MTPITKSFQYGQHTVTLETGVIARQATAAVMASMDD-TS
PNP_AERS4       ---------------------MNPIVKSFQYGQHTVTLETGVMARQATAAVMVSMDD-TC
PNP_SHELP       ---------------------MNPIVKSFEYGQHTVTLETGVIARQADAAVLASMGD-TT
PNP_IDILO       ---------------------MNPITKQFQYGQHTVTLETGVIARQATASVLASIDD-TT
PNP_PSEHT       ---------------------MQAIIKEFQLGQHTVTLETGAIARQADGAVLASIGD-TS
PNP_BUCAP       --------------------MLNPIVRKFQYGQHTITLETGIMARQATAAVMASMDD-TA
PNP_BUCBP       --------------------MLNPIVRKFQYGQHIVTLETGIMARQATAAVLTSMDD-TT
PNP_BUCCC       --------------------MLKPIIHKFKYGKHNIILETGVIARQATASVLASMDD-TT
PNP_WIGBR       --------------------MLKATIQKFQYGKNIVTIETGMIARQATSAVMVRMDD-TS
PNP_BLOFL       --------------------MLNSIVHKFQYGQHTVVLNTGAIARQANAAVMVSIGD-TT
PNP_BLOPB       --------------------MLDPIIHKFKYGQHTVILDIGTIARQANAAVMVSMSD-TT
PNP_BAUCH       --------------------MLNPIVHRFQYGKHIVILETGIVARQATAAVMVNMAD-TI
PNP_NEIG1       -------------------MMFNKYVKTFQYGNQTVTLETGEIARQAAAAVKVSMGD-TV
PNP_CHRVO       ------------MNQDRETLVFNKITKTFQFGRQTVTLETGEIARQASGSVVVSVDD-TV
PNP_METFK       ---------------------MTAIKKTITYGQHELTLETGEIARQADGAVMVSYGD-TV
PNP_THIDA       ---------------------MSAIKKTFTYGRHQVTLETGEIARQASGAVVVNMDD-TM
PNP_NITEC       ---------------------MKPIKKSITYGHHTLTIETGEIAKQAHGAVMVSMDD-TV
PNP_NITMU       ----------------------MKIKKSVTYGSHQLTFETGEIARQAHAAIMVSMGD-TV
PNP_VEREI       ------------------MGIFNKVTKTFQWGDQTVVMETGEIARQASGAVLVSIDD-TV
PNP_METPP       ------------------MSLFNKITKTFQWGQHTVTLETGEIARQSGGAVIVDMDG-TV
PNP_BORA1       --------------------MFNKVTKTFQYGQHTVVLETGEIARQASGAVLVSVED-TV
PNP_JANMA       --------------------MFNKVTKTFQYGQHQVTLETGEIARQASGAVLVSIED-TV
PNP_RALSO       --------------------MFNKIVKEFQWGNHKVRMETGEIARQASGAVLLDMDD-TV
PNP_POLAQ       ------------------MTMFKKAVKSFQWGNHQVTMETGEIARQSGGAVIVNVDD-TV
PNP_PARXL       ------------------MTMFNKIVKEFQWGQHKVRLETGEIARQASGAVIVDVED-TV
PNP_DECAR       --------------------MFNVVKKTFAYGDHQVTIETGEVARQAGGAVLVSMEE-TV
PNP_AROAE       --------------------MPTAIKKTFAYGAHTVTLETGEIARQAGGAVIVNMDD-TI
PNP_ALKEH       ---------------------MKSVKKSFQYGNHTVTLETGGVARQADGAVLVNMSD-TV
PNP_HALHL       --------------MSESQLSLTPVKRSFQFGQHQVTLETGGVARQADGAVLVDMAD-TV
PNP_METCA       ---------------------MNPIRKQFQYGAHTVSFETGEIARQADAAVMVDMAG-TV
PNP_NITOC       ---------------------MTPIKKVIEYGDRSLVLETGCIARQASGAVVVRYGE-TV
PNP_XYLFT       ---------------------MAKITKTFQYGKHTVTLETGEVARQASGAVIVKMDD-TV
PNP_COXBR       ---------------------MNKIRKTFQYGKHEVTFETGEMARQATGAVVVRMGD-TV
PNP_DICNV       ----------------------MKHSVSFTYGQHQVTLETGEIARQADGAVIVNMDD-TI
PNP_PSEU5       ---------------------MNPVIKKFQFGQSTVTLETGRIARQASGAVLVTVDDDVS
PNP_SACD2       ---------MQWGTPSQKDKKVNPVIKKFQYGNDTVTLETGRIARQASGAVLASMGQ-TS
PNP_HAHCH       ---------------------MNPVRKTFQYGNSTVTLETGRIARQATGAVLVTMDD-TV
PNP_MARHV       ---MGHWPESKPLKMQEFIVELQPRIKTFEMGGETFTLETGRIARQATGAVLVSTGD-TA
PNP_CHRSD       ---------------------MNPVKKTFQYGHSTVTLETGRIARQATGAVMVTMDD-TV
PNP_ALCBS       --------------------MFNKITKQIQFGRDTVTLETGQIARQATAAVMVRIGD-TQ
PNP_ACIAD       ------------------MSMFNIIRKEFQFGQHQVVLETGRVARQAN-TVLVTMGG-VT
PNP_PSYWF       ------------------MSMFNTISREFQYGNEQVVIETGRIARQAN-SVLVHMGG-VS
PNP_HYDCU       ---------------------MSKFIKSFQYGKHEVRFETGEIARQADGAVMVAMGD-TQ
PNP_LEGPA       ---------------------MAKITKEIVFGNHKLILETGEVARQADGAVMASMNG-TQ
PNP_VESOH       ---------------------MNIKTKSFTMGKHIVTLETGRIARQAHGAVLASMDD-TQ
PNP_FRATW       ---------------------MKIFREVFELGNKEIILETGGMARQADGSVTVSCGN-NV
PNP_GRABC       --------------------MFNYFRKELDLGGRTLVLETGKIARQADGAVLARLGD-TI
PNP_ACICJ       ------------------MMFDKYFRKELDWGGRKLILETGKVARQADGAVVASYGD-TV
PNP_GLUOX       --------------------MFDYFRKEIEWAGRPLILETGKVARQADGAVMITYGD-TV
PNP_MAGSA       ------------------MSMFNVHRKEITWGGRKLVLETGKVARQADGAVMVTYGE-TS
PNP_RHORT       ------------------MSLFNVFRKEIEWGGRKLVLETGRIARQADGAVMASLGD-TT
PNP_CHESB       --------------------MFNHHKVEIEWGGRPLILETGKIARQADGAVLATYGE-TV
PNP_BARBK       --------------------MFKTHKVEIEWAGRPLTIETGRVARQADGAVVATYGE-TV
PNP_NITHX       --------------------MFNKHSVEIDWGGRPLKLETGKIARQADGAVVATYGE-TV
PNP_AZOC5       --------------------MFDIHREELDWGGRTLVLETGKMARQADGAVFASYGD-TT
PNP_PARL1       --------------------MFKITREEIEWGGRTLVLETGKIARQADGAVLATYGD-TT
PNP_MARMM       --------------------MFDIQKETIEWAGRPLTIETGRVARQADGAVMVSYGE-TT
PNP_CAUVC       --------------------MFDIKRKTIEWGGKTLVLETGRIARQADGAVLATMGE-TV
PNP_HYPNA       --------------------MFNKQSVSLEWAGRTLTIETGQVARQADGAVMVQYGD-TI
PNP_PARDP       --------------------MFDEVKKSIQWGQETLTLETGKVARQADGSVIATLGE-TS
PNP_SPHAL       --------------------MFDVKKVSIEWGGETLTLETGKVARQADGAVIATLGE-TV
PNP_NOVAD       --------------------MFDVKTVSLEWGGKTLTLETGRIARQADGAVLATYGE-TV
PNP_ERYLH       --------------------MFDKKTVSIEWGGKTLTLETGQIARQADGAVLATYGE-TV
PNP_ZYMMO       --------------------MFDIKRQEIDWGGKKLTLETGQVARQADGAVIATLGE-TV
PNP_PELUB       --------------------MFKVYKKEIEVAGKKISLETGKVARQADGAIIASCGE-TV
PNP_MAGMM       --------------------MFNIHTKSVQFGEKTITLETGRVARQANGAVMVTYGD-TV
PNP_RICTY       --------------------MFNEITKSVIWNRQVLEISTGKIARQADAAVTVKMGN-SI
PNP_ORITB       --------------------MFNEILKKVDWHGNVLSLSTGKIARNADGAVLASMGN-TS
PNP_ANAMM       --------------------MFDITRKCVEWGDRLLVIESGKIARQADGAVVVDYGG-TS
PNP_ANAPZ       --------------------MFDITRKCVEWGDRSLTIESGKIARQAGGAVVVDYGG-TS
PNP_EHRRW       --------------------MFNLIRKSTEWGGKTLVLESGKIARQANGAVVVTYGG-TT
PNP_WOLTR       --------------------MFEIIKKSIEWGGRTLSLETGKIARQADGSVVVNYGD-TS
PNP_NEOSM       --------------------MFEIKESSMEWEGKSLHIKTGEVARQAAGAACVSYGG-TV
PNP_CHLCV       --------------------MTFETIFVTLEEGKTLVFETGKIARQANGAVLARMQE-TW
PNP_CHLPN       --------------------MNFQTISINLTEGKILVFETGKIARQANGAVLVRSGE-TC
PNP_CHLMU       --------------------MAFETFSVALDKDKTLIFETGKIARQANGAVLVKMNE-TW
PNP_PARUW       --------------------MQRETISVPVG-AQEIIFETGKIARQAGGAVVVRCGE-TV
PNP_BACCN       -------------------MSQEKQVFSIDLAGRQLTIETGQLAKQANGAVLVRYGD-TA
PNP_GEOTN       -------------------MEQEKRVFSIDVAGRPLVIETGELAKQANGAALVRYGD-TV
PNP_OCEIH       -------------------MAEEKQLFSTEISGKKFTVEVGELAKQANGACMIHYGD-TS
PNP_BACHD       -------------------MEQERHEFSIDWAGRKLTVETGQLAKQANGAVLVRYGD-TA
PNP_BACSK       -------------------MDQERHEFSIDWAGRTLSVEVGQLAKQANGAVLVRYGD-TA
PNP_LISIN       -------------------MS-EKQVFSTEWAGKTLSVEVGQLAKQASGAALIRYGD-TV
PNP_ENTFA       -------------------MT-EKQVFKTTWGGRPLEVEIGQLAKQANGAVLVRYGD-TV
PNP_STAS1       -------------------MSQEKKVFKTEWANRSLTIETGQLAKQANGAVLVRYGD-TV
PNP_STRMU       ---------------------MSKQVFETIFAGKKLAVEIGQVAKQANGAALVRYGD-ST
PNP_STRTD       ---------------------MAKQTFEMTFEGRPLVVEVGQVAKQANGAVVVRYGD-TT
PNP_LACLA       ---------------------MAKETFSIEFAGRTLTVETGQVAKQANGAVVVRYGD-TT
PNP_SPICI       ---------------------MAKQVFKKIINNQELIVEHGQLAKQASGSVLVRYGD-TV
PNP_ONYPE       ---------------------MLKKVFETTNLKDSFQVEIGTYARNVDASILVRYQD-TV
PNP_ACHLI       ---------------------MSKQVFETTLAGKPLRVEVGEIAKQANGAAMIYYGD-TV
PNP_FUSNN       ----------------MKELMFDEKIMELELAGRTLKVSTGKISRQSSGAIVIQYGD-TV
PNP_TRIV2       ---------------------MAEFEKSISFDGRDIRLKVGLLAPQAGGSVLIESGD-TA
PNP_TRIEI       ---------------------MEEIDKSISFDGRDIRLKVGLFAPQAGGAVMIESGD-TA
PNP_ACAM1       ---------------------MSEVIKSISVDGREIKLTIGRFAPQAGGCVLIESGE-TS
PNP_SYNE7       ---------------------MPQLSKSLSFDGRDIRLELGLFAPQAGGSVLISSGD-TA
PNP_SYNY3       ---------------------MQEFDKSISFDGRDIRLKMGTLAPQAGGSVLIQSGD-TA
PNP_THEEB       ---------------------MKGLEKIIPLDGRDIKVVLQKFAPQAAGSILISSGE-TA
PNP_PROMA       ---------------------MQGQTTSVSFDGREIRLTTGRYAPQAGGSVLIECGD-TA
PNP_PROMP       ---------------------MEGKNTSITFDGREIRLTTGLYAPQAGGAVMIECGD-TS
PNP_SYNR3       ---------------------MQGETRSISFDGREIRLTTRRYAPQAGGSVLIECGD-TA
PNP_SYNJA       ---------------------MAEYTRSISFYGREIDINIGLMAPQAGCGVWLTSGE-TS
PNP_GLOVI       ---------------------MIEYRKSVTVHGREIGLSTGVLAQLAGGSVLVQSGE-TA
PNP_DEHM1       --------------------MITANSFERTIGGRKLTIESGKMARLADAAVTIRYAD-TE
PNP4_ALKMQ      ----------------------MIKQFQTELAGKTLHVEIGKYAEQASGSCMVRYGD-TT
PNP_ALKOO       ----------------------MFKVFKKEIAGRVLEVEVGKLAQLSNGSCLLKYGQ-TA
PNP3_ALKMQ      ----------------------MVKTFEMKLGGRPFVVEIGKVAELAQGSCMIKYGD-TT
PNP_CLOD6       --------------------MFEHKIFKMDFAGRELSVEIGKICEMASGSCIVRYSD-SM
PNP_CALS8       ---------------------MESKIYKMELAGRELSFEIGKYALLANGAVLARYGD-TA
PNP_CALS4       ---------------------MEERTFEMELAGRKLVVQTGKVAQQANGAAWVKYGD-TV
PNP_CLOPS       ----------------------MNHTHETIIAGRPMKVEFGKLGMLSDAAILMSYGD-TV
PNP_CLOB8       ----------------------MNNVLTTEIAGRELKVEFGKVGMLSNAATFTSYGD-TV
PNP_CLOBL       ----------------------MIHTLETTVAGRKMKVDFGKTGMLSNAAIFMSYGD-TV
PNP_CLOTE       ----------------------MSHVLETDIAGRTLKVEYGKVGMLSNCAILVSYGD-TV
PNP_CLONN       ----------------------MNHIFETTVAGRTLKGEFGKLGMLSDCALNISYGD-TV
PNP_CLOAB       ----------------------MLHFLETDIAGRKLKVECGKTGMLSNCAMFISYGD-TV
PNP_LACP7       ----------------------MYKSFSMELAGRTLSVDVGRVAAQANGAAFMHYGD-TV
PNP_HUNT2       ----------------------MYKTFSMELAGRTLTIETGKLAQLANGSVLVRYGD-TV
PNP_CARHZ       -----------------MTTGRQILEKEIMIAGRPLKLTAGKVATQASGSVLVSYGD-TV
PNP_MOOTA       --------------------MQGVLRKTLVVAGRDLTLETGRLAKQAGGAVMVSYGG-TM
PNP_DESRM       ------------------MSENQVLIREISLGGRTLTLETGRMAKQASGAVLVTYGE-TV
PNP_PELTS       ------------------MADRSILTREIIVGGRPMILETGRLANQASGAVFVRYGD-TA
PNP_DESHY       -------------------MTQEVLERSIQVGGRTMTFQTGKIGKQAGGAIFCRYGD-TV
PNP_SYNWW       ---------------------MIVKKYQMEVAGRPLIVEIGQVAQQANGAALMRYGD-TV
PNP_SYMTH       ------MPPGAPDGPGHRRRTNVTASFSMELGGRTMTLETGRLAKQASGSVLVNYGD-SV
PNP_CHLAA       ------------------MTERNIYSVSAEIAGRTLTLEAGRFAEQADGAVVARYGD-TM
PNP_ROSS1       ------------------MSERQIHSVSMELAGRTLTLEAGRFAEQANGAVVVRYGD-TM
PNP_DEIRA       ---------------------MIGKTFTTMLGGRELSIETGKLAKLVSGSVTVRYGDTLL
PNP_THET8       --------------MEGTPNVPQAHRYELTLAGRPLVLETGKYAKQASGSVLVRYADTVV
PNP_RENSM       -------------MEGPEIQFSEAVIDNGRFGKRTIRFETGRLAQQAAGAAMVYIDDDTA
PNP_KINRD       -------------MEGPEITAAEAVIDNGSFGTRTIRFETGRLAKQAAGSAAVYLDGESF
PNP_STRAT       -------------MEN-ETHYAEAVIDNGAFGTRTIRFETGRLAKQAAGSAVAYLDDDTM
PNP_NOCSJ       -------------MTDPEISAVETVLDNGKFGTRTVKFETGLLARQAAGAVTAYLDEDTM
PNP_ACIC1       -------------MADHDVHTAEAVIDNGSFGVRTVRFETGRLARQAGGSAVAYL-GDTM
PNP_CUTAK       -------------MEGPGLEFTEAIIDNGKLGKHVVRFEAGLLAQQADGSAAVYLDGDTM
PNP_FRACC       --------------MDDSTHAAEAVIAT-PAGDRTVRFETGRLAKQAAGSAVAYLGD-TM
PNP_THEFY       ---------------MEGVYSAEAVIDNGRFGTRTIRFETGRLARQATGSATAYLDDETM
PNP_RHOJR       ------MTENSAVEVDEGVFESTAVIDNGSFGTRTIRFETGRLAQQAAGAVVAYLDDETM
PNP_SACEN       --------MTDVQSLDEGVYEATAVLDNGAFGTRTVRFETGRLAKQAAGSVVAYLDDDTM
PNP_SALTO       -----------MTESNLGTESRTATIDNGAFGTRVITFSTGRLARQAAGSVVAQLG-ETV
PNP_COREF       -----MSEVKYFEDTDYGVIEAIATIDNGDFGTRTIRFETGQLARQADGAVTTYLDDETM
PNP_CORDI       -MSTKPSNVVFNIDEEFGITEAIATIDNGDFGKRTIRFETGQLARQADGSVTTYLDDDTM
PNP_CORJK       MSTKKQNIQAELVDPDAGVWEVEATIDNGDFGTRSIRFETGLLARQADGAVTAYLDEDTM
PNP_LEIXX       -------------MEGPEITFAEAMLDNGRFGARTVRFETGRIAQQAQGAVAAYLDEETM
PNP_TROWT       ---------------MDDVQFSEGVIDNGRFGTRTIRFETGRLARQAQGSVVAYLDGETM
PNP_BIFLO       -------------MEGPEIKAVEAVIDNGSFGKRTLRFETGRLAQQADGAVAAYLDDDSM
PNP_RUBXD       ------------------------MRLEIPVGERAIVLETGKLARQAGGAVTARFGDTTV
PNP_LEPIC       ----------------------MTHTISGQYGRDTIVLETGSWAKQAHGAVVYKSGN-LV
PNP_NITSB       ----------------------MKCRFEFEMNNLKEIYEFGEVAKQTNGSVLLKSGK-TV
PNP_WOLSU       ---------------------MNATIKEIALPNKTETFEFGAIAKQANGSVLYRCGK-SV
PNP_SULDN       ----------------------MKYDIKIDLKNKNEEYSFGEVAKQANGAAWLKSGN-TV
PNP_ARCB4       ----------------------MSKVCEFELNGKQEIFEFEKVAKQSNGAVLAKIGN-AV
PNP_CAMC5       ------------------------MQYSIEVNNQVEIFDLNKVAKQAAGAVMLRVKN-TV
PNP_CAMFF       ------------------------MQCSIEVNNQIEIFDLNKVAKQAAGAVLMRVKN-TV
PNP_CAMHC       ------------------------MKYAVEVNNNVEIFEINKVAKQAAGACLMKVKN-TV
PNP_CAMJD       ------------------------MQYSIEINKNTEIFDIDKVAKQATG-VLMRQGK-SV
PNP_HELHP       -----------------------MQHIKLEFENLSEQYSFNYVAQAANGGILYQNGG-SV
PNP_HELPH       -----------------------MDFITINSSNKTEEFALKQVVKQATSSLLYRLGK-TI
PNP_HELAH       -----------------------MDFITINSINKTEEFALKQVAKQATSSLLYRLGK-TI
PNP_HELPJ       -----------------------MDFITINSGNRTEEFALKQVAKQATSSLMYRLGK-TL
PNP_SULNB       ---------------------MNEQIIEINLNNLDEKYEFNKIAKQASGAVMYRQGK-AV
                                                                            

PNP_FERNB       VLATVNVSDNVVEGI-----DFVPLTVEFMEKFYAAGKIPGGFVKRE-GKPSESGILSSR
PNP_THEM4       VLATANISDRVIEGV-----DFVPLTVEYQEKFYAAGKIPGGFIKRE-GKPTESAILSAR
PNP_THEP1       VLATANISDKAVEGI-----DFVPLTVEFQERFYAAGKIPGGFIKRE-GKPSESAILSAR
PNP_PSELT       VLATAVMSDSAVEGI-----DFVPLTVEFQERFYAAGKIPGGFIKRE-GKPSEMAILSAR
PNP_PETMO       ILVTADASEETVKGQ-----DFFPLTVEFQEKFYAVGKIPGGFIKRE-GKPSDEAILAAR
PNP_AQUAE       VLVTAVMSDEPITDV-----DFTPLAVDYRERASAYGRIPGGFTKRE-GKPTDREILVSR
PNP_TREDE       ILATICASGQAQEGL-----DYVPLTVDYNEKYYAAGKIPGGFIKRE-GRPKDKEILVSR
PNP_TREPA       ILATVCSSAQRQEGL-----DYVPLTVDFNEKYYAVGKMPGGFIKRE-GRPKDREILISR
PNP_BORBU       VLATVCCSSNVREDL-----DFVPLSVEYNEKYYAAGKIPGGFIKRE-GKPKDKEILVSR
PNP_DESVV       VLVTACSQA-TDRD-----LGFFPLTVEYSEKMYAAGRIPGSFFRREIGRPSERETLVSR
PNP_DESAG       VLCTVCTQP-LERE-----ISFFPLVVDYTEKMYAAGRIPGSFFRREIGRPSERETLVSR
PNP_LAWIP       VLVTVCSQP-LESD-----KGFFPLTVEYSEKMYAAGRIPGSFFRREIGRPSERETLISR
PNP_SYNFM       VLIAATKED-RIREG----IDFVPLMVDYQEMSYAAGRIPGGFFRREIGRPSEKETLTSR
PNP_ANADF       VLVTVVSAA-EKKEG----IDFFPLTVDYQEKLFAAGRVPGSFFRRE-GRPTEKETLTSR
PNP_MYXXD       LLVTAVSAR-EKKD-----IDFLPLTVEYQEKLYSAGRIPGSYFKRE-GRLTEKETLASR
PNP_SORC5       VLVTAVSQD-ERPG-----LDFFPLTCEFVEKTYAAGKIPGGFFKRE-ARQREEEILSSR
PNP_GEOUR       VLVTAVATK-TAKEG----QDFFPLTVNYQEKAYAGGKIPGGFFKRE-ARPSDNETLTCR
PNP_PELPD       VLVTAVAQK-EAKEG----QDFFPLTVNYTEKAYAGGKIPGSFFRRE-ARPSDPETLTCR
PNP_PELCD       VLCTAVSAK-QMREG----QSFFPLTVNYQEKFYAGGKIPGSFFRRE-RGATERETLVCR
PNP_SYNAS       VMVTAVSLK-TAREG----VDFLPLTVDYQEMTYAAGKIPGGFFKRE-GRPNEREILTSR
PNP_DESPS       VLVTVVGAK-TSNPN----VDFLPLTIEYQEKFSAVGRVPGNYFRREIGRPSDQEVLTCR
PNP_BDEBA       VLVTATSSK-KASE-----LDFFPLTVEYIEKFYATGKIPGGYFKRE-AKPTNDAVLIAR
PNP_BACV8       LLATVCAAK-DAVPG----TDFMPLQVEYKEKYSAFGRFPGGFTKRE-GKASDYEILTCR
PNP_PORGI       LLATVCAAK-DANPG----CDFMPLQVEYKEKYSAIGRFPGGFTRRE-GKASDYEILTCR
PNP_CYTH3       ILATVVSAK-EAKPG----VDFMPLSVDYQEKFASNGKIPGGFLKRE-SRLSDYEILISR
PNP_FLAPJ       ILGTVVSSR-KATPG----IDFLPLTVDYREKFAAAGRFPGGFFKRE-ARPSDSEVLTMR
PNP_GRAFK       LLCTVVSNY-EQK-D----LPFLPLTVDYREKFAAAGRYPGGFFKRE-ARPSDGEVLTMR
PNP_SULMW       LLATVVISK-ESKED----FKFIPLTIDYREKYSAGGKIPGGYIKRE-GRPYDEEILTMR
PNP_CHLPD       VLATVVSSKTPPPAN----QDYFPLQVEYREKYSAAGKFPGGFFKRE-GRPSEKEILTAR
PNP_CHLTE       VLATVVSSKTPPSPN----QDFFPLQVEYREKYSAAGKFPGGFFKRE-GRPSEKEILSAR
PNP_PELLD       VIATVVSSRKTPSVN----QDFFPLQVEYREKYYAAGKFPGGFFKRE-ARPSEKEILSAR
PNP_CHLCH       VLATVVSSKKTPPLG----QDFFPLQVEYREKYSAAGRFPGGFFKRE-GRPSEKEILSAR
PNP_SALRD       VLSTATLSD--SVNE----SNFFPLTVDYREKFAAGGKVPGGFIKRE-GRPTDKETLTSR
PNP_KORVE       VLATACANAD-PREG----IDFFPLTVDYREYTYAGGRFPGGFIKRE-GRPSEKEILTSR
PNP_SOLUE       VLVTACMADQ-PKPS----AGFFPLTVDYREYTYAAGKIPGGFIKRE-GRLSEKEVLTCR
PNP_RHOBA       VLVAAASGT--PRPG----IDFFPLMCDYRERLAAAGKFPGGFLKRE-GRPSTKEILSSR
PNP_ECOLI       VFVTVVGQKKAKPGQ-----DFFPLTVNYQERTYAAGRIPGSFFRRE-GRPSEGETLIAR
PNP_PHOPR       VFVSVVGKKAAVEGQ-----DFFPLTVNYQERTYAAGKIPGGFFKRE-GRPSEGETLTAR
PNP_HAEDU       VFVSVVAKKEVKEGQ-----DFFPLTVNYQERTYAAGRIPGGFFKRE-GRPSENETLIAR
PNP_COLP3       VLVSVVGKKEAKPGQ-----DFFPLTVNYQERAYAAGKIPGSFFKRE-GRPSEEETLIAR
PNP_PSYIN       VFVSVVGKNADNQER-----DFFPLTVNYQEKTYAAGKIPGGFFKRE-GRPSEDETLIAR
PNP_PSEA6       VLVSVVGKKDTKPGQ-----DFFPLTVNYQERTYAAGKIPGGFFKRE-GRPSEYETLTSR
PNP_AERS4       VFVTVVGKKEADHGR-----DFFPLTVNYQERTYAAGRIPGGFFRRE-GRPSEGETLTSR
PNP_SHELP       VLVTVVGKKAEEPGR-----DFFPLTVNYQEKTYAAGKIPGGFFKRE-GRPSEGETLTAR
PNP_IDILO       VLVTVVAKKEAREGQ-----NFFPLTVNYQEKTYAAGKIPGGFFKRE-GRPSENETLTCR
PNP_PSEHT       VLVTVVGKREAQPGQ-----DFFPLTVNYQERMYAAGRIPGGFLKRE-GRPNDGETLIAR
PNP_BUCAP       VFVTVVGEKTTNSSQ-----KFFPLTVNYQERTYAVGRIPGGFFRRE-GRPSENEILTAR
PNP_BUCBP       VFVTVVGQKKLQTEQ-----KFFPMTVNYQERTYAAGRIPGGFFRRE-GRPSENEILIAR
PNP_BUCCC       VLITIVSDNTTIPGQ-----KFFPLVVNYQERTYAAGRIPGGFFRRE-GRPSENEILISR
PNP_WIGBR       VFVTVVADKKEKLGQ-----KFFPLTVNYQERTYSIGRFPGGFFRRE-GRPNENEVLVSR
PNP_BLOFL       VLVTVVSSNQEKIDQ-----GFFPLVVHYQERTYAAGKFPGGFFRRE-GRPSESEILTSR
PNP_BLOPB       VLVTVVSSNQVRLEQ-----DFFPLVVNYQERTYAAGKFPGGFFRRE-GRPSENETLTSR
PNP_BAUCH       VLVTVVGVKQVKPGQ-----KFFPLMVNYQERTYAAGRFPGGFFRRE-GRPSEGEILISR
PNP_NEIG1       VFVAVTTNKEVKEGQ-----DFFPLAVDYLERTYAAGKIPGGFFKRE-GKQSEKEILTSR
PNP_CHRVO       VMVSVVGGKNVKPGQ-----DFFPLTVDYLERTYAAGKIPGGFFKRE-GKQSEKEVLTSR
PNP_METFK       VLVSVVGKREVKEGQ-----DFFPLTVDYQEKTYAAGKIPGGFFKRE-GRPSEKETLTSR
PNP_THIDA       VLVTVVAKNEVKPGQ-----DFFPLTVDYQEKTYAAGRIPGGFLKRE-SRPSEGETLISR
PNP_NITEC       VLVTVVGDKKTKPGQ-----DFFPLTVDYQEKFYSAGRIPGSFFKRE-GRPSEKEILTSR
PNP_NITMU       VLVTVVGAKSAKQGQ-----DFFPLTVDYQERSYAAGRIPGSFFKRE-GRPSEKEILTSR
PNP_VEREI       VLATVVASRSIKPGQ-----DFFPLTVDYIEKTYAAGKIPGSFFKRE-AKPSEHETLTSR
PNP_METPP       VLATVVAAKNPKPGQ-----DFFPLTVDYIEKTYAAGKIPGSFFKRE-GRPSELETLTSR
PNP_BORA1       VLATVVAAKKAKPGQ-----DFFPLTVDYIEKTYAAGRIPGGFFKRE-GKPSEKETLTSR
PNP_JANMA       VLATVVAKKDAKPGQ-----DFFPLTVDYVEKTYAAGRIPGGFFKRE-GRPSEKETLTSR
PNP_RALSO       VLATVVGAKNAKPGQ-----DFFPLTVDYIEKTYAAGKIPGGFFKRE-GRPSENETLTSR
PNP_POLAQ       VMGTVVASKSAKPGQ-----SFFPLTVDYLEKTYAAGKIPGGFFRRE-GRPSEGETLISR
PNP_PARXL       VLATVVGARTAKPGQ-----DFFPLTVDYLEKTYAAGKIPGGFFRRE-GRPSEGETLISR
PNP_DECAR       VLVTVVAAKNAKPGQ-----DFFPLTVDYQEKTYAAGRIPGGFFKRE-GRPSEKETLTCR
PNP_AROAE       VLATVVAAKEAKAGQ-----DFFPLTVDYVEKFYAAGRIPGGFFKRE-GRPTEKETLTSR
PNP_ALKEH       VLVTAVGRKEADPGK-----GFFPLTVNYQERTYAAGKIPGGFFKRE-GRPSEKETLTCR
PNP_HALHL       VLVTVVGRKDPAAAR-----DFLPLTVNYQERTYAAGRIPGGFFKRE-GRPSEKETLTCR
PNP_METCA       VLVTVVGRKDASPHG-----DFFPLTVNYQEKAYAAGRIPGGFFKRE-GRPSEKETLTAR
PNP_NITOC       VLVTVVGMKEAAEGR-----DFFPLTVNYQERTYAAGKIPGGFFKRE-GRPTEKETLTSR
PNP_XYLFT       LLVTVVAAKTAREGQ-----DFFPLTVDYQEKFYAGGRIPGSFFKRE-GRATEKETLISR
PNP_COXBR       LLVSVVAKKEAEEGR-----DFFPLTVNYQEKTYAAGKIPGGYFKRE-GRPTEKETLTSR
PNP_DICNV       VLVTVVANKTVAEGQ-----DFFPLTVDYQEKNYAAGKIPGGFFKRE-GRPSEEETLISR
PNP_PSEU5       VLVTVVGAKTADPSK-----GFFPLSVHYQEKTYAAGKIPGGFFKRE-ARPSEKETLTSR
PNP_SACD2       VLVAVTGSKEAKPGQ-----DFFPLSVHYQEKAYAAGKIPGGFFKRE-ARPSEKETLTSR
PNP_HAHCH       VLVTAVAEKEAVPGR-----DFFPLSVHYQEKTYAAGRIPGGYFKRE-GRPSEKETLTSR
PNP_MARHV       VLGTVVGAKEPKPGQ-----GFFPLTVNYQEKTYAAGKIPGGFFKRE-GRPSEKETLTSR
PNP_CHRSD       VLCTVVAKKDVNPAQ-----PFFPLSVHYQEKTYAVGKIPGGFFKRE-GRPTEKETLTSR
PNP_ALCBS       VLVTVVGRKEANPGQ-----NFFPLTVNYQEKTYATGRIPGGFLKRE-GRPSEKETLTCR
PNP_ACIAD       VLVAVVAQPKAKAGQ-----DFFPLTVNYQEKQYAAGRIPGGYGKRE-GRASEAETLISR
PNP_PSYWF       VLVAVVVKSDAKEGQ-----NFFPLTVNYQEKMYAAGKIPGAYGKRE-GRPTEFETLTSR
PNP_HYDCU       LLVTVVGAKNAKAGQ-----DFFPLTVQYQEKAYAAGRIPGGFLKRE-GRPSEKETLTSR
PNP_LEGPA       VLVTVVWKKDSGESN-----DFFPLTVNYQEKFYAIGKIPGGFNKRE-GRPSDNETLISR
PNP_VESOH       VLVTVVSSKETRPGQ-----DFFPLSVDYIEKTYSTGKIPGSFLKRE-ARPSEKETLTSR
PNP_FRATW       VLVTTVVKKSVADGT-----DFFPLSVHYLEKTYAAGKIPGGFLRRE-GRPSEEQILISR
PNP_GRABC       VLCTAVGAKSAKAGQ-----DFFPLTVNYQEKAFAAGKIPGGFFKRE-GRPSEHETLVSR
PNP_ACICJ       VLATVVGARSVKPGQ-----DFFPLTVNYQEKFYAAGRIPGGFFKRE-GRPTERETLTSR
PNP_GLUOX       VLCTAVGAKSVKPGQ-----DFFPLTVNYQEKAYAAGKIPGGFFKRE-GRPSEAEVLNAR
PNP_MAGSA       VLCTVVGAKSQKPGI-----DFFPLTVNYQEKAFAAGKIPGGFFKRE-GRPSEKETLVSR
PNP_RHORT       VLCTAVGAKT-KSKF-----DFFPLTVNYQEKTFAAGKIPGGFFKRE-GRPSEKETLVSR
PNP_CHESB       VLATVVSAKEPKPGI-----DFFPLTVNYQEKTFAAGKIPGGYFKRE-GRPSEKETLVSR
PNP_BARBK       VLATVVSAKAPKPDQ-----DFFPLTVNYQEKTYAVGKIPGGYFKRE-SRPSENETLISR
PNP_NITHX       VLATVVAAKTPREGV-----DFLPLTVDYQEKTYAAGRIPGGYFKRE-GRPSEKETLVSR
PNP_AZOC5       VLATVVSAREPKPGQ-----DFFPLTVNYQEKTYAAGRIPGGYFKRE-GRPSEKETLVSR
PNP_PARL1       VLATVVGERKPKPGL-----DFFPLTVNYQEKTYAAGKIPGGFFKRE-GRPSEKETLVSR
PNP_MARMM       VLATAVGVKQAKPGV-----DFFPLTVNYQEKYFAAGKIPGGFFKRE-GRPTDKETLTSR
PNP_CAUVC       VLATAVFAKSQKPGQ-----DFFPLTVNYQEKTFAAGKIPGGFFKRE-GRPSEKETLVSR
PNP_HYPNA       VLATAVFAKEAKPGQ-----DFFPLTVNYQEKYFASGRIPGGFFKRE-GRPTEKETLTSR
PNP_PARDP       VMANVTFAKEPKPGQ-----DFFPLTVHYQEKYYAAGKIPGGFFKRE-ARPSEKETLTAR
PNP_SPHAL       VLCAVTAAKSVKDGQ-----DFFPLTVHYQEKYSAAGRIPGGFFKRE-RGATEKETLVSR
PNP_NOVAD       VLCAVTAAKSVKEGQ-----DFFPLTVHYQEKYSAAGRIPGGFFKRE-RGATEKETLVSR
PNP_ERYLH       VLCAVTAARSVKEGQ-----DFFPLTVHYQEKFSAAGRIPGGFFKRE-GRATEKETLTSR
PNP_ZYMMO       VLCAVTAAKTVKEGQ-----DFFPLTVHYQEKYSAAGRIPGGFFKRE-RGATERETLISR
PNP_PELUB       ILATVVGAKKVNPDM-----DYFPLSVNYQEKYYAGGKIPGGYFKRE-ARPTESEQLISR
PNP_MAGMM       VLVTAVAETSMRAGQ-----DFFPLSVHYQEKFWAAGKIPGGFIKRE-TRPSEREVLTSR
PNP_RICTY       LLCTCVVANKVKD-----GIGFFPLTINYREMAYSAGKIPGGFLKRE-GKASDKEILVSR
PNP_ORITB       VLCTVVFDKNTKK-----DMDFFPLGVYYREMAYAAGKIPGGFIKKE-GKFSEYEVLVSR
PNP_ANAMM       VLSTVVSQKSKEP------VDFLPLTVQFLAKSYAIGRIPGGFFKRE-GKPSDRETLISR
PNP_ANAPZ       VLATVVSQKSKEA------VDFLPLTVQFLAKSYAVGKIPGGFFKRE-GKPSDRETLISR
PNP_EHRRW       VLSTVVAGKAKEP------VDFLPLTVQFVAKSYAVGKIPGGFLKRE-GKPSDRETLISR
PNP_WOLTR       ILVTVVRKKKEEI------VDFLPLNVQFIAKSYAMGRIPGGFFKRE-GKPSDRETLISR
PNP_NEOSM       VLAVVTLQKDTAASKKTSDLSGLALVTNFLAKSYALGRIPNGFFKRE-GKLSEREVLASR
PNP_CHLCV       VFSSVCAA-NLEEPV-----DFLPLRVDYQEKFSSIGKTLGGFIKRE-GRPTEREILTSR
PNP_CHLPN       VFASACAV-DLDDKV-----DFLPLRVDYQEKFSSTGKTLGGFIKRE-GRPSEKEILVSR
PNP_CHLMU       VFSSACAA-SLSEAV-----DFLPFRVDYQEKFSSAGKTSGGFLKRE-GRPSEKEILISR
PNP_PARUW       VFTTACAAPNADSTT-----DFLPLRVDYQEKFSSAGKTLGGFIKRE-GRPTEKEVLVSR
PNP_BACCN       VLSTATASKEAKDV------DFFPLTVNYEERLYAVGKIPGGFIKRE-GRPSEKAILASR
PNP_GEOTN       VLSTATASREAKDV------DFFPLTVNYEERLYAVGKIPGGFIKRE-GRPSEKAILASR
PNP_OCEIH       VLSVATASSEPKDL------PFFPLTVNYEERLYAVGKIPGGFIKRE-GRPSEKAILSSR
PNP_BACHD       VLSTATASKEPKDL------PFFPLTVNYEERLYAAGKIPGGFIKRE-GRPSEKAILASR
PNP_BACSK       VLSTATASKEPKDL------PFFPLTVNYEERLYAAGKIPGGFIKRE-GRPSERAILTSR
PNP_LISIN       VLTAAVGSKKPRPG------DFFPLTVNYEEKMYSVGKVPGGFLKRE-GRPSDRATLTAR
PNP_ENTFA       VLSAAVASKEAKDV------DFFPLTVNYEEKMYAVGKIPGGFIKRE-GRPSERATLTAR
PNP_STAS1       VLSTAVASKEPRDG------DFFPLMVNYEEKMYAAGKIPGGFKKRE-GRPSDEATLTAR
PNP_STRMU       VLSAAVMSKKMSTG------DFFPLQINYEEKRYAAGKFPGGFNKRE-GRPSTDATLTAR
PNP_STRTD       VLSVAVMSKKMATA------DFFPLQVNYEEKMYAAGKFPGGFSKRE-GRPSTDATLTAR
PNP_LACLA       VLTAATMGK-MATG------DFFPLQVNYEEKMYAAGKFPGGFNKRE-ARPSTDATLTAR
PNP_SPICI       VLVTATVNNKLSEV------DFFPLTVVFQEKLYSVGKIPGGFLKRE-GKPSEYGTLSAR
PNP_ONYPE       VLTTTVFSRKPNNL------DFLPLTVIYQEKLYAAGKIPGSFLRRE-GRSNDHEILTSR
PNP_ACHLI       VLSTAVAKAKVGQT------DFFPLMVIYAEKQYAAGKIPGGFFRRE-GRPSEVETLTSR
PNP_FUSNN       LLSTANRSKEARKGA-----DFFPLTVDYIEKFYSSGKFPGGFNKRE-GRPSTNATLVAR
PNP_TRIV2       VLVTATRSAG-REGI-----DFLPLTVDYEERLYAAGRIPGGIMRRE-GRPPEKTILTSR
PNP_TRIEI       VLVTATTAKG-REGI-----DFLPLLVDYEERLYAGGKIPGGFLRRE-GRPPEKVTLTSR
PNP_ACAM1       VLVTATRSSG-REGI-----DFLPLLVDYEERLYAAGRVPGGFLRRE-GRPPEKATLTCR
PNP_SYNE7       VLVAATRSTA-REGI-----DFLPLTVDYEERMYAAGRIPGGFLRRE-GRPPERATLTSR
PNP_SYNY3       VLVTATRAKG-RDGI-----DFLPLTVDYEGRLYAAGRIPGGFLRRE-GRPPEKATLISR
PNP_THEEB       VLVTANRAAA-REGI-----DFLPLVVDYEERLYAAGRIPGGFLRRE-GRPPEKAILIGR
PNP_PROMA       VLVTATQGQG-REGA-----DFLPLSCDYEERLYAAGRIPGSFMRRE-GRPPERATLISR
PNP_PROMP       LLVTATKTTK-KQAA-----DFLPLICDYEEKLYAAGRIPGGFMRRE-GRPPERATLIAR
PNP_SYNR3       VLVTATRANG-REGI-----DFLPLTCDYEERLYAAGRIPGSFMRRE-SRPPERATLACR
PNP_SYNJA       VLVTATRQAG-RAGV-----DFLPLLVDYEERLYAAGRIPGGYLRRE-GRPPERATLISR
PNP_GLOVI       VLVTATMASKPREGI-----DFFPLLVDYEERLYAAGRIPGSFVRRE-GRPPEKAILAAR
PNP_DEHM1       LLVTLCAAKKPREGV-----DFLPLTIDYEERMYAAGKIPGGFIRRE-GRPSEQAILAGR
PNP4_ALKMQ      VLVNATASKSPREGI-----DFFPLSVDYEEKLYAVGKIPGGFIKRE-ARPSEKAVLTSR
PNP_ALKOO       VLVNACASKSPREGI-----DFFPLSVDYEEKMYAAGKIPGGFIKRE-GRPSENAILTSR
PNP3_ALKMQ      VLVTACASKEPKEGL-----DFFPLSCDYEEKLYAVGKIPGGFIKRE-SRPSEKATLTAR
PNP_CLOD6       VMVNTTKSAKPRDGI-----DFFPLSVDYEEKLYSVGKIPGGFLKRE-GKPSEKAILTSR
PNP_CALS8       VLVTACASEKPREGI-----NFFPLTVDYEERLYSVGKIPGGFIKRE-GKPSEKAILSAR
PNP_CALS4       VLVTACASKEPREGI-----DFFPLTVEYEERLYSIGKIPGGFIKRE-GKPSEKAILSAR
PNP_CLOPS       ILTNVNASEKPREGI-----DFFPLSVEYEERLYSVGKIPGGFIKRE-GKPSEKAILNGR
PNP_CLOB8       ILTNVNASEQPREGI-----DFFPLSVEYEERLYAVGKIPGGFIKRE-GRPSEKAILNGR
PNP_CLOBL       VMINANASKEPREGI-----DFFPLSVDYEERLYSVGKIPGGFIKRE-GKPSDKSILHAR
PNP_CLOTE       VLINANASKEPRDGI-----DFFPLSVEYEERLYSVGKIPGGFIKRE-GRPTENAILHAR
PNP_CLONN       VLVNVNASPEPKEGI-----DFFPLSIEYQERLYAVGKIPGGFIKRE-GRPSDKAILNAR
PNP_CLOAB       VMVNVNASEKPREGI-----DFFPLSIEYEERQYSVGKIPGGFVKRE-GRPSEKSILHAR
PNP_LACP7       VLSTATASDKPREGI-----DFFPLSVEYEEKLYAVGKVPGGFNKRE-GKASENAILTSR
PNP_HUNT2       VLSTATASATPREGV-----DFFPLSVDYEERLYAVGKIPGGFIKRE-GKPSEKAILTAR
PNP_CARHZ       VLVTATGSKEPREGI-----DFFPLTVDYEERFYAVGKIPGGFIKRE-GRPSEKAILSAR
PNP_MOOTA       VLVTATASEEPREGI-----DFFPLTVDYEERLYAAGKIPGGFIKRE-GRPSEKAILSAR
PNP_DESRM       VLVTATVAKNTR-DI-----DFFPLTVDYEERLYAVGKIPGGFIKRE-GRPSEKAILSGR
PNP_PELTS       VLVTATVAPTVRAGI-----DFFPLTVDYEERFYAVGKIPGGFIKRE-SRPSEKAILSGR
PNP_DESHY       VSAFATGSAQPREGI-----DFFPLTVEFEERLYAAGKIPGGFIKRE-GRPSEKAILSAR
PNP_SYNWW       VLVTATAAKQPREGI-----DFFPLTVDYEEKQYAVGKIPGGFIKRE-GRATAQATLSAR
PNP_SYMTH       VLCTAVGSATPREGV-----DFFPLTVDYEERMYSVGRIPGNWFRRE-GRPTSKAILWAR
PNP_CHLAA       LLATVVCAKEAREGT-----DFFPLTVDYEEKMYAVGKIPGNFFKRE-GRPTTTAILISR
PNP_ROSS1       LLATAVASKEPRADA-----DFFPLTVDYEEKMYAAGKIPGSFFKRE-GKPTDSAILTAR
PNP_DEIRA       LVTAQASDTQSK--L-----DFLPLTVEFEERHYAVGKIPGSFQRRE-GRPGEKAILSAR
PNP_THET8       LATAQASETPVE--A-----DFLPLTVEFEERHYAVGKIPGSFMRRE-GRPGEKAILSAR
PNP_RENSM       LLSATTAGKQPREGF-----DFFPLTVDVEERMYAAGRIPGSFFRRE-GRPSTEAILACR
PNP_KINRD       LLSATTAGKSPKDQF-----DFFPLTVDVEERSYAAGKIPGSFFRRE-GRPSTEAILTCR
PNP_STRAT       VLSATTASKNPKDQL-----DFFPLTVDVEERMYAAGKIPGSFFRRE-GRPSEDAILTCR
PNP_NOCSJ       LLSATTAGKHPKDHF-----DFFPLTIDVEERMYAAGKIPGSFFRSE-GRPGEDAILTCR
PNP_ACIC1       VLSATTASKEPREQF-----DFFPLTVDVEERLYAAGRIPGSFFRRE-GRPSEEAILTCR
PNP_CUTAK       LLSATTAAKTPRDSI-----DFFPLTVDVEERMYAAGRIPGSFFRRE-GRPSEGAILACR
PNP_FRACC       VLSATTVSKQPKEQL-----DFFPLTVDVEERMYAAGRIPGSFFRRE-GRPSEDAILTCR
PNP_THEFY       VLSATTVSKRPKEAL-----DFFPLTVDVEERMYAAGRIPGSFFRRE-GRPSEDAILTCR
PNP_RHOJR       LLSATSASKHPKEHF-----DFFPLTVDVEERMYAAGRIPGSFFRRE-GRPSTDAILTCR
PNP_SACEN       LLSATTASKQPKEHF-----DFFPLTVDVEERMYAAGRIPGSFFRRE-GRPSTDAILTCR
PNP_SALTO       VLSATTVGRQPKEHF-----DFFPLTVDVEERMYAAGRIPGSFFRRE-GRPSEDAILTCR
PNP_COREF       LLATTTASNQPREGL-----DFFPLTVDVEERMYAAGRIPGSFFRRE-GRPSTEAILACR
PNP_CORDI       LLATTTASNQPREGF-----DFFPLTVDVEERMYAAGRIPGSFFRRE-GRPSTEAILACR
PNP_CORJK       LLSTTAASRQPREGI-----DFFPLTVDVEERMYSVGRIPGSFFRRE-GRPGTDAILAAR
PNP_LEIXX       LLSATSASKHPKDNF-----DFFPLTVDVEERSYAAGKIPGSFFRRE-GRPSTEAILVCR
PNP_TROWT       LLSSTSVGKQPKEDC-----DFFPLTVDVEERSYAAGKIPGSYFRRE-GRPSTEAILACR
PNP_BIFLO       ILSTTTAGSSPKENY-----DFFPLTVDVEEKMYAAGKIPGSFFRRE-GRPSSEAILACR
PNP_RUBXD       LSTATRS-EEPRPGA-----TFLPLSVDIEERMSSAGKIPGGFLKRE-GKPSEKAILTAR
PNP_LEPIC       LLATVCAADEAKEGQ-----DFFPLTCEYTEKLYSVGRFPGGYFKRE-AKPPEHEILISR
PNP_NITSB       MLATVVMEK-EMVDE-----DFLPLTVQYIEKSYAAGKIPGGFVKRE-QKPGDFETLTAR
PNP_WOLSU       LLASVCYESDERVKE-----DFLPLTVQYIEKSYAAGKFPGGFIKRE-SKPGDFETLTSR
PNP_SULDN       ILATVVIDETEIVKD-----DFLPLTVQYIEKAYAAGKIPGGFFKRE-TKASDFETLTSR
PNP_ARCB4       VLATVVSEFDNPVSE-----DFTPLTVQYIEKTYAAAKLPGGFIKRE-GKPSDFETLTSR
PNP_CAMC5       VLATVARDD-VQVEE-----DFLPLTVQYIEKAYAAGRIPGGYVKRE-TKPGDFETLTAR
PNP_CAMFF       VLAAVARED-AQVEE-----DFLPLTVQYIEKQYAAGRIPGGYVKRE-TKPGDFETLTSR
PNP_CAMHC       VLATVAREN-TQVEE-----DFLPLTVQYIEKQYAAGRIPGGYIKRE-TKPGDFETLTSR
PNP_CAMJD       VLATVAREE-KQVEE-----DFLPLTVQYIEKAYAAGKIPGGYVKRE-TKPSDAETLTAR
PNP_HELHP       LLASVCTQENEKYDD-----EFLPLSVQYIEKTYANNKFPSGFIKRE-GKPSEFEILTSR
PNP_HELPH       ILASVCVER-EPVSE-----DFLPLVVQFLEKSYAAGKIPGGFVKRE-GRAQDFEILTSR
PNP_HELAH       ILASVCVER-ELVSE-----DFLPLVVQFLEKSYAAGKIPGGFVKRE-GRAQDFEILTSR
PNP_HELPJ       ILASVCVER-EPVSE-----DFLPLVVQFLEKSYAAGKIPGGFVKRE-GRAQDFEILTSR
PNP_SULNB       LIAAVAVDE-KAVEE-----DFLPLTVQYMERSYAAAKIPGGFIKRE-TKPGDFETLTSR
                :                      .:         :  :  .   : *         *  *

PNP_FERNB       LIDRPIRPLFPKNLRNEVQVIVTVLSVDPN-CPTDVLGITAASLALNISRVPFD----GI
PNP_THEM4       LIDRPIRPLFPKYLRNDVQLIVTVLSVDGD-TPPDVTGIFAASLALNFSKIPFQ----GI
PNP_THEP1       LIDRPIRPLFPKKLRNEVQVIVTVLSVDPN-VPPDVVGIFAASLALNVSKIPFE----GI
PNP_PSELT       TIDRPIRPLFPKHLRNEVQVVVTVISTDSV-NTPDIVGVFAASLALNISDIPFN----GI
PNP_PETMO       LIDRPIRPLFPENFFNEVQVITTVFSMLNG-DSIETWGITGASLALNLSPIPFN----GI
PNP_AQUAE       VIDRPIRPLFPEGFFHDVIITALTLSADDK-YDPDVLAITGASAALHISRIPFE----GP
PNP_TREDE       LIDRPMRPLFNKEFGREIQLVPTCISTDMI-NPPDILAVIASSAAVHISDIPFD----GP
PNP_TREPA       LIDRPMRPLFEKEFGRDIHVVPTCISSDMV-HPHDVLAIVASSAAVTLSDIPFH----GP
PNP_BORBU       LIDRPMRPLFDKRFGREIQVIPTTLATDQL-NPPDIVGMNAAFTAVFLSDIPFN----GP
PNP_DESVV       LIDRPIRPLFPKGLKDEVQVLANVISSDQN-NDSDVLAVTGASTALGLSSIPFD----GP
PNP_DESAG       LIDRPLRPLFPKGFTNEVQILANVISADQE-NDSDVLALCGSSAAVMLSSVPFE----AP
PNP_LAWIP       LIDRPIRPMFPKGLAEDVQILANVISSDQE-NESDILAVTGASAAVMLSSLPFE----CA
PNP_SYNFM       LIDRPIRPLFPKKYCYETQVVATVLSVDME-NEPDVVALTGASTALHISPVPFQ----GP
PNP_ANADF       IVDRSCRPLFAEGYPNETQIIATVISFDQE-NDTDVLALTGASAALHLSDIPFN----GP
PNP_MYXXD       LVDRSCRPLFPEGYAYETQIIASVISSDPE-NEGDIHGITGASAALWVSDIPFD----GP
PNP_SORC5       LMDRPLRPLFPEGFKRDTQIIATVLSSDKQ-NKADVLALTGASAALHISDIPWH----GP
PNP_GEOUR       LIDRPIRPLFPENFLNDTQIMATVVSADKD-NDPGILSMVGASAALMVSDIPFQ----GP
PNP_PELPD       LIDRPIRPLFPENFLNDTQIIATVVSADKD-HDPRILSMLGASAALEVSDIPFQ----GP
PNP_PELCD       LIDRPLRPLFPKGYMFETQIMPTVISVDEQ-NDPDTLAMVGASAAIAVSDIPFD----GP
PNP_SYNAS       VIDRSIRPLFPKGYCYETQLVATVLSVDSE-NDSDVAALLAASAALEISDIPFK----GP
PNP_DESPS       IIDRPLRPLFPEGYRSETQVIATVLSADQV-NSPDVLALTGASAALSISHIPFA----GP
PNP_BDEBA       LIDRPIRPVFPEGYRHETQIVATVLSADGA-FPLEILASLGASAALHCSDIPFN----GP
PNP_BACV8       LVDRALRPLFPDNFHAEVYVNIVLFSADGI-DMPDALAGLAASAALAVSDIPFG----GP
PNP_PORGI       LVDRALRPLFPDNYHAEVFVNVILFSADGE-DMPDALAGLAASAALAVSDIPFN----GP
PNP_CYTH3       LVDRAMRPLFPEDFHADTQVAITLISADAD-VLPDALACLAAQAAMSVSDIPFN----GP
PNP_FLAPJ       LVDRVLRPLFPSDYHAEVQVMIQLMSHDEE-VMPDALAGLAASAALALSDIPFE----TL
PNP_GRAFK       LVDRVLRPLFPKDYSAETQVMIQLMSHDDE-VMPEAMAGLAASAAIQLSDFPFE----CA
PNP_SULMW       LVDRLLRPLFKDNYYNEIQIMISLLSYDIN-VLPDGLAGLVASTAVSISEISFQ----GP
PNP_CHLPD       LIDRALRPLFPDGYLFETQIIVTVFSSDQI-NDADVLGGVAASAAIMVSDIPFH----NS
PNP_CHLTE       LIDRALRPLFPDGYYQETQIIISVISSDTI-NDADVLGGIAASAAIMVSDIPFA----NP
PNP_PELLD       LIDRALRPLFPTGYYHETQVIINVISSDQQ-NDADVLGGLAASAAIMVSDIPFE----NA
PNP_CHLCH       LIDRALRPLFPDGYYYETQIIISVISSDQV-NDGDVLGGLAASAAIMVSDIPFQ----NP
PNP_SALRD       LIDRAIRPLFPDGFYHDVHVVNFVISAGQD-FDADVIAGVGSSAALMLSGAPFA----GP
PNP_KORVE       QIDRPIRPLFPEGFRCETQVIAMVLSADSE-NDPDVCGINGASAALAVSDIPFN----GP
PNP_SOLUE       LIDRPIRPLFPEGFMNETQIIAMVLSADPE-QDPNSLAIVGTAAALAISDIPFQ----YV
PNP_RHOBA       LMDRPIRPLWPAGYKDEVQVQACVIASDLQ-NDGDVLAMIGGATALHISPLPFK----GP
PNP_ECOLI       LIDRPIRPLFPEGFVNEVQVIATVVSVNPQ-VNPDIVAMIGASAALSLSGIPFN----GP
PNP_PHOPR       LIDRPIRPLFPSAFKNEVQVIATVVSVNPE-VNPDMITMIATSAALAISGLPFN----GP
PNP_HAEDU       LIDRPIRPLFPEGFFNEIQIVATVVSVNPQ-ISPDLVAMIGASAALSLSGVPFN----GP
PNP_COLP3       LIDRPIRPLFPEGFTNEVQVIITVVSVNPE-IAPDIISLIGTSAALAISGLPFS----GP
PNP_PSYIN       LIDRPVRPLFPAGFKNEVQVIATVVSINPE-VNPDVVAMIATSAALSISGMPFK----GP
PNP_PSEA6       LIDRPIRPLFPDGFMNEVQIIVTVVSANPE-IPTDIISLIGTSAALAISGMPFN----GP
PNP_AERS4       LIDRPIRPLFPEGFLNEVQVVATVMSVNPL-VSPDIVAMIGASAALAISGIPFG----GP
PNP_SHELP       LIDRPIRPLFPNGFKNEVQVIITVVSVDPE-ISPEVISMIGTSAALSISGIPFN----GP
PNP_IDILO       LIDRPIRPLFPDGFMNEVQVVATVVSVNPQ-INPDIVALIGTSAALSISGVPFA----GP
PNP_PSEHT       LIDRPIRPLFPSGFVNEVQVIATVVSVNPE-IQPDMVALIGTSAALAISGIPFS----GP
PNP_BUCAP       LIDRPIRPLFPKGFCNEIQIIATVVSVNPQ-INPDIISIIGASAALSLSGIPFY----GP
PNP_BUCBP       LIDRPIRPLFPKRFFNEVQIIATVVSLNPQ-VNPDIVAIIGASAALSISGMPFL----GP
PNP_BUCCC       LIDRPIRPLFPKDFLYEVQIIATVISVNPQ-INPDIISIIGSSAALCLSGLPFL----GP
PNP_WIGBR       LIDRSVRPLFPKNFFNDIQIIATVMSVNPQ-VNPDIVSIIGASAALSLSGLPFK----CP
PNP_BLOFL       LIDRPIRPLFPKGFLNDIQIIATVVSVNPQ-IHPDIVAMIGVSAALSLSDIPFF----GP
PNP_BLOPB       LIDRPIRPLFPKGFINDVQVVATVVSVNPQ-VNPDIVAIIGVSAALSLSDIPFF----GP
PNP_BAUCH       MIDRPLRPLFPDGFLNEVQVIATVVSINPQ-VSPDIVAMIGVSAALSISGIPFN----CP
PNP_NEIG1       LIDRPIRPLFPEGFYHDIQIVAMVVSVDPE-IDSDIPAMLGASAALVLSGVPFA----GP
PNP_CHRVO       LIDRPIRPLFPEGFYHDVQIVATVLSLNPE-VDSDIPAMIGASAALAISGLPFA----GP
PNP_METFK       LIDRPLRPLFPEAFYNEVQVVATVMSSDPE-IDADIPAIIGASAALAISGIPFY----GP
PNP_THIDA       LIDRPIRPLFPEGFFNEVQIIATVMSSNPE-VSADIPALIGASAALSLSGLPFD----GP
PNP_NITEC       LIDRPIRPLFPDGFYNEVQVIAMVLSSDAE-IDADIPATIGASAALILSGIPFD----GP
PNP_NITMU       LIDRPIRPLFPENFYNEVQVVATVLSSDNE-VDADIPAMLGASAALVLSGIPFN----GP
PNP_VEREI       LIDRPLRPLFPQGFFNEVHLVIHTLSLNPE-VDADIAALIASSAALALSGIPFN----GP
PNP_METPP       LIDRPLRPLFPEGFYNEVQVVVHVLSLNPE-ASADIAALIGSSAALAISGIPFN----GP
PNP_BORA1       LIDRPLRPLFPEGFYNEVQVVIHTLSVNPE-IDPDIPAMIGASAALAISGIPFN----GP
PNP_JANMA       LIDRPIRPLFPEGYLNEVQIIIHVMSVNPE-IDPDIAAMIGASAALSVAGIPFA----GP
PNP_RALSO       LIDRPLRPLFPEGFYNEVQVVIHVLSINPE-VPADIPALVAASAALAVSGLPFN----GP
PNP_POLAQ       LIDRPLRPLFPEGFLNEVQVVIHVLSINPD-VPSDIPALIAASAALAISGIPFA----GP
PNP_PARXL       LIDRPLRPLFPEGFYNEVQVVIHVLSLNPE-IPADIPALIGASAALAVSGLPFN----GP
PNP_DECAR       LIDRPIRPLFPDGFYNEVQVIATVMSLNPE-IDSDIPALIGASAALAISGVPFN----GP
PNP_AROAE       LIDRPIRPLFPEGFYNEVQVIITVLSLNPE-VDPDIPAMIGASAALAISGVPFD----GP
PNP_ALKEH       LIDRPIRPLFPEGFYNEVQVVATVLSMNPE-VDADIPALIGASAALSISGIPFD----GP
PNP_HALHL       LIDRPIRPLFPEGFRQEVQVIATVLSLNDE-VDADIPAMIGTSAALALSGIPFE----GP
PNP_METCA       LIDRPIRPLFPDGFTHEVQVVATVMSLNPE-VDPDIPSMLGASAALTLSGLPFK----GP
PNP_NITOC       LIDRPLRPLFPKNFINEVQVIATVISSDSE-NDPDIPSLIGASAALALSGIPFT----TP
PNP_XYLFT       LIDRPIRPLFPEDYKNEVQIIAMVMSLDPE-IDGDIPAMIGASAALSLAGIPFK----GP
PNP_COXBR       LIDRPLRPLFPKGFTNEVQVIATVLSVDSK-VPTDIPAILGASAAIGLSGIPFN----GS
PNP_DICNV       LIDRPIRPLFADGFLNEVQIIATVLSYNPE-VSPDIPSIIGASAALKLSGLPFN----GP
PNP_PSEU5       LIDRPIRPLFPEGFQNEVQVICTVVSTSKK-TDPDIAAMIGTSAALAVSGIPFD----GP
PNP_SACD2       LIDRPIRPLFPNGFLNEVQVVCTVISAEKD-VDPDIVAMIGTSAALAISGIPFN----GP
PNP_HAHCH       LIDRPIRPLFPDGFMNEVQIICTVMSANKD-VDPDIASIIGAAAALEISGVPFQ----GP
PNP_MARHV       LIDRPIRPLFPNGYMNEVQVVLTVMSASKN-HDPDIAAMIAASAALAISGIPFD----GP
PNP_CHRSD       LIDRPIRPLFPNGFMNEVQVVCTVLSTDRN-HDPDIAAMLGTSAALAISGVPFN----GP
PNP_ALCBS       LIDRPIRPLFPKGFMNEVQVVATVMSSDKN-RDPDIAALIGTSAALSISGIPFS----GP
PNP_ACIAD       LIDRPIRPLFPEGYFNEIQITATVVSSDKT-MDADIAAMLGASAALSIAGTPFR----GP
PNP_PSYWF       LIDRPIRPLFPEGYVNEIQITATVISSDKK-HYADIAAMIGASAALSISDAPFN----GP
PNP_HYDCU       LIDRPIRPLFPKGFMNEVQVIATVVSLDPE-IGTEVPAMLGTSAALSISGIPFD----GP
PNP_LEGPA       LIDRPIRPLFPDNFFNEVQIIATVLSLNPE-VSPDIIAMIGASAALSISGVPFN----GP
PNP_VESOH       LIDRTIRPLFPNGFMNEIQVLITVVSANSE-VNPDIISMLGVSAALSISGVPFS----RP
PNP_FRATW       LIDRSIRPSFPDGFFNEIQIVATVLSYDGA-VAPDILALIGASASLAISGAPYD----DV
PNP_GRABC       LIDRPIRPLFPEGFYNEVQVIATVLSHDME-NDPDIVALIGCSAALTLSGIPFF----GP
PNP_ACICJ       LIDRPIRPLFPHGFRNEVQVIVNVLSHDLE-NEPDIVSLVAASAALTLSGIPFF----GP
PNP_GLUOX       LIDRPIRPLFPENFRNEVQITATVLSYDNE-NDPALVSLIGCSAALTLSGIPFF----GP
PNP_MAGSA       LIDRPIRPLFADGFRNEVQVVCTVLSHDLE-NDPDIAALVGTSAALTISGLPFM----GP
PNP_RHORT       LIDRPIRPLFVHGYKNETQLVCTVLCHDLE-NNPDIVAIVGASAALTLSGLPFL----GP
PNP_CHESB       LIDRPIRPLFVEGYKNDTQVIITVLQHDLE-NDPDILSMVAASAALTLSGVPFM----GP
PNP_BARBK       LIDRPIRPLFVDDYKNDTQVIVSVIQHDLE-NNPDILSMIAASAALTLSGIPFM----GP
PNP_NITHX       LIDRPVRPLFADGWRNETQVIVTVLSHDME-NDPDVLAMVAASAALTLSGAPFR----GP
PNP_AZOC5       LIDRPIRPLFADGYKNDTQVVVTVLAHDLE-NDPDVLSMVAASAALTLSGVPFM----GP
PNP_PARL1       LIDRPIRPLFIKGFKNETQVIATVVSHDME-NDPDIVAMIAVSAALTISGLPFL----GP
PNP_MARMM       LIDRPIRPLFVKGFKNEVQVMLTVLSHDLE-NDPDIVGMIGASAALVLSGLPFM----GP
PNP_CAUVC       LIDRPIRPLFVKGFKNEVQVVVTVLQHDLE-NDPDILGMVAASAALCLSGAPFM----GP
PNP_HYPNA       LIDRPIRPLFVDGFKHEVQVVVTTLSYDLE-NDADIIALVGASAALVLSGAPFM----GP
PNP_PARDP       LIDRPIRPLFVPGFKHEVLVMCTVLSHDLV-NDPDIVAMIAASAALTISGVPFM----GP
PNP_SPHAL       LIDRPIRPLFPEGFYNEINAIAQVLSYDGH-NEPDILAMVAASAALTISGVPFM----GP
PNP_NOVAD       LIDRPVRPLFPEGFYNEINVIAQVLSYDGE-TEPDIVAMIAASAALTISGVPFM----GP
PNP_ERYLH       LIDRPVRPLFPEGFYNEINVIAQVLSYDGE-TEPDIVAMIAASAALTISGLPFM----GP
PNP_ZYMMO       LIDRPIRPLFPEGFYNETLVIAQVMSYDGE-NEPDILAMIAASAALALSGVPFL----GP
PNP_PELUB       LIDRPIRPLFPSEFKNEVQLLPTVISYDKD-NQPDILAITASSAALAISGMPFM----GP
PNP_MAGMM       LIDRPIRPLFPKGFMNETQVVAQVLSYDPD-YPSDIAALIGCSAALALSGVPFE----GP
PNP_RICTY       LIDRPIRPLFHQAFIHETHITCSVLSYDPE-TPVDILAIIGASAALSISPAPYL----EI
PNP_ORITB       LIDRSIRPLFDSNFRNDTQIICTVMSYDPR-YSPDILAIIGSSAALAISGIPIV----KP
PNP_ANAMM       LVDRSIRPLFPTGFCDEIVIVCNLLSYDQV-SPPETVALIGAAAALAISGIPFP----TP
PNP_ANAPZ       IIDRSIRPLFPSGFSDEVAVVCNLLSYDAS-SPPETVALIGASAALAISGIPFH----CP
PNP_EHRRW       LIDRSIRPLFPSGFYDEVSIVCNLLSYDTV-TPPEVTALIGATAALAISGVPFN----GM
PNP_WOLTR       VIDRSIRPLFLEGFHDEISIVCNLLTYDTV-NPPEVPALIGAVAALAISGVPFH----FI
PNP_NEOSM       VVDRAVRPLIEENLVNEVNIVCKLLAHGNRKVLPEIPALIAASAALQLSGIPFS----GP
PNP_CHLCV       LIDRSMRPSLPNRLMQDVQVLSYVWSYDGV-TLPDPIAICGVSAALAISDIPQI----SV
PNP_CHLPN       LIDRSLRPSFPYRLMQDVQVLSYVWSYDGQ-VLPDPLAICAASAALAISDIPQS----NI
PNP_CHLMU       LIDRSLRPSFPNRLMQDIQVLSYVWSYDGK-TLPDPLAICGASAALAISEVPQN----CI
PNP_PARUW       LIDRPIRPMFEEGYYNEVQLLSFVWSYDGI-NSPEPLAICGASAALVISDIPLI----KP
PNP_BACCN       LIDRPIRPLFADGFRNEVQVVSIVMSVDQD-CSSEMAAMLGSSLALSISDIPFE----GP
PNP_GEOTN       LIDRPIRPLFAEGFRNEVQVVSMVMSVDQD-CSPEVAALIGSSVALTISDIPFE----GP
PNP_OCEIH       LIDRPIRPLFPDGFRNEVQVISTVMSVDQD-CPSEIAAMIGSSIALSVSDIPFE----QP
PNP_BACHD       LIDRPIRPLFPEGFRNEVQVISIVMSVDQD-CSSEMAAMVGSSLALSISDIPFE----GP
PNP_BACSK       LIDRPIRPLFPDGFRNDVQVISIVMSSDQD-ASPEMAAMIGSSLALCVSDIPFE----GP
PNP_LISIN       LIDRPIRPLFAEGFRNEVQITSTVFSVDQD-CSPEMAAMLGSSVALVISDIPFE----GP
PNP_ENTFA       LIDRPIRPMFSEGFRNEVQITNIVMSVEQD-CTPEMAAMFGSSLALAISDIPFD----GP
PNP_STAS1       LIDRPIRPLFPKGYKYDVQIMNTVLSADPD-CSPEMAAMIGSSMALSVSDIPFQ----GP
PNP_STRMU       LIDRPIRPMFAEGFRNEVQVINTVLSYDAD-ASAPMAAMFGSSLALSISDIPFN----GP
PNP_STRTD       LIDRPIRPMFAEGFRNEVQVINTVLSYDEN-ASAPMAAMFGSSLALSISDIPFN----GP
PNP_LACLA       LIDRPIRPMFAEGFRNEVQVINTVLSYDEN-ASGRVAAMFGSSLALAISDIPFD----RP
PNP_SPICI       VIDRALRPLFSENFRNEVQIVINVLAVDND-NDVRMVSLFAASLALSISKIPFA----GP
PNP_ONYPE       LIDRSLRPLFPDYFQQEVQVINTVLSLDPD-FKSELASMLGSSLSLLISEIPFF----EA
PNP_ACHLI       LIDRPLRPLFDDGYRNEVQVVNTVLSSDPE-ASSQMAAMLGSSIALEISNIPFM----GP
PNP_FUSNN       LIDRPIRPMFPDGFNYDVHIVNTVLSYDEI-NIPDYLGVIGSSLALMISDIPFL----GP
PNP_TRIV2       LIDRPLRPLFPSWLRDDLQIVALTMSMDEQ-VPPDVLAVTGASIATLIAKIPFN----GP
PNP_TRIEI       LIDRPLRPLFPSWLRDDIQIVATTLSMDEE-VPPDVLAVTGSSVAVLLAKLPFY----GP
PNP_ACAM1       LIDRPMRPLFPNWLRDDLQIVATTISMDEQ-VPPDVLAVTGASVATLLAKIPFK----GP
PNP_SYNE7       LIDRPLRPLFPSWLRDDLQVVATTLSMDET-VPPDVLAVTGASIATLVAKIPFY----GP
PNP_SYNY3       LIDRPLRPLFPHWLRDELQIVATTLSMDEE-VPPDVLAVTGASVAVILAQIPFK----GP
PNP_THEEB       LIDRPLRPLFPQWLRDDLQVVATTVSLDEN-APPDVLAVTGASIAVLLAQIPFN----GP
PNP_PROMA       LIDRPLRPLFPNWMRDDIQVVATCLSLDER-VPADILAVTGSSMATLLAGIPFY----GP
PNP_PROMP       LIDRPMRPLFPSWMRDEIQIVASCLSLDER-VPADVLGVTGASIATLLAEIPFY----GP
PNP_SYNR3       LIDRPIRPLFPSWMRDDLQIVATVMSVDER-VPPDVLAVTGASLATLLAKIPFY----GP
PNP_SYNJA       LIDRPLRPLFPEWLRDDVQIVATTLSVDDK-VPPDVLCILGASLAIHSARIPFN----GP
PNP_GLOVI       LIDRPLRPLFPKGFINDVQIVATVLALDMN-VPPDILAILGASTATMLAGIPFD----GP
PNP_DEHM1       LTDRPLRPLLPKEWRNELQIIITVIASDKE-NDADIWGVVGASTVLTMSQIPYE----GP
PNP4_ALKMQ      LIDRPIRPLFPKGYRNEVQVIATVMSVDKD-YAPDIVAMIGSSIALSISDIPFG----GP
PNP_ALKOO       LIDRPIRPLFPDGYRNDVQIIATVLSVDID-CTPDIVAMLGSSIALSISDIPFQ----GP
PNP3_ALKMQ      LIDRPIRPLFPKGYHNDVQVIATVLSMDQD-CPPDISAMIGSSIALSVSNIPFM----GP
PNP_CLOD6       LIDRPIRPLFPKGFRNDVQVVATVLSVDQD-CTPDIVAMIGSSIALSISDIPFN----GP
PNP_CALS8       LIDRPIRPLFPKDFYHDVSVIATVLSVDPD-NPPDVLAMLGSSVALSISDIPFE----GP
PNP_CALS4       LIDRPIRPLFPEGYRNDVQVIATVLSVDPD-AQPEIVAMIGSSVALSISDIPFN----GP
PNP_CLOPS       AIDRPLRPLFPKGYRNDVQVVCTVVSVEND-NLPEILAINAASMALCLSSIPFT----TP
PNP_CLOB8       AVDRTLRPLFPKGYRNDVQVVTTVVSVEKD-NLPEILAINAASLALCLSSIPYT----IP
PNP_CLOBL       SIDRPLRPLFPNGYRNDVQIVNTVLSVEQD-NLPEILAINGSSLALCLSSIPFT----TP
PNP_CLOTE       AIDRPLRPLFPKGYRNDVQIVCTVLSVESD-NQPDILAMNGASLALCLSSIPFT----TP
PNP_CLONN       AIDRPLRPLFPKGYRNDVQVVCTVVSVDQD-NLPNILAMNGASLALCLSSIPFT----IP
PNP_CLOAB       AIDRPLRPLFPKGYRNDVQVVCTVMSVEQD-NLPEILAMNGASMALCLSDIPFT----TP
PNP_LACP7       VIDRPMRPLFPKDYRNDVTLNNLVMSVDPD-CSPELTAMLGSAISVAISDIPFD----GP
PNP_HUNT2       VIDRPLRPLFPKDLRNDVAIVNTVLSVDQD-NSPELAALLGSSIAVSISDIPFN----GP
PNP_CARHZ       LIDRPIRPLFPKGFKNDVHIVATVLSVNQD-NPPEIAAMNGASAALTLSHLPFL----GP
PNP_MOOTA       LIDRPIRPLFPKFYRNDVHVVATVMSVDQD-CPPNVAGIIGASAALMLSAIPFA----GP
PNP_DESRM       LIDRPIRPLFPKHMRNEVQVVATVMSVDQD-NAPEIAAMIGASAALHISKIPLK----KP
PNP_PELTS       LIDRPIRPLFPKEMRNEVQVIATILSVDQD-NAPEIAAMVGASAALHISEIPLK----FP
PNP_DESHY       LIDRPIRPLFPEGYRNDVQVVAQVMSVDQD-CASDITGINAASAALTISNVPFE----GP
PNP_SYNWW       LIDRPIRPLFPKGFRNEIHVVATILSVEKD-NAPDVTAITGASVALSISDIPFA----GP
PNP_SYMTH       LTDRPIRPLFPEGFRNDVQVVCTVLSVDPD-HPVEIMGMIGASAALTISDIPFE----GP
PNP_CHLAA       LTDRPLRPLFPKGFYNEVQVIITTFSIDME-NDPGPLAIIAASAALCISDIPFA----GP
PNP_ROSS1       LTDRPLRPLFPEGYRNEVQIIVTTFSIDMV-NDPAPLAIIGASAALAISDIPFL----GP
PNP_DEIRA       ITDRQIRPLFPKGYRHETQVIITVLSADGQ-NAPDVLGPIGAAAALSISDIPWA----GP
PNP_THET8       MTDRPIRPLFPKGFRHEVQIIVTVLSADQK-NPPDILGPIAASAALMLSDIPWE----GP
PNP_RENSM       LMDRPLRPAFVKGLRNEVQIVVTVLAINPD-ELYDVVAINASSMSTQLSGLPFS----GP
PNP_KINRD       LIDRPLRPSFVKGLRNEVQVVVSVMALHPD-DAYDVVAINVASLSTQLSGLPFS----GP
PNP_STRAT       LIDRPLRPSFKKGLRNEIQVVATIMALNPD-HLYDVVAINAASASTQLAGLPFS----GP
PNP_NOCSJ       LIDRPLRPTFKKGLRNEVQVVITVMALNPD-TPYDVLAINAASLSTQLSGLPFS----GP
PNP_ACIC1       LIDRPLRPSFVKGLRNEVQVVVTVLAVDPE-HLYDVVAINAASMSTLLAGLPFS----GP
PNP_CUTAK       LIDRPLRPSFVKGLRNEVQVVVTVMALNPA-VYYDVVAINAASMSTQLAGLPFS----GP
PNP_FRACC       LIDRPLRPSFAKGLRNEIQVVATVLALDPD-TLYDVVAINAASASTTLSGLPFT----GP
PNP_THEFY       LIDRPLRPSFQKGLRNEIQIVATVLALHPD-HLYDVIAINAASMSTQLAGLPFS----GP
PNP_RHOJR       LIDRPLRPSFVDGLRNEIQVVVTVMSLNPQ-DLYDVVAINAASASTQIAGLPFS----GP
PNP_SACEN       LIDRPLRPSFVDGLRNEVQVVVTVMSLDPQ-DPYDVLAINGASASTQLSGLPFS----GP
PNP_SALTO       LIDRPLRPSFVKGLRNEVQVVETVLALDPS-HPYDVVAINAASMSTKLSGLPFS----GP
PNP_COREF       LIDRPLRPTFVKGLRNEVQVIITVMSVSPE-DSYDVVAINGASAATRISGLPVS----GA
PNP_CORDI       LIDRPLRPTFVKGLRNEVQVVITVLSVNPQ-DMYDVVAINGASAATQLSGLPVS----GP
PNP_CORJK       LIDRPLRPTFVRGLRNEVQVIVTVLSMDPK-DRYDVLAINGASASTQLSGLPVS----GP
PNP_LEIXX       LIDRPLRPSFVDGLRNEVQIVVTVLSIAPD-EFYDALAINAASASTQISGLPFS----GP
PNP_TROWT       LIDRPLRPSFNAGLRNEVQVIVTVLSIAPG-EFYEALAINAASASTLVSGLPFS----GP
PNP_BIFLO       IIDRPLRPLFPHTLRNEVQVVETVLAVNPD-DAYDVIALNAASASTMISGLPFE----GP
PNP_RUBXD       LTDRPIRPLFPKDYYYEVQVIGTVLVADQE-NPYDVVSMVGASAALALSDIPFG----GP
PNP_LEPIC       IIDRPIRPLFPEGYFCEVQLQVQVLSADGD-VSVAGHALNAASAALAVSDIPFN----GP
PNP_NITSB       IVDRALRPLFPKGYLYPTVITVMVLSADPE-SDLQVLALNAASAALFVSDIPVR----KA
PNP_WOLSU       IIDRSLRPLFPKGYAHPTQITVMVLSAQND-ADLQTMALNAASAALFVSDIPLR----KP
PNP_SULDN       IVDRSLRPLFPKGFGHPTQITIMVFSVDKE-SDLQVLALNAASAALYVSDIDIN----KS
PNP_ARCB4       VIDRSLRPLFPKGYVYPTTITVMVLSADKN-VDLQTLSLNAANAALYTSNLPIK----KS
PNP_CAMC5       IIDRSLRPLFPKGYAYPTQIVVMVLSADPE-VDLQVVGLNAASVALYLSDIPVN----RP
PNP_CAMFF       IIDRSLRPLFPKGYAYPTQIVVMVLSSDPE-VDLQVVSLNAASVALYLSDIPVN----SP
PNP_CAMHC       IIDRSLRPLFPKGYAYPTQIVVFVLSADPE-IDLQVVGLNAASVALYLSDIPMK----AP
PNP_CAMJD       IIDRSLRPLFPKGYAYPTQIVVMVLSADPK-VDLQVMSLNAASVALYLSDIPMK----AP
PNP_HELHP       LIDRTLRPLFPKGYTYITSIVVMVLSYDGK-SDLQLNALNAAACALYVSDLPLESLQDKA
PNP_HELPH       LIDRTLRPLFPKDYRYPTQITLMVLSHDIE-NDLQVSALNAASAALFLAHIAPI----KS
PNP_HELAH       LIDRTLRPLFPKDYRYPTQITLMVLSHDIE-NDLQVSALNAASAALFLAHAAPF----KS
PNP_HELPJ       LIDRTLRPLFPKDYRYPTQITLMVLNHDIE-NDLQVSALNAASATLFLAHIAPI----KS
PNP_SULNB       IVDRSLRPLFPKGFYYPVTISVMVVSSDSE-VDMQVAALHAANAALYVSDISVQ----RS
                  **  **                                        :           

PNP_FERNB       VAGVQIGYVDGQ------FIVFPTAEQLE--------RSKIDIVVAGTKDA---------
PNP_THEM4       VAGVRIGYVDGE------FVIFPTEEQLK--------NSKLDIVVAGSKDA---------
PNP_THEP1       VAGIRVGYRDGQ------FIALPSEEDIE--------KGLMDITVAGTKDA---------
PNP_PSELT       VAAVRVGLVDGK------IVLFPTEDQLQ--------KSLLDIVVAGTEDT---------
PNP_PETMO       VAGVRIGYVDGQ------FIAFPTQEQLK--------NSKIDMVVAGTKDA---------
PNP_AQUAE       IAGVRVCRVNGE------FVANPTYEQRK--------EADLDIVMAGTKDA---------
PNP_TREDE       VAAARVAYKNGE------YIINPTFSQIE--------TADMEIVVAGTKEG---------
PNP_TREPA       VAAVRVAYLNGS------YVINPTFSQID--------AASMEVVVAGTRQG---------
PNP_BORBU       IAAVRMVYLNGK------FIVNPSFEEIH--------DSDLDIVVAGSLNG---------
PNP_DESVV       VAGARIGRIDGQ------FVINPTIKEMERS--------DLNIVLAASRD----------
PNP_DESAG       VAGARVCRIDGE------FVLNPTITEAAKA--------DLNLVVAANRD----------
PNP_LAWIP       IAAGRIGRLNGQ------FVLNPTINEIELS--------DLNIVFAASSE----------
PNP_SYNFM       VAAVRVGRINGS------FAINPSAKELLES--------DLNVVVAGSRD----------
PNP_ANADF       IAGVRVGRVNGQ------FVANPTLAQRAEA--------DLDVIMAASRD----------
PNP_MYXXD       IAGIRVGRVGGQ------LVANPTAKQREQS--------DLDLVMAVSRK----------
PNP_SORC5       VVGVRVGRLDGE------FVAYPTVADIERC--------DIDLVVACSRD----------
PNP_GEOUR       IAGVKVGRVDGR------FIANPTADEMEKS--------DIEIVVAASKD----------
PNP_PELPD       IAGVKVGRVDGR------LICNPTADELELS--------DMEIVVAASRD----------
PNP_PELCD       VAAVRVGRVEGN------LIANPTIEQRAES--------DMDIIVSGSRD----------
PNP_SYNAS       IVGVRVGRVDGQ------FICNPSKLEQEKG--------DLNLYLVGRKVVPGTEGRPY-
PNP_DESPS       VAGGRIAYIDGK------YVLNPTFAELESS--------SMDLMVACTRN----------
PNP_BDEBA       TAAVQIARVDGQ------FVANPTPQQMEKS--------DMDMIVAGTRN----------
PNP_BACV8       ISEVRVARIDGQ------FVINPTFEQLEKA--------DMDLMVAATYD----------
PNP_PORGI       ISEVRVARVDGR------YIVNPTFEQLERA--------DIDLMVGATMD----------
PNP_CYTH3       VSEVRVISLNGE------FIINPKPAQIEKA--------ELELIVAASYD----------
PNP_FLAPJ       ISEARVGRIDGK------FIINPSRAQLELS--------DIDMMIGASTD----------
PNP_GRAFK       ISEARVGRVNGE------FIINPTRAQLAES--------DIEMMIGASAD----------
PNP_SULMW       VSTVRIIRINDA------FIINPGIEEIKKSDFYLDLDLDLDLIVGGTNN----------
PNP_CHLPD       MSEVRVGRINGE------FIVNPNINELQGS--------DIDICIGGTAN----------
PNP_CHLTE       MSEVRVGRINGL------FIVNPDINELAQS--------DMDICIGGTED----------
PNP_PELLD       MSEVRVGRVNGL------FIINPTIDELEGS--------DIDISIGGTAD----------
PNP_CHLCH       MSEVRVGRVNGL------YIINPDVNELKES--------DIDMCIGGTND----------
PNP_SALRD       FAEVRVGRVDGD------YIVNPTMQQTEES--------DIDLVVAGKED----------
PNP_KORVE       IGAVRVGLIEGQ------NIVNPTYDEMRAS--------KLNIMVVGTAE----------
PNP_SOLUE       MAGVRVGMRDGQ------YTANPTYTEGRAS--------KLNIVVAGTEE----------
PNP_RHOBA       LGSVRVGKVDGK------LVAFPTADQLEQS--------ELDMIVSGSRD----------
PNP_ECOLI       IGAARVGYINDQ------YVLNPTQDELK--------ESKLDLVVAGTEAA---------
PNP_PHOPR       IGAARVGFINDQ------FVLNPSNTELE--------ESRLDLVVSGTKDA---------
PNP_HAEDU       IGAARVGFINDQ------FVLNPTITEQK--------QSRLDLVVAGTDKA---------
PNP_COLP3       VGAARVGYTDGQ------YILNPLQSELP--------TSQLDLVVSGTDSA---------
PNP_PSYIN       IGCARVGYKEGE------YLLNPTKTELE--------TSDLNLVVSGTDNA---------
PNP_PSEA6       VGAARVGYTDGQ------YVLNTRTSELE--------ISQLDLVVAGTKGA---------
PNP_AERS4       IAAARVGYMNGQ------YVLNPTTAELP--------QSDLDLVVAGTANA---------
PNP_SHELP       LGSARVGYVDGE------YILNPTVSQLE--------NSQLELSVAGTENA---------
PNP_IDILO       IGAARVGVVNDE------YVLNPTADELE--------NSKLDLVVAGTDKA---------
PNP_PSEHT       IGATRVGYIDGE------YVLNPTLKELE--------ESKLDLVVAGTDNA---------
PNP_BUCAP       IGAARVGFVNNQ------YVLNPTIDDMK--------SSFLDLVVSGTQNA---------
PNP_BUCBP       IGAARIGYINNQ------YILNPNVNEIK--------SSSLDLIISGTEES---------
PNP_BUCCC       IGAARIGFLNNK------YILNPSIEKIK--------KSSLDLVVSGTKNT---------
PNP_WIGBR       IGSSRIGYIDNK------YILNPTTSELI--------DSKLDMIVSGSSNA---------
PNP_BLOFL       IGAARVGYIKDQ------YILNPTTIELS--------NSKLDLVVAGTDSN---------
PNP_BLOPB       IGAARVGYIKNQ------YVLNPTTTELS--------NSKLDLVISGTESN---------
PNP_BAUCH       FGAARVGYINNQ------YVLNPTIAELV--------DSSLDLVVASTANA---------
PNP_NEIG1       IGAARVGYINGV------YVLNPTKAELA--------KSQLDLVVAGTSKA---------
PNP_CHRVO       IGAARVGYANGE------YILNPTKTELQ--------TSQMDLVVAGTSRA---------
PNP_METFK       IGAARVGYINGE------YVLNPTASQLK--------ETALDLVVAATESA---------
PNP_THIDA       VGAARVGFINGE------YVLNPTNAELK--------DSALDLVVAGTESA---------
PNP_NITEC       IGAARVGYIDNE------YVLNPTTTQLN--------KSQLNLVVAGTQKA---------
PNP_NITMU       IGAARIGYINGE------YVLNPDTSALK--------QTQLNLVVAGTRQA---------
PNP_VEREI       IGAARVGYIQGE------YRLNPGPTARK--------SSQLDLVVAGTEAA---------
PNP_METPP       IGAARVGYINGE------YVLNPGPTQLA--------DSKLDLIVAGTEAA---------
PNP_BORA1       IGAARVAYVEGQ------YLLNPTASQLK--------SSKMDLVVAGTENA---------
PNP_JANMA       VGAARVGYIDGQ------YVLNPTTSQLA--------KSDLDLVVAGTEIA---------
PNP_RALSO       VGAARVGYKDGQ------YLLNPNRAQLA--------HSDLDLVVAGTERA---------
PNP_POLAQ       VGAARVGYANGQ------YLLNPTRTEQA--------TSELDLIVAGTQAA---------
PNP_PARXL       VGAARVAYINNE------YVLNPTRPQMK--------ESALDLIVAGTERA---------
PNP_DECAR       IGAARVGYIDGQ------YVLCPTLSQLK--------GSQLDLVVAGTEAA---------
PNP_AROAE       IGACRVGYSGGQ------YLLNPTVEQLK--------ASELNLVVAGTEAA---------
PNP_ALKEH       IGAARVGYKDGE------YLLNPTFEETA--------ASDLDLVVAGTENA---------
PNP_HALHL       IGACRVGHLDGE------FVLNPTFSQTA--------ESDLDLVVAGTQDA---------
PNP_METCA       IGAARVGFVNGA------YVLNPDGSVVE--------GSELDLVVAGTANA---------
PNP_NITOC       IAAARVGYIDGQ------YVLNPTLGQME--------KSALDLVVAGTEKA---------
PNP_XYLFT       IGAAKVGYNDGQ------YILNPTVSELK--------KSQLELVVAGTANA---------
PNP_COXBR       LGAARVGYRGGE------YLLNPSLDELK--------DSALDLVVAGTRDA---------
PNP_DICNV       IAAARVGYVNDA------YVLNPSPKALK--------NSRLDLVVAGTESA---------
PNP_PSEU5       IGAARVAFHPETG-----YLLNPNYEQLK--------ASSLDMVVAGTKDA---------
PNP_SACD2       IGAARVGYTQESG-----YLLNPTYSTLK--------TSELDMVVAGTADA---------
PNP_HAHCH       LAAARVGYTDEDG-----YLLNPGFKAIE--------NSKLDMVVAGTEDA---------
PNP_MARHV       IGAARVGYTNEKG-----YFLNPTFEELS--------TSLLDMVVAGTDEA---------
PNP_CHRSD       IGAARVGFNEDKG-----YFLNPTVEELE--------SSELNMVVAGTEKA---------
PNP_ALCBS       IGAARVGYKDGM------YILNPSYSELA--------ESALDLVVAGTEPA---------
PNP_ACIAD       IGGARVGLINGE------YVLNPNFEQLA--------QSDLDLVVAGTESA---------
PNP_PSYWF       IGGARVGFINGE------YVLNPSIEELK--------SSDLDLVVAGTKSA---------
PNP_HYDCU       IGAAVVGYKDND------YILNPSSQELQ--------ESDLELSVAGTSDA---------
PNP_LEGPA       IGAARVGYKDGV------YLLNPSRKEQE--------ESKLDLVIAGTKDA---------
PNP_VESOH       IGGSRVGYSNGE------YILNPTYIELT--------NSDLDMVVAGTDEA---------
PNP_FRATW       VAGVRVGYTNGK------YILNPNKQDLR--------DSDLDLVVSGTDDA---------
PNP_GRABC       VAASRVGLVN-GA-----FVLNPTLEQRA--------ESKLDLVVAGTAEG---------
PNP_ACICJ       VGAARIGYID-GE-----YILNPTSAQIA--------ESRLDLVLAGTEEG---------
PNP_GLUOX       VACARIGRID-GK-----LVVNPTHDEIK--------DSTLDLMVAGTAEG---------
PNP_MAGSA       VGAARVGYVD-GA-----YVLNPLVGDLP--------KSELDLVVAGTVEG---------
PNP_RHORT       IGAARVGLID-GA-----FVLNPTRDQMA--------DSVLDLVVAGTREG---------
PNP_CHESB       VGAARVGYVG-GE-----YILNPHLDEMA--------ETKLDLVVAGTSDA---------
PNP_BARBK       IAGARVGYCN-GH-----YVLNPTLDEMP--------ESKLDLVVAGTENA---------
PNP_NITHX       IGAARVGFMN-DE-----YVLNPTLDEMV--------DTQLELVVAGTADA---------
PNP_AZOC5       IGGARVGFVG-DE-----YVLNPTIEELK--------DSALDLVVAGTSDA---------
PNP_PARL1       IGAARVGYIG-GE-----YKLNPMIDEMP--------ESALDLVVAGTADA---------
PNP_MARMM       IGAARVGYKD-GE-----YVINPPCDEMD--------DSELDLVVAGTQDA---------
PNP_CAUVC       IGAARVGWVD-GA-----YVLNPTLDEMK--------ESKMDLVVAGTADA---------
PNP_HYPNA       IGAARVGYKD-GQ-----YIINPTIAELE--------ESELDLVVAGTTDA---------
PNP_PARDP       IAAARVGFAD-GE-----YVLNPEVQDMDHLRLNP--EQRLDLVVAGTRDA---------
PNP_SPHAL       IGAARVGYLN-GE-----YILNPT-DEQVA-------EGDLDLVVAATHDA---------
PNP_NOVAD       IAAARVGFIE-GE-----YVLNPKQDVALA-------DGRLDLVVAATDTA---------
PNP_ERYLH       IGAARVGFTNDGE-----YVLNPSVVDALGE------DGNLDLVVAATQDA---------
PNP_ZYMMO       IGAARVGYQD-GE-----FILNPTLEQLEK--------SDLDLVVGATRDA---------
PNP_PELUB       VGASRVGLVD-GK-----YILNPSKAELE--------NSTLDLVVAGTKDA---------
PNP_MAGMM       IGGARVGFID-GK-----PVLNPTVDQLA--------ASRLDLVVAGTRSA---------
PNP_RICTY       VAASKVGLINGE------FVLNPTL-ELLKT-------SQLDLVVAGTKDS---------
PNP_ORITB       IGAARVGIVNDE------FILNPVIHDNTGV-------NELDLVVAATFDS---------
PNP_ANAMM       IAGAKIGYIREEER----YILNPSA-EELAR-------SELDMFYSGTKSS---------
PNP_ANAPZ       VAGARIGYIRGEGR----YILNPSA-DELSV-------SALDMFYARTDTS---------
PNP_EHRRW       VVGARVGYLLSEDK----YLLNASA-DEMLS-------SSLDLFLSGNKDS---------
PNP_WOLTR       IAGVLVGCD-GNNN----YILNPSV-QEMKV-------SSLDLFLSGDERS---------
PNP_NEOSM       VIGVDVDMRGSE--------VTCNE-IRETE-------GGLELFVACTEES---------
PNP_CHLCV       VAGVRVGFVNNS------WVVNPTKAEMD--------VSRMELVLAGTENA---------
PNP_CHLPN       VAGVRIGCIDNQ------WVINPTKTELA--------SSTLDLVLAGTENA---------
PNP_CHLMU       VAGVRVGLVEGK------WVVNPTKDELD--------ASKLDLVMAGTASA---------
PNP_PARUW       VGAVRIGFIDAQ------FIVNPTIEQQK--------QSKLDLLIAGTEEA---------
PNP_BACCN       IAGATVGR-ID-----GEFIINPTVEQQE--------KSDIHLVVAGTKDA---------
PNP_GEOTN       IAGVIVGR-ID-----GQFVINPTVEQME--------KSDMHLIVAGTKDA---------
PNP_OCEIH       IAGVNVGR-VD-----GEFIINPTIEQEA--------KSDIELTVAGTKDA---------
PNP_BACHD       IAGVTVGR-ID-----GQFVINPTQDQLE--------KSDIHLVVAGTKDA---------
PNP_BACSK       IAGVTVGR-IN-----GEFIMNPTPAQLA--------ESDIDLTVAGTKEA---------
PNP_LISIN       IAGVDVGR-ID-----GKYVINPTIEQAE--------KSDISLTVAGTYDA---------
PNP_ENTFA       IAGVDVGR-IN-----GEYVLNPTVEQAE--------QTDIELTVAGTKEA---------
PNP_STAS1       IAGVKVGY-ID-----GEYVINPTVAQKE--------VSRLDLEVAGHKDA---------
PNP_STRMU       IAGVQVAY-LD-----GQYVINPTAEEKK--------ASLLELTVAGTKEA---------
PNP_STRTD       IAGVQVAY-AA-----EDFIINPSASDKE--------VSHLDLIVAGTKEA---------
PNP_LACLA       IAGVEVAY-ID-----GEYIINPTVAEKE--------ASSLELSVAGNINA---------
PNP_SPICI       VAGALVTVDQK-----NNIIINPTLEQIN--------DGQMELIVAGTDEA---------
PNP_ONYPE       ISGVYVGK-IN-----DKFIINPTLQQLA--------NSTLHLMVAGTKHN---------
PNP_ACHLI       IAGAHVGR-ID-----GQFVLNPSSEQLN--------VSDIDLIVAGTKDA---------
PNP_FUSNN       VASVIVGY-KN-----GEFILNPSPKELE--------ESELDLIVAGTKEA---------
PNP_TRIV2       MAAVRVGLVG------DDFIINPTYAEIE--------AGDLDLVVAGSPHG---------
PNP_TRIEI       MAAVRVGLVG------DDFIINPTYREVK--------NGDLDLVVAGSPQG---------
PNP_ACAM1       MAAVRVGLVG------DDFIINPTYEEIS--------EGELDLVVAGSPDG---------
PNP_SYNE7       MAAVRVGLVG------DDFIINPTYREIE--------KGDLDLVVAGTPAG---------
PNP_SYNY3       MAAVRVGLVG------DDFIINPTYREVH--------NGDLDLVVAGTPAG---------
PNP_THEEB       MAAVRVGLVG------DEFVINPTYKEIE--------RGGLDLVVAGSPDG---------
PNP_PROMA       MAAVRVGLLG------DDFVLNPSFREIE--------RGDLDLVVAGTPDG---------
PNP_PROMP       MAAVRVGLIG------DDFILNPSYREIE--------KGDLDIVVAGSPEG---------
PNP_SYNR3       MAAVRVGLLG------DDFILNPSYREIE--------RSELDLVVAGTAEG---------
PNP_SYNJA       VAAVRVGLVK------DEFIINPTYAEIE--------AGDLDLVVAGCADG---------
PNP_GLOVI       VAATRVGLMG------DDFIINPTYKEIE--------EGELDLVVAGTKNG---------
PNP_DEHM1       VGASRVGYTN------GEFVLNPTFAQLE--------QSQMDLVVVSTRKA---------
PNP4_ALKMQ      TGSVNVGLVN------GEFVLNPTSDQRA--------ISDIDLVVSGTKDA---------
PNP_ALKOO       TASVHVGLVD------GKLLINPTSDERE--------HSSLDLVVSGTKDA---------
PNP3_ALKMQ      TASVSVGMID------GEYIVNPTSKQKE--------DSTLELIVSGTKNA---------
PNP_CLOD6       TGSVCVGLVD------GAFVVNPNAEQRE--------KSSMHLVVSGTKEA---------
PNP_CALS8       TGSVLVGYVD------GKIVINPTAKERE--------VSKLHLVVSGTKDK---------
PNP_CALS4       TGSVAVGLVD------GKFVINPTYEQRE--------KSLMHLVVSGTKDA---------
PNP_CLOPS       VAAVQVGLIG------EEFILNPTSKERE--------ESSLQLTVCATKER---------
PNP_CLOB8       AAAVQVGIID------GKFVTNPDTQGRE--------KSILHLTVCATKER---------
PNP_CLOBL       VAAVSVGLVD------GEFIINPTVAQRE--------NTILDLTVCATKER---------
PNP_CLOTE       VANVSVGLIN------GDFILNPTQSQRE--------ESILNLTVSATKER---------
PNP_CLONN       VGTVSVGLID------GEFIINPTSKQRE--------ESILDLTVCATKDR---------
PNP_CLOAB       VATVSVGCID------GKFVLNPTLEERE--------KSSLDLTVCATNER---------
PNP_LACP7       CATTQVGLVD------GELVFNPTAAQKA--------VSDLALTVASTRDK---------
PNP_HUNT2       VGAVILGLID------GEVIINPTEKQKE--------ISQMYVTLAGTRNK---------
PNP_CARHZ       IGAVVVGLVE------DELVINPTIEQAE--------KSRLHLVVAGTRDA---------
PNP_MOOTA       IGAVSVGLID------NRPVINPTLEEDS--------RSSLNLTVAGTANA---------
PNP_DESRM       IGGVIVGRVD------GQFVINPMVRQAE--------NSDMHLVVAGTDDA---------
PNP_PELTS       IGGVIVGRVD------GRFVINPVLAQAE--------KSDMHLVVAGTKDA---------
PNP_DESHY       VAAVTVGLIG------DEFIINPTVEQSE--------KSVMHLTVAGTKDA---------
PNP_SYNWW       VAAVIVGLVD------GELIINPTVEQHQ--------KSDLHLAVAGTKEA---------
PNP_SYMTH       IGGVIVGLVD------GQFVINPTAEQQE--------RSEMHLVVAGTEHA---------
PNP_CHLAA       VGAVQMGHLN------GQLVVNPKMNEIA--------DSRLDLVVAGTKDA---------
PNP_ROSS1       VGAVQVGYID------GKVQINPEMPDMP--------NSDLDLVVAGTKDA---------
PNP_DEIRA       TACVRVGQID------GQYVVNPTTEQLT--------RSRMDLVVAGTRE----------
PNP_THET8       IAAVRVGLIG------GSFVLNPTLQELE--------ESQLDLVVAGSKE----------
PNP_RENSM       IGGVRVALIE------DQWVAFPRHSEME--------KAVFNMVVAGRVA----------
PNP_KINRD       IGGVRIALID------GQWVAFPRYSELE--------RAVFDMVVAGRVVTTA-------
PNP_STRAT       YGGVRVALIR------GQWVAFPTHTELE--------DAVFDMVVAGRVLE---------
PNP_NOCSJ       VGGVRVALIE------GQWVAFPTHSQLE--------NAVFDMVVAGRVTE---------
PNP_ACIC1       IGGVRMAHID------GTWVAFPTYSELE--------RATFDMVVAGRVLP---------
PNP_CUTAK       IGGVRMALID------DQWVCFPSVDQRK--------ESTFDMVVAGRVLA---------
PNP_FRACC       IGATRVGFVD------GEWIAFPTHAELA--------RATFDMVVAGRVIE---------
PNP_THEFY       IGGVRVALVE------GQWVAFPTHSELA--------NATFDMVVAGRVLD---------
PNP_RHOJR       VGGVRVALITSDENKAGQWVAFPTVEQLE--------NAVFDMVVAGRIVSGS-------
PNP_SACEN       VGGTRMALID------GQWVAFPTYEQLE--------RAVFDMVVAGRIVGD--------
PNP_SALTO       IGATRMAHID------GSWVAFPTHEELV--------RATFDMVVAGRALPD--------
PNP_COREF       VGGVRMALIADENHPEGQWVAFPTAEQQK--------ASVFELVVAGRLVE---------
PNP_CORDI       VGGVRMALIADDAHPKGQWIAFPTHEQHE--------QALFELVVAGRIVS---------
PNP_CORJK       VGGVRMALVVDSDHPEGQWVAFPTREQEE--------KAIFELVVAGRVTEPVKPARGRG
PNP_LEIXX       IAGVRLALIPGNGAHEDQWVAFPKASQLE--------EAVFDLIVVGRVLTNED------
PNP_TROWT       IGGVRLALIDG------QWVAFPRYEDLS--------GAVFDLTVAGRVFVNES------
PNP_BIFLO       VSGVRLALID------GQWVAFPRWSERE--------RAVFEIVVAGRVIE---------
PNP_RUBXD       IGAVRVGRHPD-----GGFILNPTYQQLE--------ESDLDIVVAGTKEA---------
PNP_LEPIC       IAGARIGRVNGE------LILNPTTKEIL--------NSDLDLVVAGTKTH---------
PNP_NITSB       VSGLRVAKVDGE------VLFNPPLSKLK--------ESTLDLYLAGTKEE---------
PNP_WOLSU       VHGLRIGKINGA------LVVNPTTKEMS--------ESTLDLFVSGVEED---------
PNP_SULDN       VSAIRVAKIDGE------LILNPTLSELD--------KSTLDLYLSGTKED---------
PNP_ARCB4       VCGVRVGKIENT------LVINPTNEQLE--------NSTLDLYVAGSKEE---------
PNP_CAMC5       VCGVRVGYIDDK------FVINPSNSELK--------SSALDLYVAGTKDE---------
PNP_CAMFF       VCGVRVGHINGK------FVINPSNSELK--------NSALDLYVAGVKDE---------
PNP_CAMHC       VCGVRVGYINDS------FVINPTNSELQ--------NSALDLYVAGVKDE---------
PNP_CAMJD       VCGVRIGKIDGN------FILNPNNEELQ--------NSTLDLYVAGVKDE---------
PNP_HELHP       VSGVRIGRKDGH------FIINPTMEQLS--------ESELNLFVSGRDDE---------
PNP_HELPH       VSACRIARIGNE------FIINPNTSLLN--------QSSLDLFVSGTKES---------
PNP_HELAH       VSACRIARIDNE------FIINPSTSLLN--------QSSLDLFVSGTKES---------
PNP_HELPJ       VSACRIARVDNE------FIINPSASLLN--------QSSLDLFVSGTKES---------
PNP_SULNB       IAAVRVGKIEDE------LVLNPTLSQQD--------ESVLDLLVVGSEQD---------
                     :                                  : :                 

PNP_FERNB       ---------------ITMVEG--------------------------------EAKEVTE
PNP_THEM4       ---------------ITMVEG--------------------------------EAKEVTE
PNP_THEP1       ---------------VTMVEG--------------------------------EAKEVAE
PNP_PSELT       ---------------ITMVEG--------------------------------EAKEVSE
PNP_PETMO       ---------------VTMVEG--------------------------------ESLEVSE
PNP_AQUAE       ---------------IVMVEG--------------------------------GGKEIPE
PNP_TREDE       ---------------ITMVEG--------------------------------GANEVSE
PNP_TREPA       ---------------ITMVEG--------------------------------GAREVSE
PNP_BORBU       ---------------ITMVEG--------------------------------GANEVGE
PNP_DESVV       --------------AVVMVEG--------------------------------EASFVPE
PNP_DESAG       --------------ALVMVEG--------------------------------EADFVPE
PNP_LAWIP       --------------AVVMVEG--------------------------------EANVVEE
PNP_SYNFM       --------------AVVMVEG--------------------------------GADFVSE
PNP_ANADF       --------------AIVMVEG--------------------------------GAKEVSE
PNP_MYXXD       --------------AIVMVEG--------------------------------GAEEVSE
PNP_SORC5       --------------AIVMVEG--------------------------------GAAEATE
PNP_GEOUR       --------------AVIMVEG--------------------------------SAAEVSE
PNP_PELPD       --------------AIIMVEG--------------------------------EARFVSE
PNP_PELCD       --------------AIIMVEG--------------------------------ETRFISE
PNP_SYNAS       ------------DVNLVMLEG--------------------------------EAQQVEE
PNP_DESPS       --------------AIVMVEG--------------------------------KADELSE
PNP_BDEBA       --------------GLLMVEG--------------------------------ETKFISE
PNP_BACV8       --------------NIMMVEG--------------------------------EMQEVSE
PNP_PORGI       --------------NIMMVEG--------------------------------EMDEVQE
PNP_CYTH3       --------------NVIMVEG--------------------------------EMSEVSE
PNP_FLAPJ       --------------SIAMVEG--------------------------------EMKEISE
PNP_GRAFK       --------------SVMMVEG--------------------------------EMDEISE
PNP_SULMW       --------------YIILVEG--------------------------------EMREISE
PNP_CHLPD       --------------TICMLEG--------------------------------EMKEISE
PNP_CHLTE       --------------TICMLEG--------------------------------EMKEISE
PNP_PELLD       --------------TICMLEG--------------------------------EMKEISE
PNP_CHLCH       --------------TICMLEG--------------------------------EMNEISE
PNP_SALRD       --------------ALVMVEG--------------------------------EAEEISE
PNP_KORVE       --------------GIVMIES--------------------------------GAHEATE
PNP_SOLUE       --------------GIVMVEA--------------------------------GAQEVSE
PNP_RHOBA       --------------MVAMIEG--------------------------------FANEMPE
PNP_ECOLI       ---------------VLMVES--------------------------------EAQLLSE
PNP_PHOPR       ---------------VLMVES--------------------------------EADRLSE
PNP_HAEDU       ---------------VLMVES--------------------------------EADILSE
PNP_COLP3       ---------------VLMVES--------------------------------EADVLSE
PNP_PSYIN       ---------------VLMVES--------------------------------EAGILSE
PNP_PSEA6       ---------------VLMVES--------------------------------EAEVLSE
PNP_AERS4       ---------------VLMVES--------------------------------EAAILSE
PNP_SHELP       ---------------VLMVES--------------------------------EADALPE
PNP_IDILO       ---------------VLMVES--------------------------------EAQLLSE
PNP_PSEHT       ---------------VLMVES--------------------------------EADVLAE
PNP_BUCAP       ---------------VLMVEA--------------------------------ESKVLSE
PNP_BUCBP       ---------------VLMVEA--------------------------------EANMLTE
PNP_BUCCC       ---------------IFMVEA--------------------------------EASILSE
PNP_WIGBR       ---------------VLMVES--------------------------------SSNILQE
PNP_BLOFL       ---------------ILMVES--------------------------------AACVLSE
PNP_BLOPB       ---------------ILMVES--------------------------------ESCLLSE
PNP_BAUCH       ---------------VLMVES--------------------------------EAKQLSE
PNP_NEIG1       ---------------VLMVES--------------------------------EAKILPE
PNP_CHRVO       ---------------VLMVES--------------------------------EAKELPE
PNP_METFK       ---------------VLMVES--------------------------------EAKELPE
PNP_THIDA       ---------------VLMVES--------------------------------EAMELPE
PNP_NITEC       ---------------VLMVES--------------------------------EANELSE
PNP_NITMU       ---------------VLMVES--------------------------------DAMELSE
PNP_VEREI       ---------------VLMVES--------------------------------EAQQLSE
PNP_METPP       ---------------VLMVES--------------------------------EADQLPE
PNP_BORA1       ---------------VLMVES--------------------------------EAQQLSE
PNP_JANMA       ---------------VLMVES--------------------------------EAKQLSE
PNP_RALSO       ---------------VLMVES--------------------------------EANQLSE
PNP_POLAQ       ---------------VLMVES--------------------------------EANQLSE
PNP_PARXL       ---------------VLMVES--------------------------------EAQQLSE
PNP_DECAR       ---------------VLMVES--------------------------------EADQLSE
PNP_AROAE       ---------------VLMVES--------------------------------EARELSE
PNP_ALKEH       ---------------VLMVES--------------------------------EANQLPE
PNP_HALHL       ---------------VLMVES--------------------------------EANLLPE
PNP_METCA       ---------------VLMVES--------------------------------EAKILPE
PNP_NITOC       ---------------VLMVES--------------------------------EAQELPE
PNP_XYLFT       ---------------VLMVES--------------------------------EAALLSE
PNP_COXBR       ---------------VLMVES--------------------------------EAQELPE
PNP_DICNV       ---------------VLMVES--------------------------------EADQLSE
PNP_PSEU5       ---------------VLMVES--------------------------------EAKELTE
PNP_SACD2       ---------------VLMVES--------------------------------EAKELPE
PNP_HAHCH       ---------------VLMVES--------------------------------EAKELTE
PNP_MARHV       ---------------VLMVES--------------------------------EAKGLTE
PNP_CHRSD       ---------------VLMVES--------------------------------EAKELLE
PNP_ALCBS       ---------------VLMVES--------------------------------EAQELSE
PNP_ACIAD       ---------------VLMVES--------------------------------EAKELSE
PNP_PSYWF       ---------------VLMVES--------------------------------EAAELSE
PNP_HYDCU       ---------------VLMVES--------------------------------EASELSE
PNP_LEGPA       ---------------ILMVES--------------------------------EAQELSE
PNP_VESOH       ---------------VLMVES--------------------------------EANELSE
PNP_FRATW       ---------------ILMVES--------------------------------EANSLPE
PNP_GRABC       ---------------VLMVES--------------------------------EAEELSE
PNP_ACICJ       ---------------VLMVES--------------------------------EAHELSE
PNP_GLUOX       ---------------VLMVES--------------------------------EASELSE
PNP_MAGSA       ---------------VLMVES--------------------------------EAKQLSE
PNP_RHORT       ---------------VLMVES--------------------------------EAHELSE
PNP_CHESB       ---------------VLMVES--------------------------------EAHELPE
PNP_BARBK       ---------------VLMVES--------------------------------EAHELSE
PNP_NITHX       ---------------VLMVES--------------------------------EAKELSE
PNP_AZOC5       ---------------VLMVES--------------------------------EAKELSE
PNP_PARL1       ---------------VMMVES--------------------------------EAKELSE
PNP_MARMM       ---------------VMMVES--------------------------------EAKELSE
PNP_CAUVC       ---------------VMMVES--------------------------------EIQELSE
PNP_HYPNA       ---------------VMMVES--------------------------------QAAELSE
PNP_PARDP       ---------------VMMVES--------------------------------EAYELTE
PNP_SPHAL       ---------------VMMVES--------------------------------EANELSE
PNP_NOVAD       ---------------VMMVES--------------------------------EAKELSE
PNP_ERYLH       ---------------VMMVES--------------------------------EAKELTE
PNP_ZYMMO       ---------------VMMVES--------------------------------EANELPE
PNP_PELUB       ---------------VLMVES--------------------------------ETSGLTE
PNP_MAGMM       ---------------VTMVES--------------------------------EVDFLSE
PNP_RICTY       ---------------VMMVES--------------------------------EAHLLSE
PNP_ORITB       ---------------VTMIEA--------------------------------QACEIDE
PNP_ANAMM       ---------------VVMVES--------------------------------EASELSE
PNP_ANAPZ       ---------------ILMVES--------------------------------EAHELTE
PNP_EHRRW       ---------------VLMVES--------------------------------EASELSE
PNP_WOLTR       ---------------ILMVES--------------------------------EAKELPE
PNP_NEOSM       ---------------VVMVEA--------------------------------EASEASE
PNP_CHLCV       ---------------ILMIEG--------------------------------HCDFLTE
PNP_CHLPN       ---------------ILMIEG--------------------------------HCDFFTE
PNP_CHLMU       ---------------VLMIEG--------------------------------HCDFLTE
PNP_PARUW       ---------------VLMIEG--------------------------------FCDFLTE
PNP_BACCN       ---------------INMVEA--------------------------------GADQVPE
PNP_GEOTN       ---------------INMVEA--------------------------------GADEVPE
PNP_OCEIH       ---------------INMVEA--------------------------------GANEVPE
PNP_BACHD       ---------------INMVEA--------------------------------GAEEVPE
PNP_BACSK       ---------------INMVEA--------------------------------GAKEVPE
PNP_LISIN       ---------------INMVEA--------------------------------GAKEVSE
PNP_ENTFA       ---------------INMVES--------------------------------GAKEVSE
PNP_STAS1       ---------------VNMVEA--------------------------------GASEITE
PNP_STRMU       ---------------INMVES--------------------------------GAKELSE
PNP_STRTD       ---------------INMVEA--------------------------------GAQELSE
PNP_LACLA       ---------------INMVES--------------------------------GAKELSE
PNP_SPICI       ---------------INMVEA--------------------------------GAKEVSE
PNP_ONYPE       ---------------VTMIEA--------------------------------HANEVSE
PNP_ACHLI       ---------------INMVEA--------------------------------GAKQVSE
PNP_FUSNN       ---------------VNMVEA--------------------------------GAKELDE
PNP_TRIV2       ---------------VIMVEA--------------------------------GANQLPE
PNP_TRIEI       ---------------VIMVEA--------------------------------GANQLPE
PNP_ACAM1       ---------------VIMVEA--------------------------------GANEVAE
PNP_SYNE7       ---------------VIMVEA--------------------------------GANQLPE
PNP_SYNY3       ---------------IVMVEA--------------------------------GANQLPE
PNP_THEEB       ---------------VVMVEA--------------------------------GANELPE
PNP_PROMA       ---------------VVMVEA--------------------------------GSNQLTE
PNP_PROMP       ---------------IVMIEA--------------------------------GANQLSE
PNP_SYNR3       ---------------VVMVEA--------------------------------GAQQLPE
PNP_SYNJA       ---------------VIMVEA--------------------------------GANQLPE
PNP_GLOVI       ---------------IMMVEA--------------------------------GANCLPE
PNP_DEHM1       ---------------VVMIEA--------------------------------GSKEIPE
PNP4_ALKMQ      ---------------IMMIES--------------------------------GANEVTE
PNP_ALKOO       ---------------VMMIEA--------------------------------GANEVTE
PNP3_ALKMQ      ---------------IMMIEA--------------------------------GANELTE
PNP_CLOD6       ---------------IMMVEA--------------------------------GADEVPD
PNP_CALS8       ---------------VMMIEA--------------------------------GAQEIPE
PNP_CALS4       ---------------IVMVEA--------------------------------GAKEVPE
PNP_CLOPS       ---------------VMMIEA--------------------------------GGDEIPE
PNP_CLOB8       ---------------VMMIEA--------------------------------GGQEIPE
PNP_CLOBL       ---------------IMMVEA--------------------------------GGQEIDE
PNP_CLOTE       ---------------VMMIEA--------------------------------GAEEVDE
PNP_CLONN       ---------------VMMIEA--------------------------------GGEEIPE
PNP_CLOAB       ---------------VMMLEA--------------------------------GADEIPE
PNP_LACP7       ---------------VIMIEA--------------------------------GANEVPE
PNP_HUNT2       ---------------IVMIEA--------------------------------GANEVPD
PNP_CARHZ       ---------------VMMVEA--------------------------------GAQEVPE
PNP_MOOTA       ---------------IMMVEA--------------------------------GAKEVPE
PNP_DESRM       ---------------VMMVEA--------------------------------GAKEVPE
PNP_PELTS       ---------------VMMVEA--------------------------------GAKEVPE
PNP_DESHY       ---------------VMMVEA--------------------------------GAQEVPE
PNP_SYNWW       ---------------IMMVEG--------------------------------GANEVPE
PNP_SYMTH       ---------------VLMVEA--------------------------------GAKEVPE
PNP_CHLAA       ---------------VLMVEA--------------------------------GAYELTE
PNP_ROSS1       ---------------VLMVEA--------------------------------GAKELPE
PNP_DEIRA       --------------AVMMVEC--------------------------------GAQTVSE
PNP_THET8       --------------AILMVEA--------------------------------EAGEVDE
PNP_RENSM       ----------GDDVAIMMVEAEATDNSWNLI-------------------KENGATAPTE
PNP_KINRD       --------DGSQDVAIMMVEAEATEGSWNLI-------------------KDQGATAPTE
PNP_STRAT       ----------DGDVAIMMVEAEATEKTVQLV-------------------KD-GAEAPTE
PNP_NOCSJ       ----------TGDVAIMMVEAEATEQTWDLV-------------------RS-GTQAPTE
PNP_ACIC1       ----------DGDVAIMMVEAEATEETIPLI-------------------RE-GAPAPTE
PNP_CUTAK       ----------DGDVAIMMVEAESTPATWGLV-------------------RG-GRTAPTE
PNP_FRACC       ---------DGSDVAIMMVEAEATPGTVELL-------------------AH-GAPAPTE
PNP_THEFY       ---------NG-DVAIMMVEAESTPHTLRLV-------------------AE-GAIGPNE
PNP_RHOJR       --------GDDADVAIMMVEAEATDNVISLI-------------------DG-GAQAPTE
PNP_SACEN       ------------DVAIMMVEAEATEKTAGLV-------------------SA-GAQAPTE
PNP_SALTO       -----------GDVAIMMVEAEATAHTAKLV-------------------AD-GASAPTE
PNP_COREF       RKRGN---KTFSDVAVMMVEAGASENVVERI-------------------KE-GAPAPTE
PNP_CORDI       KKQGK---KTVDDVAIMMVEAGATEQVVDRV-------------------KA-GAPAPTE
PNP_CORJK       RGRGKGAGSSEPNVAVMMVEAGATDNVVERI-------------------AE-GAPAPTE
PNP_LEIXX       --------GTEGDVAIMMVEAEATEGSWNLI-------------------QG-GAVKPNE
PNP_TROWT       --------GKE-DIAIMMVEAEATESAWDLI-------------------HSHGAKKPNE
PNP_BIFLO       ----------NGDVAIAMIEAGAGKNAWHLI-------------------YDEGQTKPDE
PNP_RUBXD       ---------------ITMVEA--------------------------------GAREVTE
PNP_LEPIC       ---------------IVMIEG--------------------------------EAKELSN
PNP_NITSB       ---------------LLMIEMAAIGSYKTEV-VPTTVDPLMDPTLAEEVITIKEPNAMKE
PNP_WOLSU       ---------------LLMIEMRTLASDEINN-TCFVGDCGMVAASASDILKIHQANEMKE
PNP_SULDN       ---------------LLMIEMRSKGGIKVD--TNLMIDPLMDPTLSSAIIATHVSNAVPE
PNP_ARCB4       ---------------LLMIEMKTIS------------SSELVEIDIEAFTKIHNTNEMDE
PNP_CAMC5       ---------------LLMIEMRSIAQQSSQIIPIIAIDPMMDPSLNDSITQKQDMNEFSE
PNP_CAMFF       ---------------LLMIEMRSLPNEQNEIVPVIAIDPMMDPSLNEGFVSRQKMNEFSE
PNP_CAMHC       ---------------MLMIEMRSLPNMNG---------------------ENQNMNEFSE
PNP_CAMJD       ---------------LLMIEMRALPDQKENEIFIEAPYADVLTQ-----TTSQNMNELSE
PNP_HELHP       ---------------LLMIEMKSIR-------------------------TAQGANELSE
PNP_HELPH       ---------------LNMIEMRSLG---------------------------QQLNALEE
PNP_HELAH       ---------------LNMIEMRSLG---------------------------QKLNALEE
PNP_HELPJ       ---------------LNMIEMRSLG---------------------------QKLNALEE
PNP_SULNB       ---------------IIMIEMRAIASEKIDDIEMDMIDPMMGGVPL--ILEHQECNEVDN
                               : ::*                                       :

PNP_FERNB       EEMLQALMTAHEAIKQ-IVAFQEEVIKEFNV-----EKMPLPEPK--------------Y
PNP_THEM4       EEMVQALMVAHEAIKK-LIEFEEEILREFNV-----EKMEIEEPK--------------P
PNP_THEP1       EDMVKALRFAHSVIKE-LVDFQEEILSEFNV-----EKIPVVEPT--------------P
PNP_PSELT       SQMLQALLKAHDAIKQ-IIDFEKEILSYFNI-----EKAQIAEKT--------------L
PNP_PETMO       EEMVEALMFAQEKIKE-IIAIEEEFLSELNI-----EKWEVQKEI--------------V
PNP_AQUAE       EVLADALFFGLDAIKE-VIEAQERLREKVGK-----PKFEYQKVE--------------L
PNP_TREDE       EVMLTALEKAHEMIKS-LCKMQEDLRELAGK-----EKLPLVPLE--------------A
PNP_TREPA       DLMLGALEQAQEHIKA-LCDMQERLRGLCGK-----EKQTVIPSS--------------A
PNP_BORBU       DILLSAIDGAHEYIKQ-ICNAQKEFLDIVGKK----EKLPLAFEE--------------K
PNP_DESVV       AVIVEALEWGHKEIQP-LIDAQLKLREM-----AGKAKR-EFTAP-------------VE
PNP_DESAG       EVIAQALEWAHREVQP-IIDMQEKLREL-----AGKAKI-EFVAP-------------EE
PNP_LAWIP       EIIIEALEWGHKEIQP-IITLQNKIQEL-----AGRNKI-PFVPV-------------EE
PNP_SYNFM       DDLVDAIDFGHKAILP-ILDAQDELQRR-----IAPVKE-APPEV-------------VR
PNP_ANADF       QVMVDALLFGQAAVRE-LLDAQDALRKA-----TGDKPRRAFDPP-------------KN
PNP_MYXXD       ADMVAALDFGFTTAQP-ALDLQDELRRE-----LNKQVRSFEKPA-------------AV
PNP_SORC5       AEIIDALMFAHETAQP-VIDLIEKMRAA-----VGKPKREFVAPA-------------LP
PNP_GEOUR       EDMLEAIFFGHAAIQP-LLAAQEELCSK-----AGVAKR-EVPPP-------------AV
PNP_PELPD       DDMLDAIFFGHAAVQP-VLEAQEKLKQL-----AGVAKR-DVPPP-------------VV
PNP_PELCD       QEMLDALFFAHEAIQP-LIDVQLELVKI-----AGKEKR-EFSVP-------------EI
PNP_SYNAS       EHVIAGIDFGLECMRP-VIELQDQLRSA-----LGKPKR-EFEAV-------------EI
PNP_DESPS       DEILGAIFFAFENLQP-LINLQDELQRA-----NGLEKI-VVESP-------------VI
PNP_BDEBA       ADALAALKFGHQSLIP-LLNAQDELREK-----AGSVAKRAFTAP-------------SI
PNP_BACV8       QDLLAAMKAAHEAIKV-HCKAQMELMEE-----VGSTVKREYCH-------------EEN
PNP_PORGI       SEMLEGIRVAHEAIKV-QCKAQLELSEA-----VGKLQKREYSH-------------EVN
PNP_CYTH3       ELMLNAIKVAHDAIRT-QCIVLKELESA-----AGKTEKRTYSH-------------EVN
PNP_FLAPJ       AEMLEAIKFAHEHIKV-QIAAQERLAAA-----FGKKEVRTYEK-------------EKS
PNP_GRAFK       EDMVEAIKFAHEAIKV-QIEAQHRLADA-----FGRKEVREYED-------------APE
PNP_SULMW       IEMMEAIVKAHKYIQL-QIEAQISLITK-----NKKFIKKKLYKIELYNYYYKYINFNLN
PNP_CHLPD       AEMLDAIKFGHEAIRK-ICALQDEMAAE-----IAR-PQRSFAPVKAPAKLK-----EVI
PNP_CHLTE       AEMLDAIKFGHDAIKK-ICALQRELAAE-----VAK-PKRPFSPTVAPDELV-----NFV
PNP_PELLD       AEMLDAIKFGHEAIKK-LCQLQNELAGE-----VAK-AKRPFTPLQVPAELS-----EYV
PNP_CHLCH       TEMLEAIQFGHTAIRK-LCVLQQEVAAE-----VAK-PKRLFVPTVIPTELD-----SFV
PNP_SALRD       ESMIEALDVAHRSIRR-LCEGQHRLVEQ-----AGEPDPFEWEA-------------DRV
PNP_KORVE       EEVVSAIEFGHGEIKK-ICAVISKLAKE-----VGKTKRTVAPVEL--------------
PNP_SOLUE       AEVLGAIEFGHECCKK-IAAGIRQLMKL-----CGKTKREFVSPVL--------------
PNP_RHOBA       DEMMEAIGFAHDAIRE-VIDLQEEFYKK-----VNPEKTPYQSPE---------------
PNP_ECOLI       DQMLGAVVFGHEQQQV-VIQNINELVKEAG----KPRWDWQPEP---------------V
PNP_PHOPR       ETMLQAVVYGHDQQQV-VINAINEFAAEVA----TPAWDWTAPV---------------V
PNP_HAEDU       EQMLAAVVFGHQQQQI-VIENIKEFVKEAG----KPRWDWQPAE---------------A
PNP_COLP3       EVMLGAVVYGHEQMQV-AVSAIKEFKAEVN----TPSWDWVAPV---------------K
PNP_PSYIN       DVMLGAVVFGHDQQQI-VVESIKEFAAEVA----RPAWNWAAPA---------------R
PNP_PSEA6       DVMLGAVMFGHEQMQT-VVNAVTEFAAEVN----TPKWDWVAEP---------------A
PNP_AERS4       EVMLGAVVYGHEQMQV-VINAINEFAADVG----TQPWDWTPPA---------------T
PNP_SHELP       EVMLGAVVYGHEQQQV-VIQAIKELKAEVN----KPMWDWTAPV---------------Q
PNP_IDILO       DQMLGAVMYGHEAMQD-VIKAITEFTAEAG----KEKWDWQAPA---------------K
PNP_PSEHT       DIMLGAVVYGHEQAQA-IITAIKEFKAEAG----KPTWDWTAPA---------------K
PNP_BUCAP       DKILGAIMFGHQQQQV-VINNIRSLSNEA-----SKLPWIISYPE--------------I
PNP_BUCBP       EQIINAINYGHEQQKI-VIKNIEHFAKKV-----KIPVWEQCLYP--------------V
PNP_BUCCC       DNILNAILFGHESQQS-LIDNIYLFSDKAN----KIPNIYKNIYK--------------P
PNP_WIGBR       KNILEAILFGNEQNKI-VIENIDKLKKKFK----KENLEYDLKSL--------------N
PNP_BLOFL       QEMLNAIVFGHEQQQT-VIQNINQLVKKAG----KVKYDWKLKD---------------M
PNP_BLOPB       KEILDAIIFGHEQQQI-VIHNINKLVKKVG----KTKYSWNEKE---------------V
PNP_BAUCH       EQMLSAIIFGHEQQQL-VIQNINHMVTIVG----KPKWSWQAQV---------------I
PNP_NEIG1       DVMLGAVVYGHDQMQV-AINAINEFADEVN----PEVWDWKAPE---------------T
PNP_CHRVO       AVMLGAVVFGHEQMQA-AIKAINELADEVN----PVMFDWAAPA---------------K
PNP_METFK       DVMLGSVVYGHEQMQI-VISAINELAAEVG----KEPWDWAPPE---------------P
PNP_THIDA       DIMLGAVVFGHTQMQA-AINAINELADEAG----ADAWDWAPPA---------------E
PNP_NITEC       DVMLGAVTYGHDQMQQ-VINMINELADETG----VTAWDWQPAE---------------K
PNP_NITMU       DVMLGAIVYGHQQMQV-AIDAINELADEAG----VTAWDWEPPA---------------R
PNP_VEREI       EIMLGAVVFGHQQGKV-AIDAIHELVHAAG----KPVWQWEAPA---------------R
PNP_METPP       DIMLGGVVFGHEQGNI-AVRVINELVREAG----KPEWQWTPPA---------------K
PNP_BORA1       EIMLGGVVFGHEQMQA-AINAIHDLVRDAG----KPEWTWSPAA---------------K
PNP_JANMA       EVMLGAVVFGHEQMKA-VIDAIHDLVRDGG----KPEVQWSPAP---------------K
PNP_RALSO       EVMLGAVVYGHEQMQI-AINAIHDLVRDGG----KPEWDWQAAP---------------K
PNP_POLAQ       EVMLGAVVYGHDQMQT-AINAINELVAEAG----KPEWDWTAAP---------------K
PNP_PARXL       EVMLGGVVFGHEQMQI-AIDAIHDLVREGG----KPEWDWQPAA---------------K
PNP_DECAR       EVMLGAVVFGHTEMQK-AINAINELVEEAG----KPEWEWEAAP---------------K
PNP_AROAE       EVMLGAVVFGHQQMQV-AIRAINELVEVAG----KPEWDWQPPA---------------K
PNP_ALKEH       EAMLGAVLYGHEQMQV-AIQAINELTAEAG----KPRWDWHPPQ---------------G
PNP_HALHL       STMLDAVLYGHEQMQV-AIDTINDLAAEAG----KPRWDWQPPA---------------K
PNP_METCA       EVMLGAVVFGHEQMQT-AIRAINELAEEVG----VTPWPWEPSA---------------V
PNP_NITOC       EIMLGSVMFAHQEMQV-VIQAIRELAEEAG----KPAWDWKPPI---------------E
PNP_XYLFT       EVMLGAVIFGHREMQK-VIQVIDSLTAEAC----TQPSDWVPPA---------------K
PNP_COXBR       SVMLGAVLHGHQAMQV-AIQAIAEFIQEAG----GAKWEWEPPT---------------V
PNP_DICNV       AVMLEAVMFGHRQQQV-VIKSINELAAQAA----KPAWAWQSPA---------------R
PNP_PSEU5       DQMLGAVLFAHDEFQA-VIKAVEELAAEAG----KPRWDWTAPQ---------------A
PNP_SACD2       DIMLGAVLYAHQEMQA-VVQAVAELAKDAA----KPVWDWKPEE---------------V
PNP_HAHCH       DQMLGAVLFAHQEMQV-AVQAIKEFAQEAG----KPKWDWQAPE---------------V
PNP_MARHV       DQMLGAVLFGHQEMQT-AITAIKEFAAENG----KPRWEWQPEA---------------E
PNP_CHRSD       DEMLGAVLFGHQEMQA-AITAIQALADEAG----KPRWDWQPPT---------------D
PNP_ALCBS       DQMLGAVLFGHMEMQP-LIQGIKEFAAEVG----TETWDWKPAE---------------Q
PNP_ACIAD       DQMLGAVLFGHDEMQI-AVQAIKEFAAAAG----AVESTWVAPT---------------K
PNP_PSYWF       DQMLGAVLYGHEQQQI-VIDNIAELAKAVG----TQKQDFVAPE---------------L
PNP_HYDCU       EIMLGAVMFGHEQMQV-AIDAIKELKAEVG----KPAWNWEAAE---------------E
PNP_LEGPA       DIMRGAMLYGHEMMKS-VIKSIEELAREVG----KSKPEWKAPE---------------I
PNP_VESOH       EIMLGAVVYAHEQYQV-AITNIAEFTTEVG----MQKWDWIAPI---------------T
PNP_FRATW       SVMLGGILYAHKHLKT-IINSINRLAKVAS----KPRIEYSIYQ---------------I
PNP_GRABC       DQMLAAVEFGHKGFQP-VIDAIIALAEHAA----RDPWTLPEQNP--------------E
PNP_ACICJ       ETMLGAVTFGHAAFQP-VIQAIIELAEHAA----KDPWPLVEESD--------------E
PNP_GLUOX       ETMLEAVTLGHTSFQP-VIDAIIALAEHAA----KAPWDLPSLTK--------------E
PNP_MAGSA       DVMLGAVMFGHREFQA-VIQAIIDLAEECA----KDPWDLPEPPA--------------E
PNP_RHORT       QQMLDAVMFGHEGYQP-VIDAIIALAEQCA----REPRAIEPPAP--------------E
PNP_CHESB       DVMLGAVMFGHRNFQP-VIDAIIKLAEVAA----KEPREFL-PED--------------L
PNP_BARBK       EVMLGAITFGQKGFQP-VIDAIIQLAEVAA----KEPREFI-PED--------------F
PNP_NITHX       DIMLGAVMFGHRHFQP-VINAIIELAEKAA----KEPREVS-QAD--------------D
PNP_AZOC5       EVMLGAVMFGHRHFQP-VIEAIIRLAEKAA----KEPRPFE-PVD--------------H
PNP_PARL1       DIMLGAVMFGHKEFQP-VIDMIIRMAEKCA----KEPRAID-VKD--------------N
PNP_MARMM       EVMLGAVMAGHKAFQP-VIDMIIKLAERAA----KEPWDYA-PAD--------------H
PNP_CAUVC       EIVLGGVNFAHQQMQA-VIDAIIDLAEHAA----KEPFAFE-PED--------------T
PNP_HYPNA       DVMLGAVVAGHDAMQP-VIDAIIALAEKAA----KEPFAYE-PPD--------------H
PNP_PARDP       AEMLGAVKFGHEAMQP-VIDLIIDLAEAAA----KEPFEFA-SPD--------------Y
PNP_SPHAL       EVMLGAVLFAHDACKE-VVKAIIKLAEQAA----KEPWEIA-SSD--------------D
PNP_NOVAD       DEMLGAVLFAHDEIKK-VIGAIIQLAEKAA----KDPWDID-LSD--------------N
PNP_ERYLH       EQMLGAVMFAHEESRK-VIGAIIDLAEQAA----KDPWELD-PVE--------------D
PNP_ZYMMO       EVMLNAVSFAHESLQP-VIKAIINLAEQAA----KEPWELV-SYD--------------D
PNP_PELUB       EVMLDAVKFGHEGFVP-VIEMIEELAKECR----KPEWTVE--KK--------------D
PNP_MAGMM       DEMLDCVMFAHESFQP-VITAIEELVAEAG----KPRWVVE-PVQ--------------V
PNP_RICTY       EKMLEAIKFGFENFQT-VIKLIKEFAKEAK-----KPKFEMQDLY--------------P
PNP_ORITB       EKMLAAIEFGYKSLKP-VINAIEEIKSSIR-----KDIFEVTARP--------------H
PNP_ANAMM       EEMLGAVTFGHENCAQ-VLDLIEEFAEAAG----PKDVVEFVPHD--------------I
PNP_ANAPZ       AEMLGALQFGHEHCEE-IIKVIGEFAEEAR----KCAPAEFVPCD--------------L
PNP_EHRRW       SQMLGAISFGHQNCQE-VIKLIEEFREESG-----ILPFGFIPHD--------------I
PNP_WOLTR       ENILNAIKFGHEHLQP-VIKLIKEFADTIG-----NKFDSFAPID--------------I
PNP_NEOSM       EEVVNALSEALKSAKP-VFSFINEFVKSVT----TVKPIG-VLYD--------------N
PNP_CHLCV       EQVIEAIEFGHKHIAT-ICRAIKDLQQKVG----KKKNSDAIVP---------------L
PNP_CHLPN       EQVLDAIEFGHKHIVT-ICKRLQLWQEEVG----KSKNLSAVYP---------------L
PNP_CHLMU       EQVLEAIAFGQKYIAK-ICDAIEAWQKAIG----KEKQLSAVLD---------------L
PNP_PARUW       DQVLEAIEIGHRSIKT-ICQTLEQWRAKVG----KPKNRETLRQ---------------L
PNP_BACCN       ETMLEAIMFGHEEIKR-LIAFQEEIVQA-----VGKEKMEVKLYE--------------V
PNP_GEOTN       EVMLEAIMFGHEEVKR-LIAFQEEIAAQ-----VGKEKMEVVLYE--------------P
PNP_OCEIH       DIMLEAIMFGHEEIKR-LVAFQEELVKA-----CGQDKFDVVLAE--------------S
PNP_BACHD       DVMLEAIMFGHNEIKR-LIEFQEKIAAE-----VGKSKTDVVLKQ--------------V
PNP_BACSK       DVMLEAILAGHENIKK-MIAFQEKVVEV-----CGKEKREVQLKT--------------F
PNP_LISIN       EAMLEAIMFGHEEIKR-LCEFQQQIIAA-----VGKEKREIELFV--------------S
PNP_ENTFA       EDMLGALLFGFDAIKE-LVAFQEEIVAA-----VGKPKMDVDLLQ--------------V
PNP_STAS1       SEMLEAIFFGHSEIQR-LVNFQQEIVDH-----IQPKKKAFVPVE--------------K
PNP_STRMU       DIMLEALLKGHEAVRE-LIAFQEEIIAA-----VGKEKAEVELLQ--------------V
PNP_STRTD       DIMLQALLKGHEAIQE-LVDFQNYIVAA-----VGKEKAEVELFQ--------------V
PNP_LACLA       EVMLGALLAGHNAVKE-LIEFQNEIVAK-----VGKEKAEVELLH--------------V
PNP_SPICI       NLMLQAILAGHDVIQQ-LIAFQHEIIAK-----VGVPKMEVELFQ--------------V
PNP_ONYPE       QDFLEAINFAHQYIKK-LCLFQENIKQQ-----FAPAKITNTLHQ--------------T
PNP_ACHLI       EVMLEAILFGHEAIKE-LCAFQETIKKA-----FGVEKVEPELLS--------------L
PNP_FUSNN       ETMLKAIMFAHENIKK-ICEFQEEFSKL-----YGKENIEFEKPE--------------V
PNP_TRIV2       RDIIEAIDFGYEAVRD-LIKAQLDLVAE-----LGLEIVQEAPPE--------------V
PNP_TRIEI       QDIIEAIDFGYEAVCD-LIQAQREIIAE-----MGIELVELEPPE--------------V
PNP_ACAM1       QDMIEAIDFGYEVVCD-LIKAQKELIAE-----LGIEQVEEAAPE--------------T
PNP_SYNE7       ADVIEAIDFGYEAVQE-LIKAQQSLLAE-----LGIEQILPEAPN--------------A
PNP_SYNY3       QDIIEAIDFGYEAVQD-LINAQRELMTD-----LGITLATSEPPP--------------V
PNP_THEEB       ADMIEAIDFAYEVIRD-LIQAQRDLLKE-----LGIDIVRAEPPA--------------I
PNP_PROMA       QDVIEAIDFGYEAVNE-LIKAQESILKD-----SGLTQIKPEKPD--------------L
PNP_PROMP       QDTIEAIDFGYEAVSE-LIKAQENLLKD-----LGIKQVKPLEPE--------------E
PNP_SYNR3       EDMIEAIDFGYEAVLE-LIRHQKETIAE-----LGIEQVVPEKPA--------------E
PNP_SYNJA       KDVVEAIEFGFEAVQE-LLKAQQQVFAD-----LNITPVELPPPP--------------Q
PNP_GLOVI       EDIIDAIDYGYEAVQA-MLTAQEEFIRD-----LKIEPMAFVAPA--------------N
PNP_DEHM1       DLMIKAIEFAHQANQE-LIDLQDEIRAK-----LGKEKLPVPVLE--------------I
PNP4_ALKMQ      DQMLDALMFAHEEIKT-IVAFIEEIVAE-----VGKPKQEVQLFA--------------I
PNP_ALKOO       AQMLEAILFAHEEIKN-IISFIEEIAAE-----VGKEKQEVVTLE--------------I
PNP3_ALKMQ      AQILDAIMFAHEEIKK-IVAFIENIVSE-----VGKPKSEVIAKQ--------------M
PNP_CLOD6       EVMLDAILFAHQEIKK-IVEFIEGIVAE-----VGKEKMPVELYH--------------A
PNP_CALS8       DIMLEAIMTAQEEIKK-IVEFIEGIVKE-----VGKPKMQYEKRV--------------V
PNP_CALS4       ETILDAIVYAHQYIKQ-IVEFIEGIVKE-----VGVPKAEVVLHE--------------I
PNP_CLOPS       DTMINAIKFGFDKCQD-IIKFQEEAVSM-----FGKEKKVPELHK--------------V
PNP_CLOB8       DTMIDAIKYGFDECQK-IIAFQEEAVAK-----FGKKKDEPVLYA--------------V
PNP_CLOBL       ETMYNAILFGFEECKN-IVAFQEEAVAK-----LGKTKDEQVLYK--------------A
PNP_CLOTE       DTMYNAIRFGFEQCQK-IVEFQEEAMRR-----FGKEKVEPVLYL--------------V
PNP_CLONN       DVMYDAIMFGFEECKK-IADFQQKVMEQ-----YGKQKAELILHE--------------I
PNP_CLOAB       DLMIAAIDFGFNACQD-IVAFQEKAMKE-----FGKEKVTPELYH--------------P
PNP_LACP7       DKMLEAIFAAHEVNQE-VIQFIDKIVAE-----FGKEKHGYISCE--------------I
PNP_HUNT2       EVMLDAIKKGHEEIKK-IVDFIDGIVKE-----VGKPKFEYESAE--------------V
PNP_CARHZ       EIMIEAITRGHEEVKK-IVAFIEEFREEALKLGLAKEKMEVVVEE--------------K
PNP_MOOTA       DLMLECIMQGHEEIKR-IVAFINEFRAEALAMGLAKEKPELVAPQ--------------L
PNP_DESRM       SEMLEGIMYGHEKVKE-IVKFIEDFRTEALGMGLAFEKMEIPEPQ--------------F
PNP_PELTS       EVILEAISFGHETVKE-IVAFIERYREEALEMGLAKEKMVIEVAE--------------P
PNP_DESHY       AQMLEAIMFGHREIQR-IAEFIENYRLEALERNLAKPKQEVVMKQ--------------M
PNP_SYNWW       ETMRDAIFFAHEEIKK-IVDFQENIIRE-----VGLSKMQVEIPI--------------L
PNP_SYMTH       QTMLDAILFGHEVIKNTIIPTIKQMQAE-----VGKPKREVVLFN--------------P
PNP_CHLAA       DEMLQAVIDGHAVCKQ-ICDLQEQLVQL-----CGKPKRPFTPPV--------------V
PNP_ROSS1       DLMLEAIIQGHQVCKQ-ICDLQNELVRL-----AGRPKREFVPPP--------------V
PNP_DEIRA       DDLVGAIEFAHAEMQG-VIALIEQMRAEVG---HEKFNFLAEEGP--------------A
PNP_THET8       ETLVQALEFAHKEMQP-ILELQEAMARELA---KPKMAWTPPESL--------------P
PNP_RENSM       EIVSEGLEAAKPFIKA-LCEAQADLAARAA---KPTVEFPIFLDY--------------Q
PNP_KINRD       EVVAAGLEAAKPFIAE-LVRAQAEVAATAA---KPTAAFPTFPDY--------------Q
PNP_STRAT       EVVAAGLDAAKPFIKV-LCKAQADLAAKAA---KPTGEFPVPSST--------------T
PNP_NOCSJ       EIVAGGLDAAKPFIKQ-LCEAQVELANVAA---KPVQDFPVFLDY--------------E
PNP_ACIC1       EVVAGGLEAAKPFIRT-LCAAQSELAARAA---KPVTEFPLFRDY--------------E
PNP_CUTAK       EVVATGLEAAKPFIKV-LCDAQVALAAKLP---KETYDFPVFKDY--------------E
PNP_FRACC       EVVAAGLEAAKPAIRE-LCRAQSELAALAA---KPAREFPVFIDY--------------H
PNP_THEFY       QTVAEGLEAAKPFIKV-LCRAQQTVAEAAG---KPPGEYPIFIDY--------------Q
PNP_RHOJR       AIVAEGLEAAKPFIAR-LCTAQQQLAAKAS---KPTGDFPVFPAY--------------Q
PNP_SACEN       EVVAAGLEAAKPFIRT-LCQAQQQLAQAAG---KATEEFPVFPAY--------------A
PNP_SALTO       EVVASGLEAAKPAIRE-LCRAQSELAEVAA---KPVAEFPVFLDY--------------S
PNP_COREF       KTVAEGLEAAKPFIDL-LCRAQEGLAQRVA---KETREFPLFPAY--------------S
PNP_CORDI       SVVAEGLEAAKPFIEV-LCRAQAGLAERAA---KETQEFPLFPPY--------------T
PNP_CORJK       EVVAQGIEAAKPFIAT-LCEAQNALAKAVD---AETREFELFPPY--------------G
PNP_LEIXX       EVVAQGLEAAKPFIRQ-LVGAQAALAKQSA---KAIADYPVFLPY--------------S
PNP_TROWT       EVIEEGIESAKVFIRT-LCDIQRDLASKLS---LSHTEPDLYPDY--------------S
PNP_BIFLO       EVVAGGLEAAKPFIKV-ICEAQDELKKIAA---KETKEFQLFPEY--------------T
PNP_RUBXD       DVVVEALEVAQGVIRE-QAEAIERWAAEHG---EEKQ--PFEEPG--------------E
PNP_LEPIC       EEMIAALRFAQKHIAE-FVTLQEEYAKKIG---VVKREVKLKVR----------------
PNP_NITSB       EELASIIAQGKDVIQIACNEYEKYFIESAKEQLELELLPQTIDED---------------
PNP_WOLSU       EELLEALELAKTSIKKASACYVEAFTPLAKPDAILELKPDITSSE---------------
PNP_SULDN       DELITILAKAEELLFETNAMYEEMFKEFKKETSPLECKAHALNEE---------------
PNP_ARCB4       DALVEAIAFAQNALKEANLTYEKAFEEVSKEKFEVELVKFTIEES---------------
PNP_CAMC5       DRIVEAIDFAGKAILRASNAYEEAFKEHKKEDAILELKPEIENEN---------------
PNP_CAMFF       DLMIDAIKLATEAILKGSNAYEEAFRNYKKETANLEYKPEIENEN---------------
PNP_CAMHC       DKMVEAIDFASKAILAGSTAYENTFSALKKPDAALEYKPEVEDEN---------------
PNP_CAMJD       DEILEALNLAQKAILNGSNAYEEAFSKHKK-NSQIELKNEIEHPE---------------
PNP_HELHP       ENFLEALECAKNYIKNATQTYHQQFAPYKKSPFAFESANDELDEQ---------------
PNP_HELPH       PLMLKALELAQKSLKETCTLYEEVFTPHQNELLFKESQGIIFNER---------------
PNP_HELAH       PLMLEALELAQKSLKETCTLYEETFTPHQNALLFKESQGIVFNER---------------
PNP_HELPJ       PLMLEALELAQKSLKETCALYEEAFTPYQNELLFKEGEGIVLNER---------------
PNP_SULNB       EALVDAIAFAAKAIEEASAIYEKEFTPVMRTPLGLSLAEEKVDEE---------------
                      :  .                                                  

PNP_FERNB       NVELVEKFVEYIDMTELEKRIFAR----GKQERA----EMADEYYESIVQKFFE------
PNP_THEM4       KDELIGRFEELLVENELRKRLLIK----EKLERS----LKLKEYKEELISKIFE------
PNP_THEP1       PEGLVEAFKDLLNKEELERRILVK----VKKERE----VALKEYEEQLLNQIAE------
PNP_PSELT       PEEIEKEFSQLLDGNELRERLLIQ----GKKARS----NALSEYFKKIYEILEA------
PNP_PETMO       PEEFIEDYLSLIDEEELKKVLLTK----GKKNRD----KVISEYKKNVMKKFEEIFLE--
PNP_AQUAE       PEDILKALEEECT-PKILEAFNIK----DKKERY----STLDKIVEEFIEAHQI------
PNP_TREDE       ELENKQAIYDEAF-PRLSKTLYLS----TKMERR----EESDKVKKELAEKYAE------
PNP_TREPA       QLVGRDRIYELAY-PRLAQALYAQ----GKGERR----SACDAVKRDVAQQYAA------
PNP_BORBU       IFEFKDELRDFVY-ADLKEACFVK----GKLNR-----DKAITLLRNKSYEYFS------
PNP_DESVV       DADLAARVAALATA-DLDVALRIP----EKMARK----DARKAVKEKVMEALVADPAYAE
PNP_DESAG       DTELKEKAEALATA-DLAAALQVR----EKMARK----EAKKAVKEKVKAALLQDPAFAE
PNP_LAWIP       NIVFSKKVEELADKFGIVEAMQVK----EKQFRK----EARKAVKEKVLAILKEDPLYAE
PNP_SYNFM       NESLVQAVRDAAAA-EMRAVMTTP----EKHPRR----DRKKALKERIQAELVSD-----
PNP_ANADF       DVALREKVKALTWE-KVKEAYARN----EKHDRY----GRLSEIKKELLQALKEEAAGDA
PNP_MYXXD       DEGLRAKVRELAMD-GIKAGYGIK----EKGARY----EALGKTKKEALAKLKEQLGDGY
PNP_SORC5       DE-IKRRVAQIVDE-DLKAATKVT----DKKARY----DGYSSLKKKLTETLSAELGAEK
PNP_GEOUR       NEELKANVKDIAYA-RMKEAVRIK----SKVERH----NSIDAISAETLAALATEFEGC-
PNP_PELPD       DQALLARVRELASE-RMSAAVKIK----SKQERH----NQIDLITAETTASLAAEFEGN-
PNP_PELCD       DPAVVEKVAELAET-RLSEAVKIR----TKQDRY----AAVAEIKTEILETLAADFEDQ-
PNP_SYNAS       DDALLAEVSEKAAV-RMREAYRMS----RKLDRH----AALDEIRNSVLKAVTADEAGL-
PNP_DESPS       DAELKAKVVEIAAA-GMQKVYTTV----DKLERG----KVYDDLKKEVVAQLDTEEGLR-
PNP_BDEBA       DADFKAKAESLLRP-KIAAALSIK----EKQDRY----AAANEAAAEAEKALLADIADKE
PNP_BACV8       DEDLRKAVREACYDKAYAIAASGNR---NKHERQ----DAFDAIRDEFKTQYTEE-----
PNP_PORGI       DEDLRKKVHDECYARAYEVATSGT----GKHERG----EAFEKIVEEFKAQYTEE-----
PNP_CYTH3       DWDLKKKINDAVYQQVYEVAKLGNA---NKNTRA----EGFKAVKKAYIESLPAD-----
PNP_FLAPJ       DDAIYAKVKEAAYDKIYNIAKVGS----AKQERT----AAFDAVKEEVKALFTEE-----
PNP_GRAFK       NEDLVKKVHDMAYDKVYAVAKAGS----SKKERT----DAFASIKEEVKASFSEE-----
PNP_SULMW       VFYIKEKIKFISYEEIDYIYKSCL----FKQKRS----NKIYNILKKIKFHFYNE-----
PNP_CHLPD       AGLSETRLKELAYTPLCKEDRAEK----TASVYK----ETLQSTLELFKALLTPEEIAA-
PNP_CHLTE       EEHCSAELKALAYTPLAKEERAEK----TKAIYT----QTIRKTLTHFTDRVGPDQIEA-
PNP_PELLD       KNACESSLKELAYKPLAKEVRADE----TKAIYS----ETVKKAIEHFSAAFGPEALAA-
PNP_CHLCH       RANCQSRLRELAYTPLGKEERAER----TAAIYN----ETLAATLEHFRATISSEEAQA-
PNP_SALRD       PEQLVQRMREEYGPKVADHIHGPY----SKETFH----GGIGDLKDQAVDDVLGDA----
PNP_KORVE       DQPYLDGLRKKIGADLADALNTEKY---PKSESY----AKVKEIKSKLKEEIPAD-----
PNP_SOLUE       DETIYAEVEKQARVDLTDALNTEKH---EKLASY----ALVASVKKRTIEALP-------
PNP_RHOBA       DDGLLQRLTDAYYSDFKTAQQTSG-----KQARA----EAVRAVRDRAMADVIPDPNAA-
PNP_ECOLI       NEALNARVAALAEARLS-DAYRIT----DKQERY----AQVDVIKSETIATLLAE-----
PNP_PHOPR       NAELKARVADKAATRLS-DAYQIT----EKMARY----DEVGSIKNDVVASLLAE-----
PNP_HAEDU       NTALINQVKALAETRIG-DAYRIT----EKQARY----EQIDAIKADVIAQLTAQ-----
PNP_COLP3       NAELLAKIAELSEAQVN-EAYQIT----EKAVRY----EKIKEIRSSVLEALLAE-----
PNP_PSYIN       NEALDAAIATEAQARFE-QAYQIS----DKGDRY----DAIKAITSEVKEKLLAS-----
PNP_PSEA6       NVTLKDKIKALAEAEMT-EAYQIS----DKMARK----DAIVALTDKTVAAIVEA-----
PNP_AERS4       NEALKAKIAELATAELG-EAYRIT----EKAVRY----AAIGAIKQRVIEQVIAA-----
PNP_SHELP       NEELVAKVKDLAEAGLT-EAYQIV----VKQDRY----AQVDVVKTAAKEALLAE-----
PNP_IDILO       DESLQTKIRELAEQGIG-EAYRTT----DKAERK----GKLDQVKEQMVEKLTAE-----
PNP_PSEHT       NVSLEEKVASIAADKVG-EAYRIT----DKVARK----EALGVAKDEVVAVLTSELAE--
PNP_BUCAP       NTELELKITKLAEKDIS-NAYLIF----NKQERY----EKLNFLKEEIIKLFFSENS---
PNP_BUCBP       NDDLEKRIIEISEQEIV-KAYNIF----DKVIRL----DVLDKIKSKAIEIIISEYS---
PNP_BUCCC       DKQIFNLISKKIKKDIN-KAYYIL----KKKERL----KKLNDIKQKVTSELLNNDS---
PNP_WIGBR       NNDIQFVIEDLFFDRIK-DSYKIP----EKKKRL----EKIENIKNDILNNFINNN----
PNP_BLOFL       DILLSEYLSNLYRSRVNVSCLVGV----NKKDRQ----EQLNNIKHDIIDITLREY----
PNP_BLOPB       NISLKTYLSELYESRAQ-DIYCFF----DKKERH----AQVDSIKKDIVKTVLNSYQ---
PNP_BAUCH       DTNLQLCVTELAESRLN-EAFCIS----DKQERD----VCIETIKSDVLSALQQKN----
PNP_NEIG1       NEELVAKVRGIAGETIK-EAFKIR----QKQARS----AKLDEAWNAVKEALITEETD--
PNP_CHRVO       DEALIAQIRGIAGEKLA-EAFRLR----QKQART----VAINEAWDAVKAGLINEETD--
PNP_METFK       NTELIAKVEALAGADIN-EAYKIK----SKSARS----SKLDEIRSRVLGELITETTS--
PNP_THIDA       DTAMVDRLKALAEDGLQ-QAYNIK----QKRARM----AAVDEVRSKAFAELITADMD--
PNP_NITEC       DHSLIEKITQLAEADLR-DAFRLK----QKSVRT----EAISEIWQRVFTELKAGTEE--
PNP_NITMU       DPALAVKIAELAENDLR-AAFRQK----QKQVRS----ETIDNIWTRVFTELGVEDGE--
PNP_VEREI       DEALIARVAALADDKLR-AAYQIR----NKQART----EACRAAYAAVLAQLQADGV---
PNP_METPP       DEDFIAKVNGLGEAKLR-AAYQIR----SKQDRT----QATRAAYAEVLAALAAEGA---
PNP_BORA1       NEALIAAVTAAAQEGLS-AAYQIR----EKQART----TKLREVYAEVSAKLAEQAAAAG
PNP_JANMA       NEALISRVAHFAEAKLR-AAYQTK----DKQART----TKLKDAFAEVNNELAAEAASIG
PNP_RALSO       NEALVAKVSELGLADLQ-AAYQLR----QKSARS----QKLKEVYASVAAKLAEAGV---
PNP_POLAQ       DEPFIAKVTALAEAPLR-EAYQIR----QKGARS----DKLKEITKEVMAKLQEEG----
PNP_PARXL       NEPLIARVTELAQADLL-AAYQLR----DKQARS----AKLKEIYAATSAKLEEDAAAGG
PNP_DECAR       DEALVASLSALVSAKLE-EAYNIT----VKQTRS----QAVKAIRAEAVAALCTGAEG--
PNP_AROAE       NEPLIARIKELAGAHLE-EAFRIT----SKQART----QRINEIRKQTFGVVADGVEV--
PNP_ALKEH       DAALETAIKDLVGDDLA-AAYQIP----EKQERQ----NRIGELRQRAVEALGEN-REE-
PNP_HALHL       NESLDSAVAELVRSDLE-AAYQIA----DKQERS----ERVGALRDKAVEALAD---EE-
PNP_METCA       DAALVAAVDELARAGLG-EGYNIA----DKQLRQ----QKLKEVRKAVIDALTA------
PNP_NITOC       EEDLKSAVQEVGEARAQ-EAYQIR----SKQERQ----ASLAELRNSIVESLVP---EE-
PNP_XYLFT       NDALVIALKKVIGGRLS-DAFHIR----DKLQRR----DAIAAVKDDVIQQLAG--RLE-
PNP_COXBR       NTALEKWVVEKSEAPLK-KAYQIQ----EKTARQ----AQIQAIRDQLLADRAAEREGE-
PNP_DICNV       DEQLDTEVKNHFEERLV-AAYQIA----HKQTRQ----ETVAQIHADAVALLGIQNNAH-
PNP_PSEU5       NTALLDAIRSEFGAAIS-EAYTIT----IKQQRY----ARLDELREQVVAKFS----GEE
PNP_SACD2       NAELKAKVEHGFADSVG-VAYRIT----DKQKRY----DRLSELRNQAVAELA----TEE
PNP_HAHCH       NAELLEALKAKFAGSIG-EAYGIR----VKADRY----AKLGELRQQAEEELA----GEE
PNP_MARHV       NTELLNAIKAEFGGAIE-EAYAIR----DKMARY----ERLGEIKSAAVEKLA----GEE
PNP_CHRSD       DTTLKSALAAEFEAKVG-EAYRIT----DKMARQ----DALSALKDEALERLA----GEE
PNP_ALCBS       NETLKAAIKDKFAAALG-EAYTIT----EKMARY----AKVGELRDACVAEFA----TGE
PNP_ACIAD       NETLLEQLKAAFEAKIS-EAYTIA----VKQDRY----TALDALYAEAVAQFV---PEND
PNP_PSYWF       NAELKEKVTTQFGEQVA-EAYAIS----DKQARY----EKLDEIKAAAIDALAGD-PESE
PNP_HYDCU       DIDLKTKVFDAIRSDIE-AAYDIA----DKMDRY----AAIDAAKTKVMEALAA--TEEN
PNP_LEGPA       DTVLKARINDVARNEVE-AAYLIK----DKQQRY----QRLDELREQTISALL-----AE
PNP_VESOH       NEVLLSDIKSKFGKEIN-KAYQIK----EKLDRH----AKIDNIRMAAIEALENEN----
PNP_FRATW       NKFLKSQIKSQFFGEIK-NAYTIA----SKQERN----LKLNAIRKNVLEYIFSSDVDG-
PNP_GRABC       HVALKQRLNEAG-RTLLGNAYQEK----VKQLRQ----EKISAAKKQIIETLGIGGTPEE
PNP_ACICJ       EKALAARVDELA-REGLRAAYAER----EKTARH----EKIGAVKAAVLETLAAEERSVE
PNP_GLUOX       EIALRKRVEKVG-NKLMADAYKER----QKQARY----KKVAEAKDRINEILADEGLDVE
PNP_MAGSA       VAVVTGKFNDAGVPAELAEAYKII----KKQDRY----AAVGAVKKKALALLT-EAAEIA
PNP_RHORT       AEAVAAKVREVG-EAGLRDAYKEA----DKMVRH----DKVDAVRDAVTAAFAGDDAALA
PNP_CHESB       -SALEAEMLKVV-EADLRDAYKIT----NKQARY----DAVNAAKAKVKEAFLPEGAEAY
PNP_BARBK       -SDLEKTMLKMI-EKDLRKAYTIT----DKQQRY----DAIDAIKTEILSKFAPEMEVNC
PNP_NITHX       -SALEKEMLGLI-EGELRPAYAIA----DKQQRQ----NAVAAAKAKVIAHYFP---EGQ
PNP_AZOC5       -SALEAKIREIA-EADLRAAYKIK----QKQARY----EAVGAAKSKVKKYFEQLAIDGQ
PNP_PARL1       -SELVAKVRELA-ESDVRAAYGLK----DKGQRH----EALAAAKDKVKSALCNPEDPNA
PNP_MARMM       -SAEEAKVRDLI-GDDLAAAYTIV----DKTERY----KAVGAAKDKAVEALLQTEERPD
PNP_CAUVC       -DAIKAKMKDLV-GADIAAAYKIQ----KKQDRY----EAVGAAKKKAIAALGLSDENPT
PNP_HYPNA       -SAALKSVIDTV-GADLSKAYKIT----AKGERY----AAIGAAKDKAKAALLGTDEAPG
PNP_PARDP       -SALYARVKSLG-EADMRAAYAIH----DKGERR----DAIEVAKAKVLAGLSEEE----
PNP_SPHAL       DAALKDKLRKLI-GKDIAAAYKLT----DKSARS----NALNEARAKAKESFIADGL---
PNP_NOVAD       TADIKKKLKDLV-GKDVAAAYKLT----DKSARS----NALNEARAKAKAAFAEEG----
PNP_ERYLH       KSAALEKLRGVI-GDDLAKAYKIT----NKAQRQ----DAVNAARTKAREHYSDLEES--
PNP_ZYMMO       -SALAAKVEELC-YDNFDKAYRLT----RKAERV----DALSKAKAVLDEAFPEAD----
PNP_PELUB       LSEVKKKLEENF-TEDLTKAFATI----DKQDRS----NQISEISDKAKQLFADDEN---
PNP_MAGMM       NEALLAEMNDKF-AAQVTEAYAIP----EKMARY----EAVAQVKAAAMEALGTIEVDGQ
PNP_RICTY       SSLKKEIGKLFAKEIEQAFAIKS------KQERN----ANLALIHEKVLTHFVCDIENKK
PNP_ORITB       LRYNDEILKHFSSDIKSALLLQT------KNERN----QQLQLIQQKVIDYFSSKANSEA
PNP_ANAMM       GKVVSDISSGYSEKFSVAYSDHN------KKTRV----LQLDAAREGLYSDLCRKHVEES
PNP_ANAPZ       STIIDSIGSDYKERFLVAYSEKE------KKARV----AKLDAVRASLTEDLRVKFLSES
PNP_EHRRW       TSLVDDIASSYTESFSIAYSNIV------KKERV----LELEKLRDQVLSDMLAKYEQPN
PNP_WOLTR       SDIMQDLEK-HSKDFEEAYSQTV------KQERA----QTLETIRNNILNPLKEAGKDEK
PNP_NEOSM       KELCEKVRAACSGQLESVYNERIS----SKEKRH----NKLGQIYTDTFAQLSDDGYAES
PNP_CHLCV       PEEVQSSVNTFVEGKFA-DLLKIK----EKKAFE----AASKQLEKEIVEKFLEENE---
PNP_CHLPN       PAEVLTAVKECAQDKFT-ELFNIK----DKKVHA----ATAHEIEENILEKLQREDDD--
PNP_CHLMU       PEDVQNVVSNFIREKFE-KALSFR----DRDALE----QVSKELEESVVANLVQEES---
PNP_PARUW       PKELYADVESIANPLLE-KALRIC----EKQKRE----EALAEVTKAVNDRLMPENEEP-
PNP_BACCN       DAELEKAVREMA-EKDMHTAIQVH----EKHARE----DAINEVKQRVIAHYEEQE----
PNP_GEOTN       DPELEAEIRQLA-EADIKKAVQVP----EKLARD----AAIEDVKAGVIAKYEAEE----
PNP_OCEIH       EEELVENVHSEA-KDKIVNAIQVQ----EKHARD----EAIKQAKNEIVAHYEEQE----
PNP_BACHD       DPMLEQEVRVKA-EEDLKQAVQVP----EKHARQ----DAIEAVMDKVLETYEDN-----
PNP_BACSK       DAELEARLRESA-EASIKEAVRIA----EKHARQ----DAIDEIIAAQVEQHSDD-----
PNP_LISIN       DPELEAEVKAAS-EGKMKAAIKTE----EKKARE----AAIEEVKEEILESYKAK--E--
PNP_ENTFA       DADLKKEIFDAY-YNTMKTAVMTE----EKLARE----VEIDKVKDTVKEVYAEKFSE--
PNP_STAS1       DEVLVEKVKQLTQENGLKDAVLTF----DKQQRD----INLDALKEKVAAEFIDEE----
PNP_STRMU       DADLQAEIVGKY-NADLQKAVQIE----EKKARE----IATEAVKEHVTAEYEERYAE--
PNP_STRTD       NADLKAEIEAVY-YDQLAKAVQVE----EKLARE----AATKAVKEEVLASYQERFAE--
PNP_LACLA       DEDLKAEVIAAY-NSDLQKAVQIE----EKLARE----SATKAVKEAIISVYSAKYEN--
PNP_SPICI       RPEIITYVNNNY-AKDLITAARIK----EKTKRY----ETIEHLIEQAIKNYPMPVSLS-
PNP_ONYPE       EQTQQQAFFAKH-QSQVKQAILSC----NSK-------NDLQQLKEQILDQAKQTPFFKT
PNP_ACHLI       NQAIFDEVFAYK-GKELVKAVSLV----DKQERY----DVIDAIKDEVVAHFEQRNFWMT
PNP_FUSNN       -LTLVKDFIDTNGYERLQQAVLTT----GKKNRE----DAVDSLEEELMEKFIQENYPDV
PNP_TRIV2       DQTLENYIRDRASDEIKKILAQFE---LTKPERD----AALDVVKDN-IATAIAELPE--
PNP_TRIEI       DPTLENYIKEKATEQIKEILSQYD---LDKNQRD----EKLDEIKDS-LAESITELPE--
PNP_ACAM1       DPTLENFVQERVTDPVKDVLARFE---KDKNVRD----AALDEIKES-VKVAIDELPE--
PNP_SYNE7       DNTLENFVRDRASSGVQQVLQHFS---FTKSERD----AALDEVKAS-VVEAIAALPE--
PNP_SYNY3       NTAVEEFIANRASKKIITVLGQFD---LGKDGRD----AALDEIKATEVETAIAELPE--
PNP_THEEB       DPTLENFIYDRAAEPVKAILKRFE---KDKNVRD----AALDEVQGA-IAQEIAALPE--
PNP_PROMA       DETVPSYLEKNCTKPISALLKEFD---LSKEDRD----LKLDEIKTN-CAEKIDSLKD--
PNP_PROMP       DKALATYLEKNCTKPIDLILKKFD---QSKEERD----LELDKIELE-VQTKIDSLKD--
PNP_SYNR3       DTTVPDYLAKQCTKDIGAVLSQFT---LTKAERD----SQLDSIKAK-AAEAIAALKE--
PNP_SYNJA       NEELVAFVAEHAQEEIRSVLRQF----LDKTSRE----QQLEAIKAK-LEAQIQARPE--
PNP_GLOVI       DPVLVSFVEEKASEAVAEVLRSFE---LSKDERD----AKLDAIEAE-LGTTFAGLGE--
PNP_DEHM1       PEEVKAAVAAFVKGRVNEALSHQ-----DKTLRE----NAVEALQSELVEALAETYAE--
PNP4_ALKMQ      DETLDMEVRVFAK-DKIVTAMKTF----DKMERN----ERLDNVKKEILVHFSK------
PNP_ALKOO       NEDFETEVRAYAK-TRISEAIRTV----EKLERN----AKIELANEETINYFYE------
PNP3_ALKMQ      DSNLLTEVVIFLD-TKLANAIKTF----DKTERN----ENIQAVSAEALDYFEE------
PNP_CLOD6       GEEITQLVREFAT-DKMKKAVQTF----EKLERM----ENMDRVKEETLAHFEE------
PNP_CALS8       PEEIKQKVRELAY-EKAYQYVQIP----DKIERD----KKLDELKEEVLKAFEG------
PNP_CALS4       DKELEEKVRAYAT-EKIYNALRTP----EKKERN----DNLDKVEQEVLEHFKD------
PNP_CLOPS       PEEIEEAVREFAF-DMISESMHIT----DRDERN----AAMDEVKAKINEEFEE------
PNP_CLOB8       DPELEKDVKEFAS-DMIKEAMYIM----EKDERN----AAVDAVYEKVNEAFGE------
PNP_CLOBL       DEEVEKEVKRFAF-DMIKEAMYIM----DKDERN----AQLDKVKEKISEEFSQ------
PNP_CLOTE       DKDIEKEVREFAF-PMVKEAMYIS----DKDLRN----EKIDEVKEKVKEEFEE------
PNP_CLONN       DADIEKEVREFAF-DMVKEAMYIT----DKDSRN----KAMDEVKEKVSEEFDE------
PNP_CLOAB       KEEIEKDVTEFAF-ESIKEIMYIT----DRDERN----LRLREIKEKISNEFAE------
PNP_LACP7       PEEMFAAIKEVVTPEQMEEAVFTD----VKQVRE----ENIREIKNKLAEVFEE------
PNP_HUNT2       PEEIFNAVREYAY-DKMREAVLAV----DKQVRD----KNIDDLTKEITEHFAE------
PNP_CARHZ       AELKEAVTAE-AYPLLKEAIEKIIAEKFNKQERD----EYLENLKKELTTKFLE------
PNP_MOOTA       DPAWESRVREIATPRLREVIYRSRDEKWSKQERD----KQLDACREEINNLILEGQEE--
PNP_DESRM       DSNMSEAILTIAEEAIREAVLHCSREKLTKKQRE----VYMDEVMSGLQEKFLE------
PNP_PELTS       DPVLVEAVTGPATEKLDGVLRRCVNERLSKQERD----SLLNNIKDELMQKFLA------
PNP_DESHY       PEEIVQAVKAFAYDKMDQAVRTE-----EKKARE----EAIRQVKEEALAHFAE------
PNP_SYNWW       DEEIKKAVVEFATPLFEEAVKNP-----DKKTRE----DQMDSSQKSVLQHFTE------
PNP_SYMTH       PPELEQAVREAAT-VRLREAVRNP----DKLARE----EAVAAVGEAVQAELAE------
PNP_CHLAA       DTSLEEAISAWMGDRLRKAVRSPI-----KQERE----AQTEALKAEVIAHFTAD-----
PNP_ROSS1       DTSLEEAIQQWLGNRLYEAITDPN-----KMVRD----AQTEALKQEVIAHFTAD-----
PNP_DEIRA       NDYVPELTEKAKAAGLRDALLTHG-----KKDRS----ARLKALRNGLIEGYVPDP----
PNP_THET8       EEEKEALYRLALERGLSQVLQTAS-----KGERS----RALAEFAERLIAEALPKG----
PNP_RENSM       DD-IFEAVNAAAAAKLTEVFQIAD-----KQERD----NASDALKDEVVSSLSS------
PNP_KINRD       DD-VYQAVFEAASADLTAALQIGG-----KQDRE----TRIDEVKEAVKAQLAD------
PNP_STRAT       RT-TSEALSAAVRPELSAALTIAG-----KQDRE----AELDRVKALAAEKLLP------
PNP_NOCSJ       DD-VYDAVEAAVKAELAAAMKIAD-----KQERN----DRTDELKDEVLAKLGE------
PNP_ACIC1       DD-VYDAVAATVRDDVARALTIAG-----KQERE----AALDEVANTALGRLGE------
PNP_CUTAK       DD-VYAAVEEKAADELSRIEQIAA-----KLERQ----EAESELKARIKAELAE------
PNP_FRACC       DD-VLDALSAAIGDELSAALRIPG-----KAERE----NELDRVRQLAAEKVAS------
PNP_THEFY       DD-AYAAVEEAIHDELAAALTIAD-----KQERE----AELDRVKALVAEKLAE------
PNP_RHOJR       DD-VFAAVEAAAAEKLSAALTIAG-----KQERD----DKTDEVKVEVLEQVAP------
PNP_SACEN       DD-AFTAVEQAASAELAEALKIAS-----KQERE----NRLDEIKAAVLEKVGTG-----
PNP_SALTO       DD-VYDAVTELAREDVAEALKIAG-----KADRE----EALDRIKARAVEELGP------
PNP_COREF       DE-VYAAVEKQASKKLTQLMTIKG-----KNERE----NATNDFMVEVEEKLIG------
PNP_CORDI       DV-VYDAVEKKVSKKLRSLLTIKS-----KQDRD----EATNAYMEEIEADLIA------
PNP_CORJK       ED-VFASVQAEALDALEDIMAIAD-----KQERD----EALAANMQANVDELLP------
PNP_LEIXX       QE-TYDSVAALAYDELVNVYQIAD-----KVERQ----NADDALKERVKAALAEKA----
PNP_TROWT       DS-VHSFVEGLVKSDLEKVYRGNH-----DSGYAPNALSASDEIKQKAYDAFHDAV----
PNP_BIFLO       DE-LYARIDEIAHKDLDEALSIAE-----KLPRQ----DRIHEIKEHVREVLADEF----
PNP_RUBXD       NP-FVEELRGAYLERIKEGLISTD-----RRARH----EAIDLLKEELVEGRSE------
PNP_LEPIC       DEELLSKVKEYAFAKLTTANQTPD-----KTARN----KEISNVNKEVVEFFKDTIED--
PNP_NITSB       ---IWTYVEEIYAADIKEAVQAMA-----KSERN----ELLKEIAKKISEDDVAKEQGW-
PNP_WOLSU       ---IYQYIKENHAIAIKEAITRMA-----KSERH----SDLKRIAKEIASSERAQESEW-
PNP_SULDN       ---MLKYVRSNHYSDIKSAMNQMA-----KSERS----TALRQLRKKI----IITKEEW-
PNP_ARCB4       ---VINYVRDNFSNDIKEAIKKLA-----KSERA----TQLKDVAKMISKNEYCISNEI-
PNP_CAMC5       ---IAIYIDKFYKNDVKNAINQMA-----KSERA----SELGKIAKQIASDEVAQKEGW-
PNP_CAMFF       ---VAIYINEFYKEDVKAAINQMA-----KSERA----SELSKIAKQIALSEVAQKEGW-
PNP_CAMHC       ---IANFIEQNFTSDVQAAINQMA-----KSERA----TELDKIVNKIMQSETAIQNEW-
PNP_CAMJD       ---ILAFIENNFQKQIKKAINQMA-----KSERA----SELNKIAKEILNLEIA--KDW-
PNP_HELHP       ---LLNIIQTHYHTPITEAIKHMA-----KSERH----TQLKALIKQVVRECEIE-----
PNP_HELPH       ---LLDLLKNQYFDEIIKGIESSA-----LSERE----NVFNEIAKKISEA----HSEF-
PNP_HELAH       ---LLDLLKNQYFNEIIKGIESSA-----LSERE----NVFNEIARKISEA----HSEF-
PNP_HELPJ       ---LLDLLKNQYFDEIIKGIESSA-----LSERE----NVFKEVAKKISEA----HSEF-
PNP_SULNB       ---LYAYIKENYSEAVAKAISHMA-----KSERS----TELKKVRAQIMEALESEGKEA-
                                                                            

PNP_FERNB       ---DNNIPEEEQEEYAIPLKEKYDEISKKLMRKIIIERGLRADGRGPKDIRPITCEVGLL
PNP_THEM4       ---EFEIDDEEKLTQEMLLKELFDEKAKKLMRKIIINEGIRADGRTPEEIRPITCEVGVL
PNP_THEP1       ---KLSVTDLEGI--KPFVSELYEDAVKKTMRRLIVEKGIRADGRKPTEIRPISCEVGLF
PNP_PSELT       ---RYGTEKIEEL--SVLLKDKYEEALKYKMRRIIVEEGTRLDMRKPKDIRPITCETGLL
PNP_PETMO       ---KWSVAFFEDK--KRFLENAFEEKLQDSMRKMIINENKRVDGRTCDEIRDITCEVGLI
PNP_AQUAE       ---------PEEL--HFAVKYFYKKLESRLMREKVLKEGVRIDGRKPNEIRPIWIEVHPF
PNP_TREDE       ------QLED--EIQLKLFNALFEEMEYNILRTNILDKGLRVDGRGTKDIRPITCEIGVL
PNP_TREPA       ------QLEN--DVQRRLFDALFHEMEYEILRLNILDRGLRIDGRAIDAIRPIACEVGVL
PNP_BORBU       ------SLEKLTDSNESLFHKAFDDFEKEIVRSSILNDNIRTDGRTPNEIRDIISEVDIL
PNP_DESVV       ------DTTPL-----RAVGDILSALEKRIVRERIVREGRRIDGRDTTTVRPILIEAGIL
PNP_DESAG       ------TPERL-----AALGDILSSLEKRIVRQRILKEGLRIDGRDTKTVRPIIIEAGAL
PNP_LAWIP       ------HSDIL-----NTVSEIIGNLEKKIVRQRIVKENLRIDGRDTITVRPIAIEVGLL
PNP_SYNFM       ------DPDRP-----KQIDNILEDLEKEVVRRMMVEEGRRIDGRRFDEIRPINIQAGVL
PNP_ANADF       ------QKLAAIALREKEIKGYYEDVKYEYMRKMITDERRRIGGRGEADIRKITSEVGLL
PNP_MYXXD       ------TPLV-----EKHAKAVVEDLKYEHMREMTVN-GGRIGDRGHDVVRSITCEVGVL
PNP_SORC5       ------LLPL-----QGLVKAEFEERKAHVVRTYVTEEGRRIDGRDGRSIRPIMCEVGLL
PNP_GEOUR       ---------------DKQIKAFLGDFEYELVREHILKDGERIDGRDTKTIRQITTEVSLL
PNP_PELPD       ---------------EKQIRAFLGDLEYECVRADVLNSGVRIDGRDTVTIRPIATEAGLL
PNP_PELCD       ---------------EDDISEAFGNLQKRLVRQMVARDKVRIDGRDKNTIRPITCEIGLL
PNP_SYNAS       ---------------RLRTAAALEALEKRIVRDVILKEKQRIDGRSYAEIRAISAEVGIL
PNP_DESPS       ---------------ASEISSLLSDFKKTYLREKTVNTGVRIGGRAWDEIRDISSETEYL
PNP_BDEBA       ------LLKQR----KKELNSIVEDLKYQEARSMILDRAVRIDGRDVKTVRPIANEVGIL
PNP_BACV8       ----------ELEEKGALIDRYYHDVEKEAMRRCILDEGKRLDGRKTTEIRPIWCEVGYL
PNP_PORGI       ----------ELAEKAEMIARYYHDVEKEAMRRAILDEGKRLDGRKTTEIRPIWIETDCL
PNP_CYTH3       ----------HTEDL-TLIGKYYHDVEKDAVRNLILDERKRLDGRSLEQIRPIWSEVGYL
PNP_FLAPJ       ----------ELAENGDLVSKYFYKTNKEAVRNVTLDLGTRLDGRKTTEIRPIWCEVDYL
PNP_GRAFK       ----------ELEEYGDLVSDYYRKAEKAAVRDLTLNEGIRLDGRKTDEVRDIWCEVDYL
PNP_SULMW       ----------SIVINNLEIDIIFDEIKKEIIKNILFKENIRLDGRSLDDIRNICSQVDCL
PNP_CHLPD       ------EPEKALCLNAHIIEEEIHAVEKKVMRHMILDDGKRLDGRTLDEIRPISIELGII
PNP_CHLTE       ------DPTSAFCLNEHMIEECIHAVEKKVMRHMILDDGKRLDGRTLEQVRPISIELGLI
PNP_PELLD       ------DPSKALCLNEHIIEEEIHSFEKNVMRRMILDDGKRLDGRNLEQVRPITIELGVI
PNP_CHLCH       ------DTAKALCLNEHIIEDQIHAVEKEVMRHMILDDAKRLDGRALDQVRPITIELGLI
PNP_SALRD       -------SETPEGYTASDIRDAIGEVEKGEMRNMIVEEGKRIDGRDQTDVRDLWMEVGYL
PNP_KORVE       -----------DDAALKKLGKYYELLREDIFRQQVTKEKRRPDGRAFDQIRQIWIEVDVL
PNP_SOLUE       ------------DEQKEQGAKCFDALKERIFRDDMLKKHRRPDGREFDQIRQITIETGVL
PNP_RHOBA       -----------DAVCVNRFKSVWHDLEEKVVRDLILAGTR-PDGRDHNSLRAIHCETDLL
PNP_ECOLI       D----------ETLDENELGEILHAIEKNVVRSRVLAGEPRIDGREKDMIRGLDVRTGVL
PNP_PHOPR       D----------ETLDERELRGMLSSLEKHVVRGRIIAGHPRIDGREKDMVRALDVRTGVL
PNP_HAEDU       D----------ETISEGAIIDIITALESSVVRGRILAGEPRIDGRTVDTVRALNICTGVL
PNP_COLP3       N----------ADVDVQEAKDLFHDLEKTVVRGRITDGNPRIDGRDPESIRALDVMTGVL
PNP_PSYIN       D----------ETLEAKQIGEYLHDLEKTVVRTRIIKGEPRIDGRDPESIRALDVRTGVL
PNP_PSEA6       D----------AEQDAKEVSELLHELESDVVRSRILAGQPRIDGRDPAMIRALDVATGIL
PNP_AERS4       G----------VEDDAKKIGEEFHSLESRIVRGRVVRGEPRIDGRDPEMIRALSVGTGIL
PNP_SHELP       N----------PDADAREIDGLLGSLEKKVVRSRIIAGNPRIDGREPDMVRALSVMAGVL
PNP_IDILO       D----------ENVDLEESGKIFHDLESDIVRSRIIAGEKRIDGRDPDMVRAISVATGVL
PNP_PSEHT       G----------ESLDKQEIGKIFGSLEKKIVRGRIAAGEKRIDGREPDMIRALDVMTGVL
PNP_BUCAP       ------------NIDISEIEDIFEKIEKNIVRKRILNNENRIDGREKDMIRALDIRTGVL
PNP_BUCBP       ------------GIDEFEITSIISNIERKIVRNRVLKNRIRIDGRNKDEIRTLDVRTGVL
PNP_BUCCC       ------------QLTSSKIEESIYFLERNIVRKRILKGKLRIDGRINNEVRKIDVRTGIL
PNP_WIGBR       ------------NTNEEEILYIIQNIERKIVRNRIISGKPRIDGRTEDMVRNLDIHLGIL
PNP_BLOFL       N----------ENIDVNEVMSFLNNLEIKLLRSSILRDNVRFDGRSPDMIREIDISAGIL
PNP_BLOPB       H----------AAVDEKEIMYLLNYLEAQSIRYRILTNKLRIDGRSQDTIRKIDIKTGIL
PNP_BAUCH       -----------ETIEEETISNIFANLEKQIARNRILGGKLRIDGRNHKMIRSLDMRTSIL
PNP_NEIG1       ------------TLAANEIKGIFKRLEADVVRSQILDGQPRIDGRDTRTVRPLNIQTGVL
PNP_CHRVO       ------------TLKANEIKGIFKSLEAEIVRGQILAGEARIDGRDTRTVRPISIRNNVL
PNP_METFK       ------------TSEANEIKSIFHNLEAKVVRSQILNGEPRIDGRDTRTVRPISIRTGVL
PNP_THIDA       ------------TVAANHVKDAFHRLEAGVVRNRILSGQPRIDGRDTRTVRPITIRTGVL
PNP_NITEC       ------------GPSEQTIKEIGFALEAKIVRNSILDGESRIDGRGTRTVRPITIRHGVL
PNP_NITMU       ------------GPDAQAVKEACFALESRIVRSQILDGEPRIDGRDTRTVRPITIRTGLL
PNP_VEREI       ------------ECDTVKAEGLLFDIEAGIVRSQILAGEPRIDGRDTRTVRPIEIRAGVL
PNP_METPP       ------------AVDKVKVENLLFDIEAKIVRSQILAGEPRIDGRDTRTVRPIEIRSSVL
PNP_BORA1       Q----------DAPDGVTVDNILFDLEARLVRSQILNGEPRIDGRDTRTVRPISVRLGVL
PNP_JANMA       A----------AAPDTAEVGNILFDLEAKIVRSQILEGEPRIDGRDTRTVRPITIRTGVL
PNP_RALSO       ------------EADGVEVDNILFELESKIVRGQILNGEPRIDGRDTRTVRPIEIRSSVL
PNP_POLAQ       ------------DVDAVAVNDILFEIEAKIVRSQILNGEPRIDGRDTRTVRPIEIRNGVL
PNP_PARXL       T----------VAADKATVGNVLFDIEAKIVRTQILNGEPRIDGRDTRTVRPIEIRTGVL
PNP_DECAR       ------------APDENTVGNLFHEIEASIVRGRILSGAPRIDGRDTRTVRPITMRSGVL
PNP_AROAE       ------------PPTGNELKDIFHDLEAGVVRSRILAGEPRIDGRDTRTVRPIDIRVGVL
PNP_ALKEH       E----------GGWPEKDVGDAFKGLEKDIVRGRILAGERRIDGRDTRTVRPIDIEVGSL
PNP_HALHL       R----------EGWGAGDVGEAFKTLEKKIVRGRILAGHPRIDGRDNQTVRPLNVQAGVL
PNP_METCA       E----------GAHDENAVKRQIEKLEEEIVRSNILHHGKRIDGRDLSTVRPITIRTGVL
PNP_NITOC       N----------SRWSREQVLEAIGALEKRLVREQILSGGERIDGRDATAIRPINISTGLL
PNP_XYLFT       V----------EGWNLAELLKEFGELEYRTMRDALLDTKVRIDGRSLEAVRPITVKVGVL
PNP_COXBR       E----------NAVNEHELAVIFHELERRIVREQILTGQPRIDGRDTKTVRPITVKVGVL
PNP_DICNV       ------------GWEETLVNEYVHHLAYRIVRDRILKKQPRIDGRDTKTVRPITIHTSVL
PNP_PSEU5       -----------GQPSGGEVKDAFGEIEYRTVRENIVNGKPRIDGRDTRTVRPLAIEVGVL
PNP_SACD2       -----------SGVSADEVKGLFAKIEKQIVRSRVVAGEPRIDGRDSKTVRPLHVEVGVL
PNP_HAHCH       E----------GKFEAELVKKYFSKLEKACVRQNIIKGEPRIDGRDTKTVRDLKIEVGVL
PNP_MARHV       E----------GQPSEEEVKKYFGKVEKSVVRLQVIEGKPRIDGRDNKTVRPIKVEVGVL
PNP_CHRSD       S----------GQYAADDVKGAFASLEKRVVRSRIIQGEPRIDGRDHRTVRPLSIEVGTL
PNP_ALCBS       D----------GAPEADEVKDLFGKIEKSVVREAVVSGKPRIDGRALDAVRAIDCQVGTL
PNP_ACIAD       E-----------TGIADEVNELFEDLKYRTVRDNILSGKPRIDGRDTKTVRAIDVQVGVL
PNP_PSYWF       E----------FAEKEAQIKEIYNDLKYRTVRDAILSGKPRIDGRDLDTVRALDIQVGVL
PNP_HYDCU       P----------EGYDAGDIEKMVGKLQKEIVRGRIIAGEPRIDGRDTQTIRSIDCQVGIL
PNP_LEGPA       N----------DELNADVIANMFGELERSIVRNRILDGEPRIDGRDHRTVRPISIRTKFL
PNP_VESOH       E----------NGNSAEEVSKYFKEVEKSTVRERILNNDSRIDGRNNETVRELKIETGIL
PNP_FRATW       -----------NEYTEKEILEAFHDIEKDLVRSNILEGKPRIDGRCTETIRPINVKIGVL
PNP_GRABC       S----------------IAKSMLKDLEADIVRNAILDTGIRIDGRDTRTVRPIIGEVGIL
PNP_ACICJ       -----------------KAKGMFKELEADIVRNAILDNGIRIDGRDTRTVRPILAEVGVL
PNP_GLUOX       -----------------LAKPMLKELEAQVVRGSILKTGIRIDGRDLKTVRPILAEVGIL
PNP_MAGSA       -----------------VAGGILKHLEADVVRGNILKTGVRIDGRDTKTVRAIEVEVGVL
PNP_RHORT       -----------------LAGAAFKDLEKDIVRGSILDTGLRIDGRDTKTVRPIEIYPGIL
PNP_CHESB       K------------WTPEQVATVFKALQAKIVRWNILDTGSRIDGRDLRSVRPIVAEVGVL
PNP_BARBK       E------------LTADKIATVFKRLQAKIVRWNILDTGKRIDGRDLSTVRPIQSEVGIL
PNP_NITHX       E----------PKYDKLRIAAVFKHLEAKIVRWNILDTGKRIDGRDAKTVRNILAEVGVL
PNP_AZOC5       E-----------APKAQDVAEVLKGLEAKIVRWAILDDGIRIDGRDVKTVRPIVSEVGIL
PNP_PARL1       V-------------SETDVGGVFKSIESDVVRNSILDTKSRIDGRDLETVRPIVSEVGVL
PNP_MARMM       G------------IDMTTLKDVMKAVESSIVRGGIIKTGKRIDGRSLDQVRSIVSEAGIL
PNP_CAUVC       G------------YDPLKLGAIFKELEADVVRRGILDTGLRIDGRDVKTVRPILGEVGIL
PNP_HYPNA       V------------MTPEVFKTVFKEAEASVVRGDILKTGQRIDGRKLDQIRPIVAEAGFL
PNP_PARDP       -------------LLDPNLGSALKKLESGILRGGIIDGRPRIDGRDNKTVRPIDCEVGFL
PNP_SPHAL       -----------DPQAVMAGIKIVKKLEAEIVRTAILKEGKRIDGRTTTQIRPIVAETHFL
PNP_NOVAD       ------------AQTQMVAMKTMKKVEADIVRGAILKDGQRIDGRTTTQVRPIEAIVGFL
PNP_ERYLH       -----------DPAEYMGRLKLVKKLESDIVRKAILKDGQRIDGRKTDEVRPIEAMVGLL
PNP_ZYMMO       ------------PTEKLRIQKLAKKLEAKIVRTAILKEGRRIDGRDLKTVRPIRSQVGFL
PNP_PELUB       -------------YSDFNVNDELKNLEKKIVRTDILKNKKRIDGRGLADVRAIECEVGVL
PNP_MAGMM       S-----------VKRSEEVASLFKKIESRTLRQNVLQ-GKRVDGRGLTDIRPIACEVSIL
PNP_RICTY       -------------YNNYQIESTLKAISADILRNKILEQNIRIDGRSTTDIRQIACEVGLL
PNP_ORITB       N----------DGDDILNIEKALDDAKSKIFRDLVLQNKTRIGNRAVDEIRPIICEAGLF
PNP_ANAMM       -----------GEYTEQEVLLAIKTFERSLVRARVLDTLKRVDGRGFDQIRNIEIEVDLI
PNP_ANAPZ       E--------GGSKYIAQDIVYAMKTFERSLVRERVLESKSRIDGRAYDQIRNIEIEVDLI
PNP_EHRRW       GN-------LQCQYSSQDIISALKSFERSLVRSKIIETSSRIDGRAFNGIRDIEIEIDVL
PNP_WOLTR       -----------------LITQAVKNFERSLLRKIIREKGTRIDGRKYDEIRQIEVEVDIL
PNP_NEOSM       -----------------EVLFFIKKLEKEIVRKNVLEEGIRPDGRSLTEIRPISIALDYL
PNP_CHLCV       ------------IFTALNIKTAFKQAKSDYMRALIREQSVRSDGRAITTIRPISIDTSFL
PNP_CHLPN       ------------LFSSFNIKAACKTLKSDTMRALIRDREIRADGRSLTTVRPITIETSYL
PNP_CHLMU       ------------DFSLLNVKAAFKNAKSNQMRALIRDLGIRVDGRSTTEIRPISIEVSFL
PNP_PARUW       ------------KYPAKHIAYVIKDVSSKMMRQMILNENVRSDGRTSTDIRFIDIEQSLL
PNP_BACCN       ----------VEAEVLGQVSEILYKIVKEEVRRLITVEKIRPDGRKSDEIRPLASEVGIL
PNP_GEOTN       ----------ADEEKLKQVQEILHKLVKEEVRRLITVEKIRPDGRKVDEIRPLSSAVGIL
PNP_OCEIH       ----------VEEDVIKQVKSILDSMVKEEVRRLITKEKIRPDGRKVDEIRPLSSRIHVL
PNP_BACHD       -----------EDVPLSEVNEILHKIVKEEVRRLITVEKIRPDGREIDEIRPLSSQVGIL
PNP_BACSK       -----------DSINVDEVKEILQMFVKEEVRRLITVEKIRPDGRGVDEIRPLSSQIKLL
PNP_LISIN       --------LENEAEILGEVAHILEMIEKDEMRRLISQDKIRPDGRKVNEIRPLSSEVGML
PNP_ENTFA       --------HEEEAQLLKEVKQIAEDLEKDVVRELITIDKIRPDGRKLDEIRHLSSEVSIL
PNP_STAS1       --------DADNEVLIKEVNSILNDLVKEEVRRLIAEEKIRPDGRKTDEIRPLESEVGVL
PNP_STRMU       --------HEEHDRIMRDVAEILEQMEHAEVRRLITEDKVRPDGRRVDEIRPLDAEIDFL
PNP_STRTD       --------DEDKETILRDVVEILEQMEHAEVRRLITEDKVRPDGRRVDEIRPLDAEIDFL
PNP_LACLA       --------DENLSIILRDLAEILEGMEHAEVRRLITEDKIRPDGRKIDEIRPLDAEIDFT
PNP_SPICI       --------EKEQKQLTVELKTALHNIIRQEVRRQILIDKTRLDGRKLDQIRPLSSEIDIL
PNP_ONYPE       IDTATVFDYEAHKKHLQTTETLFQKLSKQETRSLILQEKIRPDKRGLEEIRTLESQIDLL
PNP_ACHLI       VDGKEVLDADQKKELMNQVKVSLDRIVTKEVRRLITEDKVRPDGRGLDEIRPLASSVDLL
PNP_FUSNN       PE------EELPEDIILEFKTYYHDLMKKLVREAILYHKHRVDGRTTTEIRPLDAQINVL
PNP_TRIV2       -EDPIRLAATA---NSKALGNTFKDITKYFMRRQIVEDNVRVDGRKLDQVRPVSSQVGVL
PNP_TRIEI       -EEAVRAMVES---ESMLLGNAFKSVTKKLMRQQIVAEGIRVDGRKLDEVRPVSCRVGVL
PNP_ACAM1       -TDPVQVAAVE---NPKAIGKVFKSITKTLMRRQVVEDKVRVDGRKLDEVRPISCNVGVL
PNP_SYNE7       -EDPVRSVTAA---EPKALGNTFKALTKTLMRQQILRDGVRVDGRKLDQVRPISSQVGLL
PNP_SYNY3       -TDPVKQSVEE---DPKLVGNLYKALTKKLMRKQIVDDGVRVDGRKLEQVRPISCEVGFL
PNP_THEEB       -DDPVAVAAAE---NPKALPTLFKAVTKKLMRQQIIEEGVRVDGRRLDEVRPIWCEVGVL
PNP_PROMA       -DNAVKKSITT---NTKLLGISFKALTKKLMREQIIKDGKRVDGRALDEVREISAEAGIL
PNP_PROMP       -DNQLKVLTSE---NEKLIHSDFKKLTKKLMRSQIINEGKRVDGRDLDEVRKISASAGIL
PNP_SYNR3       -TDAVRAAVSS---NGKLLGNSFKALTKSMMRAQIVKDGKRVDGRSLDQVRPISAAAGVL
PNP_SYNJA       -GDPLRLYLLE---NPKELDNQFKALTKKLMRQQILQEGVRVDGRKLDEVRPVSCRVGLI
PNP_GLOVI       -EDPLREKAAA---NASKLPALFKSTTKKLMRKQILVEGKRVDGRSLDEVRPISSAVRVI
PNP_DEHM1       -GD---------------ILAAYDKEIKKAIRSTILEKDIRVNGRGIKQLRQLDAETGIL
PNP4_ALKMQ      ----QYENEL------KSIVEVINSIIKEQFRYMITHDKVRPDERALDEIRPITSEVGIL
PNP_ALKOO       ----KYQEELN---L-KQIHTILDSILKEETRNLILYDKKRPDDRQHDEIRPISCEVDLL
PNP3_ALKMQ      ----KYEGRS------KEVHDILSMLIKVETRKMITSEGIRPDNRKLDEIRPISTQVGIL
PNP_CLOD6       ----TLEDFED---FVGDIEEVLQDIIKEEVRKLIVHENVRPDNRKLEEIRPIWCETGMI
PNP_CALS8       ----ETEDTL------LLVDDALYNLEKEIVRKMIAEEGKRPDGRKFDEIRPLYAEVGIL
PNP_CALS4       ----EYPDNL------ADIDEVLYKIMKEQMRKMIKEEKIRVDGRGLDDIRPIWCEVGVL
PNP_CLOPS       ----KYPDNM------SDIGEAVYDMQKEVVRHMLLKEGKRPDGRAFDEVRNIGCEVGLL
PNP_CLOB8       ----KYADKM------GDIKEVLYTMQKKVVRHMLLKDKRRPDGRAFDQIRPLGCEIGIL
PNP_CLOBL       ----KYEDKG------ADIKEVIYKTQKEIVRNMLLNEDRRPDGRAFDEVRPIGCEVGIL
PNP_CLOTE       ----KYPEND------SDISEALYKMQKEVVRNMILREKRRPDERAFDEIRKISCEVGLL
PNP_CLONN       ----KYPDNL------GDIGEAIYKMQKEVVRNMILNEKRRPDGRYFDEIRPLSSEVSLL
PNP_CLOAB       ----KYPDDG------ADIDEVVYTLQKKVVRNMLLKEHRRPDGRRFDEIRPISCDVDLL
PNP_LACP7       ----SNPEWL------HLIDEAVYKYQKKTVRKMILKDHKRPDGREIHQIRRLAAEVDML
PNP_HUNT2       ----VFPEME------PAIKEAIYKLEKKVVREYILEEGRRVDGRRLDEIRPLSAEVGLL
PNP_CARHZ       ----TYPEEE------LTIKGILDSIQKEIVRQKILKEGIRIDGRKTDEVRPIWCEVGLL
PNP_MOOTA       -ALAANPELP------GLIKELITKIEKEIVRRMILTEGIRVDGRTLEEIRPITCEVGVL
PNP_DESRM       ----QFPENP------KEVTMLIEKAEKKVVRRIITHDKLRIDGRAIDEIRPISVEVGVL
PNP_PELTS       ----DYPEQE------SLIKDLLDSIEKKLVRRMITEEGLRIDGRALNEVRPISVEVGVL
PNP_DESHY       ----QYPEDS------KTIDKILEDFVHKIVRRLITVEHIRPDGRALDEIRPISVEVGIL
PNP_SYNWW       ----SYPEEE------KLIADVSDETMKAVVRKMALEEGERVDGRKLDEIRKVSCEVGFL
PNP_SYMTH       ----QFPESE------KHIAYLLKKVLKEEVRRAIIEEGIRPDGRSLTEIRPIECAVDLL
PNP_CHLAA       ---EPEEEIAN---RTKEVTKAFEKLLKDEVRNAILDEGIRVDGRALDEIRPISIEVGVI
PNP_ROSS1       ---EPEEELEA---RIAAVSTAFENLLYEEVRRMILERGERVDGRGPKDIRPISIEVGLI
PNP_DEIRA       -TAEGSAEL-----TQAL-KDAFGKVEKRELRRLILEENLRADGRDSKTVRPIWIEARPL
PNP_THET8       -EDGTPDEG-----KKPLYESAFDEVVRRELRRLVLEEGKRADGRGPKDLRPIWIEVDVL
PNP_RENSM       ----KFDGR------EKEISAAFRSVTKQVVRQRILKDQIRIDGRGLTDIRQLTAEVEVL
PNP_KINRD       ----AFAGR------EKEVSAAYRSVQKALIRQRVLKDGVRIDGRGLADIRTLSAEVEVL
PNP_STRAT       ----EFEGR------EKEISAAYRPWPSSSSAERVIKEKKRIDGRGVTDIRTLAAEVEAI
PNP_NOCSJ       ----QFEGR------EKEIGAAFRSVNKQVVRESILRDKVRIDGRGLADIRPLHAEVGVI
PNP_ACIC1       ----RFAGR------EKEILAALRALTKKLVRERIIREKVRIDGRGLTDIRPLTAEVGIV
PNP_CUTAK       ----TFPER------EAEISGAFKAVMKKIVRKRVLDEGVRIDGRGPRDIRSLSAEVGII
PNP_FRACC       ----QFEGR------EKEIGAAYRALTKKLVRSRIVTESVRIDGRSTTEIRALSAEVDYI
PNP_THEFY       ----DFEGR------EKELAAAFRALTRKLVRERIVKDGVRIDGRGVKDIRSLTAEVNVI
PNP_RHOJR       ----NFEGR------EKELGAAFRSLTKKLVRQRILRDQFRIDGRGITDIRSLSAEVAIV
PNP_SACEN       -EGEQFEGR------EKEVGAAFRSLTKKLVRQRIIRDQVRIDGRGLTDIRSLSAEVGVI
PNP_SALTO       ----RFEGR------EKELSAALRSLTKSEVRSRVLREQVRIDGRGPRDIRPLTAEVGVL
PNP_COREF       ----RFEDDLGAAVASKEIRAAYNSLMKKIVRGKILSEGFRIDGRGVSDIRDLGVEVELI
PNP_CORDI       ----QLGSD-DEAAASKAIRAAYNAVMKKIVRHMILTEHFRIDGRGVTDIRDLGVEVDLI
PNP_CORJK       ----EFPER------EAEIRAAHNEVTKAVVRRRILEDGFRIDGRDSTTIRDLGIVVQLI
PNP_LEIXX       -QAGALDAE-----ALTQFSAAYKSVSKVVMRGRVLREGVRIDGRGLTDIRPLDAEVQII
PNP_TROWT       -LSGRFDQD-----SLSQFPHAYKAVLKDVVRTCVLEGFARMDGRGLSDIRPLDAEVQVV
PNP_BIFLO       -TDMDDAEK------DKELGNAFKELQRQIVRRRILTEDYRIDGRGLRDIRTLSAEVDIV
PNP_RUBXD       -------EE------VPLVLDALAQLQKEAFRKLYLEDRKRTDLRAFDEIRPTTAEAHVL
PNP_LEPIC       ------------SDKIKDIKAYLHELEYEIVREQVLTKGTRFDGRKLDEIRSISVEINPL
PNP_NITSB       --------------EYETIYKVVEKYKRKIVREMILNEGKRADGRGLKDVRPIDIKTNIL
PNP_WOLSU       --------------SFEAVYETVGKYKREAVRALILEERRRADGRGLKEVRPIDIQTNIL
PNP_SULDN       --------------DEVELKDVIESVKKEQVRGQILNDRVRADGRALNEIRPISISTNVL
PNP_ARCB4       --------------EFNTIYEAVSVVKREIVRAMIVNERVRADGRGLKDVRPISIETNIL
PNP_CAMC5       --------------EEGVISNVLGKYKKKIVREQIINEGVRADGRALDEVRPISIETNVL
PNP_CAMFF       --------------DEALISNILGKYKKKLVRTGIIKDKKRADGRGLKDVRPISIETNIL
PNP_CAMHC       --------------QKNVVSNIIGKFKRKIIRSQIINERRRADGRALDEIRPISIETNIL
PNP_CAMJD       --------------SEESILNTLAKVKRKLIREQILNEGKRADGRSLNEVRPISIETNIL
PNP_HELHP       --------------DEKKVQEHIMAYKRKLVREMILQSHIRADGRGLKDVRPISIQTNIL
PNP_HELPH       --------------SLEEIEWSLEKVKKTEIRRMIIQDKIRPDKRALEEVRPILIESDLL
PNP_HELAH       --------------NLEEIELSLEKVKKTEIRRMIIRDKIRPDKRALEEVRPISIESNLL
PNP_HELPJ       --------------SLEEIELSLEKVKKTEIRRMIIQDKIRPDKRALEEVRPISIESNLL
PNP_SULNB       --------------DKELVSKVLDRYKTTVVRDMILDKGIRADGRGLDEVRPITIETNIL
                                                          . *    :*         

PNP_FERNB       P--RTHGSSLFTRGETQSLGIVTLGSPAEEQIIDTLI-EEGT-KRFILHYNFPPFSTGEV
PNP_THEM4       P--RTHGSALFTRGETQSLGIVTLGAPMEEQIVDTIM-EEGT-KRFILHYNFPPFSVGEV
PNP_THEP1       P--RTHGSALFTRGETQSLGIVTLGAPMDVQIIDTLL-EEGV-KRFMLHYNFPPFCTGEV
PNP_PSELT       P--RVHGSALFTRGETQSLGIVTLGAPMDEQIIDSLL-EEGT-KRFMLHYNFPPFSTGEV
PNP_PETMO       P--RVHGSALFTRGETQSLGTVTLGAPLDVQVLDTIF-SDEE-KRFMLHYNFPPFSTGEV
PNP_AQUAE       E--RPHGNAIFTRGQTQAYVTVTLGTPDEALIIETIA-EGEVFKRFMLHYSMPPFSVGEA
PNP_TREDE       P--RPHGSAVFTRGETQSLGVVTIGTVFDEQIYDDIE-GDRR-ENFILHYNFPPFSVGEV
PNP_TREPA       P--RPHGSAVFTRGETQSLAVVTLGAMSDGQVYDDIE-GDRR-ENFILHYNFPPFSVGEI
PNP_BORBU       S--RTHGSALFTRGETQALAVTTLGTSIDEQIMDDID-GDKR-LNFMLHYNFPPFSVGET
PNP_DESVV       P--RAHGSALFARGETKSLVVATLGSSTDEQRMDSLT-GDVTK-RFMLHYNFAPYCVGEV
PNP_DESAG       P--RAHGSAIFSRGETKSLVVTTLGSTTDEQRMDSLT-GDVTK-RFMLHYNFPPYSVGEV
PNP_LAWIP       P--RTHGSALFTRGETQSLCITTLGSSTDNQRVDSLA-GDTVK-NFMLHYNFPPFSVGEV
PNP_SYNFM       P--RTHGSAVFTRGETQVLAVVTLGSSSDEQKIEALA-GETFK-SFMLHYNFPAFSVGEV
PNP_ANADF       P--RVHGSSLFTRGETQALVATTLGTAEDEQRVEMLT-GMVFK-RFMLHYNFPPFSVGEV
PNP_MYXXD       P--RTHGSAVFTRGETQALVVTTLGTSDDEQRLEMLG-GMAFK-RFMLHYNFPPFSVNET
PNP_SORC5       P--RVHGSALFQRGETQAIVTTTLGTSTDEQKIDGLM-GETWK-RFYLHYNFPPFSTGET
PNP_GEOUR       P--RAHGSALFTRGETQSLVAATLGTSIDEQRIDSLF-GESKK-RFLLHYNFPPFSVGET
PNP_PELPD       P--RTHGSALFTRGETQALVVTTLGTSSDEQRMDSLY-GEYRK-RFLLHYNFPPFSVGET
PNP_PELCD       P--RAHGSALFTRGETQALVAAALGTSKDEQRMDNVQ-SMEFK-KFMLHYNFPPFCVGET
PNP_SYNAS       P--RAHGSALFNRGETQSLAALALGTSSDEQRLDYVA-GEETR-SFILHYNFPPYCVGEA
PNP_DESPS       P--KTHGSALFTRGETQALVTATLGSERDKQRVETLN-GETSR-RFMLHYNFPPYCVGEA
PNP_BDEBA       P--RAHGSGLFTRGETQVLGTVTLGTADDEQMVDSLL-GLQKR-KFMLHYNFPPYSVGEV
PNP_BACV8       P--GPHGSAIFTRGETQSLTSVTLGTKLDEKIVDDVL-DQHRE-RFLLHYNFPPYSTGEA
PNP_PORGI       P--GPHGSAIFTRGETQSLTTVTLGTKSDEKLVDDVL-NYTKE-RFLLHYNFPPFSTGEA
PNP_CYTH3       P--SAHGSAIFTRGETQSLTTVTFGTRLDEQMIDSAM-FSGNN-KLMLHYNFPGFSTGEV
PNP_FLAPJ       P--SVHGSALFTRGETQALATATLGTSREANQIDSPS-QQGEE-KFYLHYNFPPFSTGEA
PNP_GRAFK       P--SVHGSSIFTRGETQALATVTLGTSRDANQIDMPS-HEGEE-RFYLHYNFPPFCTGEA
PNP_SULMW       P--GVHGSAIFTRGETQALSTVTLGSSLDVNKIDNAI-MRAKQ-RFYLHYNFPPFSTGEI
PNP_CHLPD       P--RAHGSALFTRGETQALVTITLGTKKDAQSVDTLT-DSADK-RFMLHYNFPPFSVGET
PNP_CHLTE       P--RAHGSALFTRGETQALVTLTLGTKKDAQSVDTLT-DDKDK-RFMLHYNFPPFSVGEI
PNP_PELLD       P--RAHGSALFTRGETQALVAVTLGTKKDAQSVDTLT-NSADK-RFMLHYNFPPFSVGEV
PNP_CHLCH       P--RAHGSALFTRGETQALVTLTLGTQKDAQSVDNLT-NSDDK-RFYLHYNFPPFSVGEC
PNP_SALRD       P--RVHGSAIFTRGETQVLGSITLGTSDDVQPVDEVF-ADTDK-SFYLHYRFPPFSVGEA
PNP_KORVE       P--RTHGSAVFTRGETQALVTTTLGTGDDMQRMEGFE-GEAKK-RFMLHYNFPPFSVGEV
PNP_SOLUE       P--RVHGSTLFTRGETQALVTVTLGTKDDEQRIELLEPGEASK-RFMLHYNFPPFSVGEV
PNP_RHOBA       P--RVHGSALFQRGETQALITIALGTSRDEQRVDGLQ-DEYSK-KFMLDYNFPSYSVGEC
PNP_ECOLI       P--RTHGSALFTRGETQALVTATLGTARDAQVLDELMGERTDT--FLFHYNFPPYSVGET
PNP_PHOPR       P--RTHGSSLFTRGETQALVTATLGTQRDAQIIDSIMGEKKDH--FLLHYNFPPYCVGET
PNP_HAEDU       P--RTHGSAIFTRGETQALAVATLGTERDAQIIDELTGEKSDR--FLFHYNFPPYSVGET
PNP_COLP3       P--RTHGSAVFTRGETQALVTATLGTQRDAQRLDTLMGDKTDP--FMLHYNFPPYCVGET
PNP_PSYIN       P--RTHGSALFTRGETQALVTATLGTQRDAQIIDSIMGEKKDN--FLLHYNFPPYCVGET
PNP_PSEA6       P--RTHGSALFTRGETQAIVAATLGTERDAQMIDGLNGKVDSR--FMLHYNFPPYCVGET
PNP_AERS4       P--RAHGSALFTRGETQAIVVATLGTERDAQNIDELAGHRADR--FMLHYNFPPYCVGET
PNP_SHELP       P--RTHGSALFTRGETQALVTCTLGTERDAQKIDSIMGEQTSR--FMLHYNFPPYSVGET
PNP_IDILO       P--RTHGSALFTRGETQALVTATLGTDRDAQMIDELTGMNTNR--FMLHYNFPPYCVGET
PNP_PSEHT       P--RTHGSAIFTRGETQALVTATLGTERDSQLIDDLTGTHKNH--FMLNYNFPPFCVGET
PNP_BUCAP       P--RTHGSSLFTRGETQSLVSVTLGTSRDAQNLDELLGDKTDN--FLFHYNFPPYSVGEI
PNP_BUCBP       P--RVHGSALFTRGETQSLVSVTLGTSRDAQNLDELLGDKTDN--FLFHYNFPPYAVGEI
PNP_BUCCC       P--RVHGSALFTRGETQALVSATLGTSRDAQNLDDLLGDRTDN--FLFHYNFPPYSVGEI
PNP_WIGBR       P--RTHGSSLFTRGETQALVTTTLGTERDAQNIDDLVGDKIDR--FLFHYNFPPYCVGEV
PNP_BLOFL       P--RTHGSALFTRGDTQALVTATLGTERDAQNLDELTGDRVDR--FLLHYNFPPYCTGEI
PNP_BLOPB       P--RTHGSALFTRGDTQALVAVTLGTERDAQNIDGLTGIRVDR--FLLHYNFPPYCVGEI
PNP_BAUCH       P--RTHGSALFVRGETQALVTVTLGTERNAQNIDELIGERTDR--FLLHYNFPPYCVGEI
PNP_NEIG1       P--RTHGSALFTRGETQALAVATLGTSRDEQIIDALSGEYTDR--FMLHYNFPPYSTGEV
PNP_CHRVO       P--RTHGSALFTRGETQALVVATLGTKQDEQIIDALAGEYTER--FMLHYNFPPYSTGEA
PNP_METFK       P--RTHGSALFTRGETQALVVATLGTGRDEQIIDALQGEYADR--FMLHYNMPPYATGET
PNP_THIDA       P--RAHGSALFTRGETQALVVTTLGTGRDEQTIDALEGSYSDR--FMLHYNMPPYATGET
PNP_NITEC       P--RTHGSALFTRGETQALVVTTLGTARDEQKIDALQGDYSER--FMLHYNMPPFATGET
PNP_NITMU       P--RTHGSALFTRGETQALVVATLGTGRDEQKIDALQGDYSER--FMLHYNMPPYATGET
PNP_VEREI       P--RAHGSALFTRGETQALAVATLGTERDAQRIDALAGEYDDR--FMLHYNMPPFATGEV
PNP_METPP       P--RTHGSALFTRGETQALVITTLGTERDTQRIDALAGEFEDR--FMFHYNMPPFATGET
PNP_BORA1       P--RAHGSALFTRGETQALVVATLGTKQDEQIIDALMGEYRDR--FMLHYNMPPFATGET
PNP_JANMA       P--RTHGSALFTRGETQALVIATLGTARDEQKIDALMGEYSDR--FMLHYNMPPFATGET
PNP_RALSO       P--RAHGSALFTRGETQALVVATLGTKSDEQIIDALQGEYRDR--FMLHYNMPPFATGET
PNP_POLAQ       P--RTHGSALFTRGETQALVVATLGTARDEQIIDALEGEYRDR--FMFHYNMPPFATGET
PNP_PARXL       P--RTHGSALFTRGETQALVVATLGTKGDEQNIDALEGEYRER--FMLHYNMPPFATGET
PNP_DECAR       P--RTHGSALFTRGETQALAVATLGTNRDEQIIDALAGEYRDR--FMLHYNMPPYATGEC
PNP_AROAE       P--RTHGSALFTRGETQALVIATLGTGRDEQIIDAIAGEYRES--FLLHYNFPPFSTGET
PNP_ALKEH       P--RTHGSAIFTRGETQAVVVTTLGTGRDAQIIDAIEGERKEQ--FMLHYNFPPYCVGET
PNP_HALHL       P--RTHGSAIFTRGETQAIVVSTLGTGRDAQVIDALEGERREP--FMLHYNFPPYCVGET
PNP_METCA       P--RTHGSALFTRGETQALVVATLGTGRDAQLIDALEGEYKEN--FMLHYNFPPYCVGET
PNP_NITOC       P--RTHGSALFTRGETQSLVATTLGTERDAQVIDAIEGERRER--FMLHYNFPPYCVGET
PNP_XYLFT       P--RVHGSGLFTRGETQAIVVTTLGTARDGQVIDAVTGEYKEN--FLFHYNFPPYSVGEC
PNP_COXBR       P--RSHGSALFTRGETQALVVTTLGTERDAQSIDDLDGDRQEE--FIFHYNFPPFCVGEV
PNP_DICNV       P--RAHGSALFTRGETQALVVATLGTGRDAQLLDTLDGEVRDN--FMLHYNFLPFSVGEI
PNP_PSEU5       D--KTHGSALFTRGETQALVVATLGTARDAQLLDTLEGEKKDA--FMLHYNFPPYSVGEC
PNP_SACD2       P--KVHGSALFTRGETQALVVSTLGSARDAQIIDALEGERKDP--FMLHYNFPPYSVGEC
PNP_HAHCH       P--NTHGSALFTRGETQALVTATLGTMRDVLMVDALEGEKKDS--FMFHYNFPPYSVGEA
PNP_MARHV       P--SVHGSALFTRGETQAIVTATLGTTRDVQIIDALEGERKDP--FLFHYNFPPYSVGEA
PNP_CHRSD       P--KTHGSAVFTRGETQAVVVATLGTLRDAQLIESLEGERKDR--FLLHYNFPPYSVGEA
PNP_ALCBS       A--KTHGSALFTRGETQAIVTATLGGMRDAQFIDALEGSHQDH--FMLQYNFPPYCVGET
PNP_ACIAD       D--RAHGSALFTRGETQALVTTTLGNTRDALMVDTLAGTKTDN--FMLHYNFPAYSVGET
PNP_PSYWF       P--YTHGSALFTRGETQALVTTTLGNSRDVNLIDSLAGTIQDH--FMLHYNFPHYSVGET
PNP_HYDCU       P--KVHGSALFTRGETQAIVVTTLGTEKDAKMVDDLTGSYNDR--FMLHYNFPPYSVGEC
PNP_LEGPA       E--RTHGSCLFTRGETQAIVVATLGNERDAQILDGISGETRDR--FMLHYNFPPYSVGET
PNP_VESOH       K--NTHGSALFTRGETQALVVTTLGPKSDAQLIEKLESPERQNNYFLLHYNFPPYCVGET
PNP_FRATW       P--GVHGSALFTRGETQALVVTTLGSDRDAQLVESLDGIEKCR--YMLHYNFPPYSVGEC
PNP_GRABC       P--RAHGSALFTRGETQALCVATLGTGQDEQVVDALTGEYRSH--FMLHYNFPPYSVGEA
PNP_ACICJ       P--RTHGSALFTRGETQALVVATLGTAQDEQIVDAIEGEYRER--FLLHYNFPPFSVGET
PNP_GLUOX       P--RAHGSSLFTRGETQALVVATLGTGQDEQIIDALEGEYRSN--FMLHYNFPPYSVGEC
PNP_MAGSA       P--RAHGSALFTRGETQALVVATLGTGQDEQIIDQLAGEYREH--FMLHYNFPPYSVGEA
PNP_RHORT       P--RAHGSALFTRGETQALVTTTLGTGQDEQIIDALEGEYREN--FMLHYNFPPYSVGEA
PNP_CHESB       P--RTHGSAVFTRGETQALVVATLGTGEDEQYVDSLTGTVKET--FMLHYNFPPYSVGET
PNP_BARBK       P--RTHGSALFTRGETQALVVATLGTSEDEQYVDLLTGVCKET--FLLHYNFPPFSVGET
PNP_NITHX       P--RAHGSALFTRGETQAMVVTTLGTGEDEQYIDALSGTYKET--FLLHYNFPPYSVGET
PNP_AZOC5       P--RAHGSALFTRGETQALVVATLGTGEDEQFIDSLEGTYKEH--FLLHYNFPPFSVGET
PNP_PARL1       P--RTHGSALFTRGETQALVVATLGTGDDEQFIDALEGTYKEN--FLLHYNFPPFSVGET
PNP_MARMM       P--RTHGSALFTRGETQALVVATLGTGEDEQFIDALTGTYKER--FMLHYNFPPYSVGET
PNP_CAUVC       P--RTHGSALFTRGETQAIVVATLGTGDDEQFIDALEGTYKES--FLLHYNFPPYSVGET
PNP_HYPNA       P--RTHGSSLFTRGETQAICVATLGTSDDEQYIDGLDGTKKEK--FMLHYNFPPYSVGET
PNP_PARDP       P--RTHGSSLFTRGETQALVVTTLGTGDDEQIIDALHGNSRSN--FLLHYNFPPYSVGEV
PNP_SPHAL       P--RAHGSALFTRGETQTIATCTLGTKDAEQMIDGLNGLSYQH--FMLHYNFPPYSVGEV
PNP_NOVAD       P--RTHGSSLFTRGETQAICTTTLGTKDAEQMIDGLEGLRYEN--FMLHYNFPPYSVGEV
PNP_ERYLH       P--RTHGSALFTRGETQAICTTTLGTKDSEQMIDGLEGLSYSN--FMLHYNFPPYSVGEV
PNP_ZYMMO       P--RTHGSALFTRGETQALVSTTLGTADAEQMIDGLTGLHYER--FMLHYNFPPYSVGEV
PNP_PELUB       P--RTHGSALFTRGETQAIVVTTLGTSDDEQRLESLDGQHRER--FMLHYNFPPFSVGET
PNP_MAGMM       P--RVHGTALFTRGETQAIATVTLGTSRDEQIVETLSGEYRDR--FYLNYTFPPYCVGET
PNP_RICTY       P--SAHGSALFTRGETQSLVSTTFGTSLDEQIVDSLEGEYKER--FMLNYIFPPYSVNEA
PNP_ORITB       N--TVHGSALFTRGDTQSLATITLGSSTDEQIVEQLNKCERQN--FLLDYIFLPYSVGEI
PNP_ANAMM       P--RSHGSALFTRGDTQALVITALGTPQDEQVVDGFDGDRRER--FLLHYNFPSYAVGEA
PNP_ANAPZ       S--KAHGSALFTRGDTQALVITALGTPQDEQIVDGFDGDKRER--FLLHYNFPPYAVGEA
PNP_EHRRW       P--KTHGSALFTRGNTQALVVTALGTPQDEQIVDDLDGDRREN--FLLHYNFPPYAVGES
PNP_WOLTR       S--RTHGSALFTRGSTQALVVTALGTTQDEQIVDDIEGDRREH--FMLHYNFPSFAVGDA
PNP_NEOSM       P--GTHGSALFTRGGTQSLVVATLGSYQDEQVMDDIDGERRES--VLLHYNFLPYAVGEV
PNP_CHLCV       P--RTHGSCLFTRGETQTVAVCTLGSEAMAQRYEDLNGEGLAK--FYLQYFFPPFSVGEV
PNP_CHLPN       P--RTHGSCLFTRGETQTLAVCTLGSEAMAQRYEDLNGEGLSK--FYLQYFFPPFSVGEV
PNP_CHLMU       P--RTHGSCLFTRGETQSVAVCTLGGESMAQRFEDLNGDGAAR--FYLQYFFPPFSVGEV
PNP_PARUW       P--RAHGSSLFTRGETQALAVCTLGGASMAQRFEDLEGEGNNR--FYLQYSFPPYSVGEV
PNP_BACCN       PR--THGSGLFTRGQTQALSICTLGALGDVQIL-DGLGVEE-SKRFMHHYNFPSFSVGET
PNP_GEOTN       PR--THGSGLFTRGQTQVLSVCTLGALGDVQIL-DGLDLEE-SKRFMHHYNFPPFSVGET
PNP_OCEIH       PR--THGSGLFTRGQTQALSVCTLGALGDVQIL-DGLDLEE-SKRFMHHYNFPQYSVGET
PNP_BACHD       PR--THGSGLFTRGQTQALSICTLGALGDVQIL-DGLGIEE-SKRFMHHYNFPQFSVGET
PNP_BACSK       PR--THGSGLFTRGQTQALSVCTLGALGDVQVL-DGLGIEE-TKRFMHHYNFPQFSVGET
PNP_LISIN       PR--VHGSGLFTRGQTQALSVCTLAPLREHQII-DGLGTEE-YKRFMHHYNFPQFSVGET
PNP_ENTFA       PR--VHGSGLFTRGQTQALSVCTLAPLGEHQII-DGLGVQD-SKRFIHHYNFPQFSVGST
PNP_STAS1       PR--AHGSGLFTRGQTQALSVLTLGSMSEYQIL-DGLGEEE-QKRFMHHYNFPNYSVGET
PNP_STRMU       PK--VHGSGLFTRGQTQALSVLTLAPMGDTQIV-DGLDEEY-KKRFMHHYNFPQYSVGET
PNP_STRTD       PK--VHGSGLFTRGQTQALSVLTLAPMSDTQLV-DGLDPEY-KKRFLHHYNFPQYSVGKT
PNP_LACLA       PRNITHGTGLFTRGQTQALSTLTLAPMNEAQII-DGLNDEY-KKRFMHHYNFPQYSVGET
PNP_SPICI       PV--VHGSALFTRGETQVLSVVTLGALGENQII-DGITDEE-SKRFMHHYNFPAFSVGET
PNP_ONYPE       PR--AHGSALFTRGQTQSLAAVTLGCLSESKII-DGLSDEQ-NKRFMLHYNFPPFSVGAV
PNP_ACHLI       PR--THGSALFTRGQTQALGIVTLGSLNENQII-DGLEQETVTKRFMLHYNFPPFSVGET
PNP_FUSNN       PI--PHGSALFTRGETQSLAITTLGTKEDEQLI-DDLEKEY-YKKFYLHYNFPPYSVGEV
PNP_TRIV2       PK-RVHGSGLFNRGLTQVLSACTLGTPGDAQNLNDDLQTDQ-SKRYLHHYNFPPFSVGET
PNP_TRIEI       PS-RVHGSSLFNRGLTQVMSAVTLGTPGDAQELADDLHPQD-EKRYLHHYNFPPFSVGET
PNP_ACAM1       PQ-RVHGSGLFNRGLTQVLSIATLGTPGDAQEM-DDLHPDS-QKRYLHHYNFPPYSVGET
PNP_SYNE7       PP-RVHGSGLFQRGLTQVLSIATLGTPGDAQEL-DDLHPDT-QKRYLHHYNMPPYSVGET
PNP_SYNY3       PR-RVHGSGLFNRGLTQVLSLATLGSPGDAQDLADDLHPED-EKRYLHHYNFPPYSVGEA
PNP_THEEB       PE-RVHGSALFNRGLTQVMSVTTLGSPADAQAL-DDLHPED-SKRYLHHYNFPPYSVGEV
PNP_PROMA       PK-RVHGSGLFQRGLTQVLSTATLGTPSDAQEM-DDLNPSP-DKTYIHHYNFPPYSVGET
PNP_PROMP       PK-RVHGSALFQRGLTQVLSTTTLGTPSDAQEM-DDLNPST-EKTYLHHYNFPPYSVGET
PNP_SYNR3       PK-RVHGSGLFQRGLTQVLSTATLGTPSDAQEM-DDLNPSN-EKHYLHHYNFPPYSVGET
PNP_SYNJA       P--RVHGSALFNRGLTQVLSITTLGTPGDAQEL-DDLHPVD-EKRYMHHYNFPGFSVGEV
PNP_GLOVI       P--RVHGCGLFTRGTTQVLSVVTLGTASDAQEL-DDLHPDD-SKRYMHHYNFPGFSVGEV
PNP_DEHM1       P--RVHGSALFTRGDTQVMAITTLGSLQEAQQL-DGLSAED-TKRFMLHYNFAPFSTGEV
PNP4_ALKMQ      P--RTHGTGLFTRGQTQVLTVATLGALGEVQIL-DGLGEEE-SKRYMHHYNFPPYSVGEA
PNP_ALKOO       P--KTHGSGLFTRGQTQVLSIVTLGAIGDVQIL-DGLGKEE-SKRYMHHYNFPPYSVGET
PNP3_ALKMQ      P--RAHGTGLFNRGETQVLTITTLGDLRDAQRI-DGIGEED-EKRYMHHYNFPPYSVGET
PNP_CLOD6       P--RAHGSAIFTRGQTQVLNVATLGALGDVQKL-DGLDEEE-NKRYMHHYNFPAYSVGEA
PNP_CALS8       P--RTHGSALFKRGYTQVLTVATLGTKGEMQFL-DGLEEEE-AKRYMHHYNFPPYSTGES
PNP_CALS4       P--RTHGSAIFTRGQTQVLTVATLGAIGDIQIL-EGIGDEE-FKRYMHHYNFPPYSVGEV
PNP_CLOPS       P--RTHGTGLFTRGLTQVMTVATLGAISEIQIL-DGIGEEE-SKRYMHHYNFPAYSVGEV
PNP_CLOB8       P--RTHGTGLFTRGLTQVMTVATLGSISEIQIL-DGIDEAQ-SKRYMHHYNFPGYSVGEV
PNP_CLOBL       P--RTHGTGLFTRGLTQVMTVATLGALGDVQIL-DGIAEEE-SKRYMHHYNFPSYSVGEV
PNP_CLOTE       P--RTHGTGLFTRGLTQVMTAATIGPLADVQIL-DSIEDEE-FKRYMHHYNFPSYSVGET
PNP_CLONN       P--RTHGSGLFTRGLTQVMSVATLGSISEGQVL-DGIEEET-SKRYMHHYNFPSYSVGEV
PNP_CLOAB       P--RTHGSGLFTRGLTQVMTVTTLGPIGDAQVI-DGLGVEE-SKRYMHHYNFPPYSTGEV
PNP_LACP7       P--RVHGSGMFTRGQTQILTVTTLAPLSEAQKL-DGLDEAEKSKRYMHHYNFPSYSVGET
PNP_HUNT2       P--RVHGSGLFTRGQTQVLSSVTLGAMGDVQIL-DGIDTEE-TKRYMHHYNFPGFSVGEA
PNP_CARHZ       P--RTHGSGLFTRGQTQVLSIVTLGAVGDVQIL-DDLGIEE-SKRFMHHYNFPPYSVGEV
PNP_MOOTA       S--RTHGSGLFTRGETQVLTVTTLGPISDEQIL-DDLGVDE-SKRYMHHYNFPPYSVGEA
PNP_DESRM       P--RTHGTGLFTRGQTQILSVATLGSISEEQIL-DGLGVEE-SKRYMHHYNFPPFSTGET
PNP_PELTS       P--RPHGSGLFTRGQTQILSVVTLGTVSEEQIL-DGLGVEE-SKRFMHHYNFPPYSTGET
PNP_DESHY       P--RTHGTGLFTRGQTQVLTVATLGAVGDEQIL-DGLGLEE-SKRYMHHYNFPPYSVGET
PNP_SYNWW       P--RPHGSGLFTRGQTQVLSVTTLGAISEEQRL-DGLGIEE-KKRYIHHYNFPPYSTGET
PNP_SYMTH       P--RPHGSGLFQRGQTQVLSICTLGTLGDMQKL-DDLTLEE-TKRFMHHYNFPPYSVGET
PNP_CHLAA       P--RVHGSAVFTRGQTQVLTITTLGSPGDEQKV-DDLGIET-SKRYIHHYNFPPFSTGEV
PNP_ROSS1       P--RVHGSGLFTRGQTQVLTLATLGSPAEEQRL-DDLGIET-TKRYIHHYNFPPFSTGEV
PNP_DEIRA       P--TAHGSAVFTRGETQVLGVTTLGTERDEILI-DDLTAES-GDKFLLHYNFPPYSTGEV
PNP_THET8       P--RAHGSAVFTRGETQVLGTVTLGTGRDEQIL-DDLGIDE-TEKFLVHYNFPPFSTGEV
PNP_RENSM       P--RVHGSAIFERGETQIMGVTTLNMLKMEQQI-DSLSPVT-RKRYMHNYNFPPYSTGET
PNP_KINRD       P--RVHGSALFERGETQILGVTTLNMLRMEQQL-DTLSPVT-RKRYMHNYNFPPYSTGET
PNP_STRAT       P--RVHGSALFERGETQILGVTTLNMLRMEQQL-DTLSPVT-RKPYMHNYNFPPISVGET
PNP_NOCSJ       P--RVHGSALFERGETQILGVTTLDMLKMEQQL-DTLSPEK-HRRYMHKYVFPPFSTGET
PNP_ACIC1       P--RVHGSALFERGETQILGVTTLNMLRMEQQL-DTVSPRT-KKRYMHHYNFPPYSTGEV
PNP_CUTAK       P--RVHGSALFQRGETQILGVSTLNMLDMEQKL-DTLSPEN-TRRYMHNYNMPPYSTGET
PNP_FRACC       P--RVHGSALFERGETQILGVTTLAMLRMEQTV-DTLNPDR-TKRYMHNYNFPPYSTGET
PNP_THEFY       P--RVHGSALFERGETQILGITTLNMLRMEQTI-DTLNPER-TKRYMHNYNFPPYSTGET
PNP_RHOJR       P--RAHGSALFERGETQILGVTTLDMVKMAQQV-DSLGPET-TKRYMHHYNFPPYSTGET
PNP_SACEN       P--RAHGSALFERGETQILGVSTLNMLRLEQTI-DSLSPET-TKRYMHHYNFPPYSTGET
PNP_SALTO       P--RVHGSALFERGETQIMGVTTLNMLRMEQSL-DTLSPEK-SKRYMHNYNFPPYSTGET
PNP_COREF       P--RAHGSSLFERGETQILGVTTLDMLKMEQHI-DSLAPVD-TKRYMHHYNFPPYSTGET
PNP_CORDI       P--RAHGSSLFERGETQILGVTTLDMLKMEQQI-DSLTPAT-SKRYIHHYNFPPYSTGET
PNP_CORJK       P--RAHGSALFERGETQILGVTTLDMLKMEQQI-DSLGPET-SKRYIHHYNFPPYSTGET
PNP_LEIXX       P--RVHGSAVFQRGETQILGVTTLNMLKMEQQI-DSLSPVT-KKRYLHHYNFPPYSTGET
PNP_TROWT       P--RVHGSAVFQRGETQVLGVTTLNMLKMEQQI-DSLAPIV-SKRYIHHYNFPPYSTGEV
PNP_BIFLO       P--RVHGSALFQRGETQILGVTTLNMLKMEQQI-DALSGPQ-SKRYMHNYEMPPYSTGET
PNP_RUBXD       P--RVHGTGLFTRGETQVLSSLALADLGLVQRL-DTLEPQT-TKRYMHHYYFPPYSTGET
PNP_LEPIC       P--GPHGSAVFTRGQTQSLGVVTLGTGSDNQRYETLEGQKEKS--FMLHYNFPAFSVGEV
PNP_NITSB       P--SAHGSCLFTRGETQALVVCTIGEKTDAQMYEMLTSKGPEYEHFMVHYNFPPFSVGEA
PNP_WOLSU       P--NAHASALFTRGETQALVVATLGGDMDAQSYELLTEKGSSKERFMVHYNFPSFSVGEA
PNP_SULDN       P--SAHASCLFTRGQTQALVVLTMGGPKDAQMFENLTDEGTQNENFMVHYNFPGFSVGEA
PNP_ARCB4       P--STHSSCLFTRGETQALVIGTIAGPKDGQMYEVLTDKSTSMENFMVHYNFPGFSVGEA
PNP_CAMC5       P--NAHGSCLFTRGQTQALVVATLGTDGDAQMYDILTEKTALIEKFMFNYNFPGFSVGEA
PNP_CAMFF       P--NAHGSCLFTRGQTQALVVTTLGTDNDAQMSEYLTEKNAVADKFMFNYNFPGFSVGEA
PNP_CAMHC       P--NAHGSCLFTRGQTQALVVTTLGGETDAQVSDSLTSNTPISERFMFQYNFPGFCVGEA
PNP_CAMJD       P--NAHGSCLFTRGQTQALVVATLGGENDAQMIDLLTEKNPISERFMVNYNFPGFSVGEA
PNP_HELHP       P--FAHGSVLFTRGQTQALVSATIGGDNDAQNYEMLGSKNALKKRFLFHYNFPSFSVGEA
PNP_HELPH       P--MAHSSILFTRGQTQSLVVGVLGTDNDAQTHESLEHKAPIKERFMFHYNFPPFCVGEA
PNP_HELAH       P--MAHSSILFTRGQTQSLVVGVLGTDNDAQTHESLEHKAPIKERFMFHYNFPPFCVGEA
PNP_HELPJ       P--MAHSSILFTRGQTQSLVVGVLGMDNDAQTHENLEHKAPIKERFMFHYNFPPFCVGEA
PNP_SULNB       P--SVHGSCLFTRGQTQALVTATLGDKKDAQMFELITDKNTQSENFMVHYNFPGYSVGEA
                     *.  :* ** *:     .:                        .* :   ...  

PNP_FERNB       KPLR-GPSRREIGHGHLAERAVKAIIPPEDEFPYVIRVVSEILESNGSSSMATVCSASLA
PNP_THEM4       KPLR-GPGRREIGHGHLAERALKAVAPDEEDFPYVVRVVSEILESNGSSSMATVCSGSLA
PNP_THEP1       KPLR-GPSRREIGHGHLAERALKNMLPPEEEFPYTIRVVSEILESNGSSSMATVCSGSLA
PNP_PSELT       KPLR-GPSRREIGHGHLAERALKFVLPDEDRFPYTIRIVSEILESNGSSSMATVCSGSLA
PNP_PETMO       KRLR-GVSRREIGHGHLAERAHKNLIPSDEEFPYTIRVVSDILESNGSSSMASVCSASLA
PNP_AQUAE       KPWG-PPRRREIGHGALAERAIEPLLPPEEEYPFIIRVVSDILESNGSTSMATVCGASLA
PNP_TREDE       GRL--GTGRREIGHGNLAHRSLYPMVPEREKFPYTVRVVSEVLESNGSSSMATVCSGTLS
PNP_TREPA       GRM--GVGRREIGHGCLAHRSLSAVIPDPEQFPYTVRVVSEILESNGSSSMATVCSGTLS
PNP_BORBU       GRL--MTGRREIGHGHLAQRALESMVPGKNDFPYTIRVVSEVLESNGSSSMATVCAGSMS
PNP_DESVV       KPVR-VS-RREIGHGALAEKALRPILPLGEDFPFTLRVVAETMESNGSSSMAAVCGGCLS
PNP_DESAG       KPVR-VS-RREIGHGALAERALRPVLPSPDSFPFTLRVVSETMESNGSSSMAAVCGGSLS
PNP_LAWIP       KPVR-VS-RREIGHGALAEKALKYILPSQNTFPFTVRIVAETLESNGSSSMAAICGGCLS
PNP_SYNFM       RPLR-GPGRREIGHGALAERSVKAVLPRDGEFPYTIRVVSEVLESNGSSSMATVCGSSLA
PNP_ANADF       KFLR-SPGRREIGHGALAERALRQVMPPEDKFPYTVRIVSDIMESNGSSSMASVCGGCLS
PNP_MYXXD       KPLR-GPGRREVGHGALAERALRNMVPKSESFPYTVRLVSDILESNGSSSMASVCGGTLA
PNP_SORC5       KPLR-GPGRREIGHGALAERALSRMIPAPDQFPYTIRIVSETLESNGSSSMAAVCGGCLS
PNP_GEOUR       SFRL-GPGRREIGHGMLAERALARVLPKHDDFPYTIRIVSDILESNGSSSMASVCGGSMS
PNP_PELPD       SFRL-GPGRREIGHGMLAERALSAILPKHDDFPYTIRIVSETLESNGSSSMAAVCGGCMS
PNP_PELCD       SMRL-FPGRREIGHGMLAERSIAQVLPNHDDFPYTLRVVSDILESNGSSSMASVCGASLA
PNP_SYNAS       RPLR-SPGRREIGHGNLARKALMPVIPSPEEFPYTIRIVSEILSSNGSSSMATVCGGLLC
PNP_DESPS       RFLR-GPSRRDIGHGTLATRGLEAVLPSEEDFPYAIRVVSEILESNGSSSMASVCGGSMA
PNP_BDEBA       GRMS-GTSRREIGHGNLAERAIKAVLPDFEKFPYTIRIVSEVLESNGSSSMGTVCSGIMA
PNP_BACV8       KAQR-GVGRREIGHGHLAWRALKGQIPAG--YPYTVRVVSDIMESNGSSSMATVCAGTLA
PNP_PORGI       RPQR-GVGRREIGHGNLAHRALKRMIPTD--YPYVVRVISDILESNGSSSMATVCAGTLA
PNP_CYTH3       KPNR-GPGRREVGHGNLAYRAIKKVMPPEIENPYTIRIVSDILESNGSSSMATVCAGTLA
PNP_FLAPJ       RPLR-GTSRREVGHGNLAQRALKNMIPAD--CPYTIRVVSEVLESNGSSSMATVCAGTLS
PNP_GRAFK       RPIR-GTSRREVGHGNLAQRALKGMIPEE--CPYTVRVVSEVLESNGSSSMATVCAGTMA
PNP_SULMW       KLLK-GVSRREIGHGNLAQRALKNIIPTT----YTIRVVSDVLESNGSSSMATVCASTLA
PNP_CHLPD       GRVG-GTGRREIGHGNLAERSIKMVSPSETDFPYTIRIVSDILESNGSSSMASVCGGTLA
PNP_CHLTE       GRVG-GAGRREIGHGNLAERAIKMVMPSEQEFPYTVRLVSDILESNGSSSMASVCGGTLA
PNP_PELLD       GRLG-STGRREIGHGNLAERSIKMVAPGEQEFPYTVRIVSEILESNGSSSMASVCGGTLA
PNP_CHLCH       GRLG-SIGRREIGHGNLAERSIKMVAPTEAEFPYTIRIVSDILESNGSSSMASVCGGTLA
PNP_SALRD       SYLR-GPKRREIGHSMLAERALRPVIPEQDEFPYTIRINADVMESNGSSSMASVCAGSLA
PNP_KORVE       AFLR-GAGRREIGHGALAERALSAVLPSEDKWPYAMRVVSDILESNGSSSMASICGGSLS
PNP_SOLUE       GFMR-GAGRREIGHGALAERALTALIPGEDKFPYTMRVVSDTLESNGSSSMAAICGGSLA
PNP_RHOBA       RPIR-GPGRREIGHGCLAERSVAPVLPSADDFPYTIRVISDITESNGSSSMASVCGATLG
PNP_ECOLI       GMVG-SPKRREIGHGRLAKRGVLAVMPDMDKFPYTVRVVSEITESNGSSSMASVCGASLA
PNP_PHOPR       GFVG-SPKRREIGHGKLAKRGIAAVMPSVEEFPYTVRVVSEITESNGSSSMASVCGTSLA
PNP_HAEDU       GMIG-SPKRREIGHGRLAKRGVLAVMPSAEEFPYVVRVVSEITESNGSSSMASVCGASLA
PNP_COLP3       GFVG-SPKRREIGHGRLAKRGMLAVMPSLEEFPYAVRVVSEITESNGSSSMASVCGTSLA
PNP_PSYIN       GFVG-SPKRREIGHGRLAKRGVLAVMPSLEEFPYTVRVVSEITESNGSSSMASVCGASLA
PNP_PSEA6       GFVG-SPKRREIGHGRLAKRGIQAVMPSEKEFPYVVRVVSEITESNGSSSMASVCGTSLA
PNP_AERS4       GMMG-SPKRREIGHGRLAKRGVAAVMPSAAEFPYVVRVVSEITESNGSSSMASVCGSSLA
PNP_SHELP       GMVG-SPKRREIGHGKLAWRGIHAVMPTAEEFPYSIRVVSEITESNGSSSMASVCGTSLA
PNP_IDILO       GMVG-SPKRREIGHGRLAKRGIQAVMPSHDEFPYTIRVVSEITESNGSSSMASVCGSSLA
PNP_PSEHT       GFVG-SPKRREIGHGNLAKRGIAAVMPTLTEFPYSIRVVSEITESNGSSSMASVCGTSLA
PNP_BUCAP       GIVG-SPKRREIGHGRLAKRSLLAVMPKLDDFPYTIRIVSEITESNGSSSMASVCGASLA
PNP_BUCBP       GMVG-SPKRREIGHGKLAKRSILAVMPKLDLFPYTIRIVSEITESNGSSSMASVCGASLA
PNP_BUCCC       GIVG-SPKRREIGHGKLAKRSFLAVMPNIEDFPYTIRLVSEITESNGSSSMASVCGASLA
PNP_WIGBR       GIIS-SPKRREIGHGKLAKRGMLAVMPDIDKFPYTIRIVSEITESNGSSSMASVCGASLS
PNP_BLOFL       GIVG-APRRREIGHGRLAKRGMLAVMPNSNEFPYTVRVVSEVTESNGSSSMASICGASLA
PNP_BLOPB       GVIG-APKRREIGHGRLAKRGMLAVMPNANEFPYTIRVVSEITESNGSSSMASICGTSLA
PNP_BAUCH       GLVG-SPKRREIGHGRLAKRGILAVMPTANEFPYTVRVVSEITESNGSSSMASVCGTSLA
PNP_NEIG1       GRMG-APKRREIGHGRLAKRALLAVLPKPEDFSYTMRVVSEITESNGSSSMASVCGGCLS
PNP_CHRVO       GRMG-PPKRREIGHGRLAKRALVAVLPPEDEFGYSMRVVSEITESNGSSSMASVCGGCLS
PNP_METFK       GRVG-TPKRREIGHGRLAKRALLAVLPSQEEFGYTIRVVSEITESNGSSSMASVCGGCLS
PNP_THIDA       GRVG-SPKRREIGHGRLAKRALLAVLPSKEEFGYTMRVVSEITESNGSSSMASVCGGCLS
PNP_NITEC       GRVG-SPKRREIGHGRLAKRALLAVLPPVEEFGYAMRVVSEVTESNGSSSMASVCGGCLA
PNP_NITMU       GRVG-TPKRREIGHGRLAKRALVAVLPSPEEFGYSLRVVSEITESNGSSSMASVCGGCLA
PNP_VEREI       GRMG-STKRREIGHGRLAKRALVAVLPTKEEFPYTMRVVSEITESNGSSSMASVCGGCLS
PNP_METPP       GRVG-SPKRREIGHGRLAKRALIPVLPKKDEFAYAIRVVSEITESNGSSSMASVCGGCLS
PNP_BORA1       GRIG-VPKRREIGHGRLAKRSLVPVLPKPEDFQYTIRIVSEITESNGSSSMASVCGGSLA
PNP_JANMA       GRVG-TPKRREIGHGRLAKRALVAALPAPEDFSYSVRLVSEITESNGSSSMASVCGGCLA
PNP_RALSO       GRVG-SPKRREIGHGRLAKRALIPVLPKEDEFAYTIRLVSEITESNGSSSMASVCGGCLA
PNP_POLAQ       GRVG-SPKRREIGHGRLAKRALIPVLPSAEDFAYSIRVVSEITESNGSSSMASVCGGCLA
PNP_PARXL       GRVG-SPKRREIGHGRLAKRALAACLPSADEFGYSIRVVSEITESNGSSSMASVCGGCLA
PNP_DECAR       GRVG-TPKRREIGHGRLAKRALLAVLPKPEDFSYSMRLVSEITESNGSSSMASVCGGCLA
PNP_AROAE       GRMG-VTKRREVGHGRLAKRALIAALPADEDFSYTVRVVSEITESNGSSSMASVCGASLA
PNP_ALKEH       GFMG-TPKRREIGHGKLAKRGIEAVMPAADDCPYVIRVVSEITESNGSSSMATVCGTSLS
PNP_HALHL       GFIG-TPKRREIGHGKLAKRGVEAVMPSDEEFPYVIRVVSEVTESNGSSSMATVCGTSLS
PNP_METCA       GAIG-SPKRREIGHGRLAKRGVQAIMPTMDEFPYVIRIVSEITESNGSSSMASVCGSSLA
PNP_NITOC       GFVG-SPKRREIGHGRLAKRSLNGVVPDEESFPYVIRVVSEITESNGSSSMATVCGTSLS
PNP_XYLFT       GRFG-VPKRREIGHGRLARRGVLAVMPSLDEFPYTIRVVSEITESNGSSSMASVCGSSLA
PNP_COXBR       GFMS-GPKRREIGHGRLAKRAVVPVVPTLDKFPYVIRVVSEILESNGSSSMASVCGSSLA
PNP_DICNV       GRIG-SPKRREIGHGRLARRGLSAVLPLEEDFPYTIRVVSEITESNGSSSMASVCGSSLA
PNP_PSEU5       GRMG-ATGRREIGHGRLARRGVAAMLPSADEFPYTIRVVSEITESNGSSSMASVCGASLA
PNP_SACD2       GRMG-ATGRREIGHGRLARRGIGAVLPKEEDFPYTMRVVSEITESNGSSSMASVCGASLA
PNP_HAHCH       SRVG-GVGRREIGHGRLARRGVQALMPNLEEFPYAVRCVSEITESNGSSSMASVCGSSLA
PNP_MARHV       GRMG-SPGRREIGHGRLAKRGVAAVMPTIEEFPYAIRAVSEITESNGSSSMASVCGSSLA
PNP_CHRSD       GFMG-GPKRREIGHGRLARRGVQAMLPSEEDFPYTIRVVSEITESNGSSSMASVCGSSLA
PNP_ALCBS       GFIG-SPKRREIGHGRLARRGVEAVVPSVQDFPYTIRVVSEITESNGSSSMASVCGTSMA
PNP_ACIAD       GRES-GPKRREIGHGRLARRGVQAVLPAADRFPYVIRIVSDITESNGSSSMASVCGASLS
PNP_PSYWF       GREG-VPKRREIGHGRLARRGVQAMLPDSDRFPYVIRVVSEITESNGSSSMASVCGASLA
PNP_HYDCU       GRVG-SPGRREIGHGMLARRGVAALLPTADEFPYTIRVVSEITESNGSSSMATVCGTSMS
PNP_LEGPA       GQVG-SPKRREIGHGRLAKRALMAVLPDTNEFPYVLRIVSEITESNGSSSMATVCGTSLA
PNP_VESOH       GRLA-TIKRREIGHGHLARRGITACLPSIEEFPYTVRVVSEITESNGSSSMASVCGSSLS
PNP_FRATW       GMVGMAPKRREIGHANLAKRATQAVFPNEEAYPYVVRVVSEILESNGSSSMATVCGSSLS
PNP_GRABC       GRMG-SPGRREIGHGKLAWRAVHPVLPAKDAFPYTLRVVSEITESNGSSSMATVCGSSLA
PNP_ACICJ       GRVG-SPGRREVGHGKLAWRAIHPLLPGKDKFPYTLRVVSEITESNGSSSMATVCGTSLA
PNP_GLUOX       GRMG-SPGRREIGHGKLAWRAIHPLLPSKEAFPYTMRVVSEITESNGSSSMATVCGSSLA
PNP_MAGSA       GRMG-SPGRREIGHGKLAWRAMRPCLPAKESFPYTMRVVSEITESNGSSSMASVCGSSLA
PNP_RHORT       GRMG-SPGRREIGHGKLAWRAIHPMMPAKDAFPYTVRVVSEITESNGSSSMATVCGTSLA
PNP_CHESB       GRMG-SPGRREIGHGKLAWRAVHPLLPAPEQFPYTIRVVSEITESNGSSSMATVCGTSLA
PNP_BARBK       GRLS-SPGRREIGHGKLAWRAIHPMLPTKEAFPYTIRVVSEITESNGSSSMATVCGTSLA
PNP_NITHX       GRLG-STKRREIGHGKLAWRAIHPVLPPHHEFPYTIRVVSEITESNGSSSMASVCGASLS
PNP_AZOC5       GRMG-SPGRREIGHGKLAWRAIHPMLPAKHEFPYTLRVVSEILESNGSSSMATVCGTSLS
PNP_PARL1       GRVG-FTGRREVGHGKLAWRALRAVLPPKTEFPYTLRLVSEITESNGSSSMATVCGSSLA
PNP_MARMM       SFRL-APGRREIGHGKLAWRAVKAVLPTKEDFPYTIRLVSEITESNGSSSMATVCGASLS
PNP_CAUVC       GRMG-SPGRREIGHGKLAWRALRPMLPTKEDFPYTIRLVSEITESNGSSSMATVCGSSLA
PNP_HYPNA       GRMG-GAGRREIGHGKLAWRALKAVLPKHEDFPYTIRMVSEITESNGSSSMATVCGCSLA
PNP_PARDP       GRVG-SPGRREIGHGKLAWRALQAVLPAPTDFPYTIRVVSEITESNGSSSMASVCGGSLS
PNP_SPHAL       GRFG-APGRREVGHGKLAWRALHPVLPSKDEFPYTIRLTSDITESNGSSSMASVCGGSLA
PNP_NOVAD       GRFG-APGRREVGHGKLAWRALHPVLPTKEEFPYTIRILSDITESNGSSSMATVCGGCLS
PNP_ERYLH       GRFG-FTSRRETGHGKLAFRALRPVLPDNEEFPYTIRVLSDITESNGSSSMATVCGGSLS
PNP_ZYMMO       GRFG-APGRREIGHGKLAWRALHPVLPSKADFPYTIRVLSDITESNGSSSMATVCGGCLA
PNP_PELUB       GRIG-T-GRREVGHGKLAWRAINSSLPPKEEFPYTFRIVSEITESNGSSSMASVCGASLA
PNP_MAGMM       GRMG-APGRREIGHGKLATRALTAIVPSAEVFPYTLRITSEITESNGSSSMATVCGAVLA
PNP_RICTY       MPMK-APSRREVGHGKLAWRAINPILPNKVQFPYSIRVVAETTESNGSSSMATVCGSSLA
PNP_ORITB       SPLR-AASRREIGHGWLAKKAIQLVIPSKDVFPYTIRIVSEITQSDGSSSMATVCSASLS
PNP_ANAMM       AALR-PPGRREIGHGKLAWRAIHPVLPTKADFPYTIRVVSEITESDGSSSMATVCGASLA
PNP_ANAPZ       SALR-PPGRREIGHGKLAWRAIHPVLPSKADFPYTIRVVSEITESDGSSSMATVCGASLA
PNP_EHRRW       AALR-APGRREIGHGKLAWKAIRYVLPEKSDFPYTIRVVSEITESDGSSSMATVCGASLA
PNP_WOLTR       SAIR-APGRREIGHGKLAWKAIHPVLPDKSEFPYTIRVVSEIMESDGSSSMATVCGTSLA
PNP_NEOSM       GALR-APGRREIGHGRLALKAVKAVLPGKEVFPYTLRLVSEITESDGSSSMATVCGSSLA
PNP_CHLCV       GRIG-SPGRREIGHGKLAEKALSHTLPDPAKFPYTIRIESNITESNGSSSMASVCGGCLA
PNP_CHLPN       GRIG-SPGRREIGHGKLAEKALSHALPDSATFPYTIRIESNITESNGSSSMASVCGGCLA
PNP_CHLMU       GRIG-SPGRREIGHGKLAEKALSHVLPEASRFPYTVRVESNITESNGSSSMASVCGGCLS
PNP_PARUW       GRVG-APGRREIGHGKLAERALMAVIPTKEQFPYTIRLESNITESNGSSSMATVCGGCLA
PNP_BACCN       RPMR-GPGRREIGHGALGERALEPVIPSEKDFPYTVRLVSEVLESNGSTSQASICGSTLA
PNP_GEOTN       GPMR-GPGRREIGHGALGERALEPVVPSEREFPYTIRLVSEVLESNGSTSQASICASTLA
PNP_OCEIH       GPIR-GPGRREIGHGALGERALEKVIPDDKEFPYTIRLVSEVLESNGSTSQASICASTLA
PNP_BACHD       GPIR-GPGRREIGHGALGERALEPVIPSEQDFPYTIRLVSEVLESNGSTSQASICASTLA
PNP_BACSK       GPIR-APGRREIGHGALGERALEQVIPSEQEFPYTIRLVSEVLESNGSTSQASICASTLA
PNP_LISIN       GPRR-APGRREIGHGALGERALQYVIPSEEEFPYTIRLVSEVLESNGSSSQASICGSTLA
PNP_ENTFA       GRAG-SPGRREIGHGALGERALAQIIPSEEDFPYTIRLVAEVLESNGSSSQASICAGTLA
PNP_STAS1       GPVR-SPGRREIGHGALGERALSHIIPDLKDFPYTVRIVSEVLESNGSSSQASICGSTLA
PNP_STRMU       GRYG-APGRREIGHGALGERALAQVLPSLEAFPYAIRLVAEVLESNGSSSQASICAGTLA
PNP_STRTD       GRYG-APGRREIGHGVLGERALAQVLPSVEEFPYAIRLVAEVLESNGSSSQASICAGTLA
PNP_LACLA       GRYG-APGRREIGHGALGERALEQVLPSLEEFPYAIRLVAEVLESNGSSSQASICAGTLA
PNP_SPICI       GRMG-PPSRREIGHGALGEKVLLQIIPSEKVFPYTIRIVSEVLESNGSTSQASICAATLA
PNP_ONYPE       GRYT-APSRREIGHGTLAEKAISQVLPEEKDFPYTIRVVSEILESNGSSSQATVCASSLA
PNP_ACHLI       GRYG-APGRREIGHGALGERALLQVLPSEDEFPYAIRVVSEITESNGSSSQATICVGSMA
PNP_FUSNN       GRMG-SPGRRELGHGSLAERALSYVIPTEEEFPYTIRVVSEITESNGSSSQASICGGSLS
PNP_TRIV2       KPLR-APGRREIGHGALAERAILPVLPPKEQFPYVIRVVSEVLSSNGSTSMGSVCGSTLA
PNP_TRIEI       KPLR-QPGRREIGHGALAERALIPVIPKSDIFPYVIRVVSEVLSSNGSTSMGSVCASTLG
PNP_ACAM1       RPMR-SPGRREVGHGALAERALLPMLPSKEEFPYVLRVVSEVLSSNGSTSMGSVCGSTLS
PNP_SYNE7       RPMR-SPGRREIGHGALAERALLPVLPSKEEFPYVIRVVSEVLSSNGSTSMGSVCGSTLA
PNP_SYNY3       RPMR-SPGRREIGHGALAERAIIPVLPPQEDFPYVVRVVSEVLSSNGSTSMGSVCGSTLA
PNP_THEEB       KPLR-SPGRREIGHGALAERALEPVLPPKEEFPYVIRVVSEVLSSDGSTSMGSVCGSTLS
PNP_PROMA       RPMR-TPGRREVGHGALAERAIIPVLPPKESFPYVLRVVSEVLSSNGSTSMGSVCGSTIA
PNP_PROMP       RPMR-TPGRREIGHGALAERAITPVLPGKETFPYVLRVVSEVLSSNGSTSMGSVCGSTLS
PNP_SYNR3       RPMR-SPGRREIGHGALAERALLPVLPPKESFPYVLRVVSEVLSSNGSTSMGSVCGSTLA
PNP_SYNJA       RPSR-SPGRREIGHGALAERALVPVLPKEEEFPYVVRVVSEVLSSNGSTSMASVCGSTLS
PNP_GLOVI       KPLR-GVGRREVGHGALAERAIVPILPEHEQFPYVIRVVSEVLSSNGSTSMGSVCASTLA
PNP_DEHM1       KRSG-SPGRREIGHGALAERALVPVLPTPEEFPYTIRMVADVVGSSGSTSMGSVCSSSLS
PNP4_ALKMQ      KFLR-GPGRREIGHGALAERALLPMVPSQDDFPYAIRLVSEVLSSNGSSSQASVCGSTLA
PNP_ALKOO       KMLR-SPGRREIGHGALAERALEPMIPSQDDFPYAIRVVSEVLASNGSSSQASVCGSTLS
PNP3_ALKMQ      RFMR-GPSRREIGHGALVERALLPMIPSKEDFPYAIRLVSEVLTCNGSSSQASVCGSTLS
PNP_CLOD6       RPSR-GPGRREIGHGALAERALLPVIPSQEEFPYAIRLVSEVLSSNGSTSQASVCGSTLS
PNP_CALS8       KPVR-GPGRREIGHGALAERALEPVIPSEDEFPYTIRLVSEVLTSNGSTSQASVCGSTLA
PNP_CALS4       RPLR-GPGRREIGHGALAERALEPVIPSEEEFPYTIRLVSEVLSSNGSTSQASVCGSTLA
PNP_CLOPS       RPLR-GPGRREIGHGALAERALEPLIPSEAEFPYTIRLVSEVLSSNGSTSQASVCGSTLA
PNP_CLOB8       KPLR-GPGRREIGHGALAERALEPLIPSEEEFPYTIRLVSEVLSSNGSTSQASVCGSTLA
PNP_CLOBL       RPLR-GPGRREIGHGALAERALEPLIPSQEEFPYTIRLVSEVLSSNGSTSQASVCGSTLA
PNP_CLOTE       RPLR-GPGRREIGHGALAEKALEPLIPSEEDFPYTIRLVSEVLSSNGSTSQASVCGSTLA
PNP_CLONN       RPLR-GPNRREIGHGALAEKAIEPLIPSEQEFPYAIRVVSEVLSSNGSTSQASVCGSTLA
PNP_CLOAB       KPLR-GPNRREIGHGALAEKALVPLIPSEEEFPYTIRLVSEVLSSNGSTSQASVCGSTLA
PNP_LACP7       KPSR-GPGRREIGHGALAERALIPVLPSEAEFPYAIRTVSETMESNGSTSQASVCASTLS
PNP_HUNT2       KSSR-GPGRREIGHGALAERALEPVIPSEEEFPYTIRVVSEVLMSNGSTSQGSVCGSTLA
PNP_CARHZ       RPMR-GPGRREIGHGALAERALEPVIPPEEVFPYTIRIVSEVLESNGSTSMGSVCGSTLA
PNP_MOOTA       RPIR-APGRREIGHGALAERALEPMIPSEEEFPYAIRLVSEVLGSNGSTSMGSVCGSTLS
PNP_DESRM       KPMR-SPGRREIGHGALAERALEPMIPPEEVFPYTIRVVSEAIESNGSTSMGSVCGSTLS
PNP_PELTS       RPLR-SPGRREIGHGALAERALAAVIPGEEEFPYTIRIVSEALESNGSTSMGSVCGSTLA
PNP_DESHY       RPMR-GPGRREIGHGALAERALLPVIPDENDFPYTIRLVSEVLESNGSSSMASVCGSTLS
PNP_SYNWW       KPMR-GPGRREIGHGALAERALLAVIPSEEEFPYTIRVVSEVLESNGSSSMGSVCGSTLS
PNP_SYMTH       RPLR-GPGRREIGHGALAERALEPVIPPEEEFPYTIRVVSEVLESNGSSSMASVCGSTLA
PNP_CHLAA       RRIG-TPRRRDIGHGALAERSLYAVLPDEKDFPYTIRLVSEVLSSNGSSSMASVCGSSLS
PNP_ROSS1       RRLG-SPRRRDIGHGALAERSLLAVLPSKEEFPYTMRLVSETLSSNGSSSMASVCGSSLA
PNP_DEIRA       KRMG-GQSRREIGHGNLAKRAIRAVLPSFEEFPYVIRVVGDVLESNGSSSMGTVCAGTLS
PNP_THET8       RRLR-GVSRREVGHGNLAKRALKAVMPKEEDFPYTIRVVGDVLESNGSSSMATVCAGCLA
PNP_RENSM       GRVG-SPKRREIGHGALAERALVPVLPSREEFPYAIRQVSEALSSNGSTSMGSVCASTLS
PNP_KINRD       GRVG-SPKRREIGHGALAERALVPVLPAREDFPYAIRQVSEALGSNGSTSMGSVCASTLS
PNP_STRAT       GRVG-SPKRREIGHGALAERAIVPVLPTREEFPYAIRQVSEALGSNGSTSMGSVCASTMS
PNP_NOCSJ       GRVG-SPKRREVGHGALARRALLPVLPTREEFPYAIRQLSEAMGSNGSTSMGSVCASTLA
PNP_ACIC1       GRVG-SPKRREIGHGALAERALIPVLPSREEFPYAIRQVSEAIGSNGSTSMGSVCASTLS
PNP_CUTAK       GRVG-SPKRREIGHGNLAERALIPVLPTREEFPYAIREVSEAIGSNGSTSMGSVCASTLA
PNP_FRACC       GRVG-SPKRREIGHGALAERALLPVLPSREEFPYAIRQVSEALGSNGSTSMGSVCASTLS
PNP_THEFY       GRVG-APKRREIGHGALAERALVPVLPSREEFPYAIRQVSEAIGSNGSTSMGSVCASTMS
PNP_RHOJR       GRVG-SPKRREIGHGALAERALMPVLPSVEEFPYAIRQVSEALSSNGSTSMGSVCASTLA
PNP_SACEN       GRVG-SPKRREIGHGALAERALIPVLPTREEFPYALRQVSEALGSNGSTSMGSVCASTLS
PNP_SALTO       GRVG-SPKRREIGHGALAERALIPVLPSREEFPYAIRQVSEALGSNGSTSMGSVCASTLG
PNP_COREF       GRVG-SPKRREIGHGALAERAVLPVIPSREDFPYAIRQVSEALGSNGSTSMGSVCASTLS
PNP_CORDI       GRVG-SPKRREIGHGALAERALVPVIPSREEFPYAIRQVSEALGSNGSTSMGSVCASTLS
PNP_CORJK       GRVG-SPKRREIGHGALAERALTPVIPSRDDFPYTIRQVSEALSSNGSTSMGSVCASTLS
PNP_LEIXX       GRVG-SPKRREIGHGFLAERALVPVLPSREEFPYAIRQVSEALSSNGSTSMGSVCASTLS
PNP_TROWT       GRVG-SPKRREIGHGFLAERALVPVLPSREDFPYAIRQVSEALGSNGSTSMGSVCASTLS
PNP_BIFLO       GRVG-SPKRREIGHGALAEKALVPVLPSREEFPYAIRQVSEAIGSNGSTSMGSVCASTLS
PNP_RUBXD       GRLG-PPRRREIGHGALAERALLPVIPSEEEFPYAIRIISEVLESNGSSSMASVCGSTLA
PNP_LEPIC       RRSS-GPGRREIGHGNLAERALKLVLPKPDEFPYVIRVVSEILESNGSSSMASVCSGSLA
PNP_NITSB       KPIS-APGRRELGHGNLARRALEPVVDVP--EDKTYRLVSEILESNGSSSMATVCGGALA
PNP_WOLSU       GMVG-APGRRELGHGNLAKRALEPTIEEW--GAQTIRLVSEILESNGSSSMATVCGGSLA
PNP_SULDN       SPIM-GTKRRELGHGNLAKRALEPIVNL---EGQTVRLVSEILESNGSSSMATVCGGYMA
PNP_ARCB4       KPMF-GVGRRELGHGNLAKKALEATIDKD--YNETVRLVSEILESNGSSSMATVCGGSLA
PNP_CAMC5       SPLK-APGRRELGHGNLAKRALAPSIDIN--SPYTIRLVSEILESNGSSSMASVCGGALA
PNP_CAMFF       SPLK-APGRRELGHGNLAKRALYPSIDLN--SPYSLRVVSEILESNGSSSMASVCGGSLS
PNP_CAMHC       SPLK-SPGRRELGHGNLAKRALTPSVPLN--NPQVIRTVSEILESNGSSSMASVCGGSLS
PNP_CAMJD       SPIK-APGRRELGHGNLAKRALYPSVDEN--YPYVIRLVSEILESNGSSSMATVCGGSLA
PNP_HELHP       SMIG-SVGRRELGHGNLAKRALHSSVQE---QDKTIRLVSEILESNGSSSMASVCGGSLA
PNP_HELPH       SSIG-AASRRELGHGNLAKRALETSIKN---KEQVIRLVSEILESNGSSSMASVCAGSLA
PNP_HELAH       SSIG-ATSRRELGHGNLAKRALETSIKN---KDQVIRLVSEILESNGSSSMASVCAGSLA
PNP_HELPJ       SSIG-ATSRRELGHGNLAKRALETSIKN---KEQVIRLVSEILESNGSSSMASVCAGSLA
PNP_SULNB       KFIG-APGRRELGHGNLAKRALEPVIPIN--YDGTIRLVSEVLESNGSSSMATICGGALA
                        **: **. *  :                *  .:   ..**:* .::*   : 

PNP_FERNB       LMDAGVPTK--KHVAGVAMGLILEEG------KGVILTDIIGLEDHWGDMDFKVAGTKDG
PNP_THEM4       LMDAGVPIK--THVAGVAMGLIVDEE------NEVVLTDIQGLEDHWGDMDFKVAGTRNG
PNP_THEP1       LMDAGVPIK--KHVAGIAMGLILEED------AEIILTDIIGMEDHYGDMDFKVAGTRDG
PNP_PSELT       LMDAGVPIS--KHVAGVAMGLILEKD------SQIVLTDILGAEDHWGDMDFKVAGTRDG
PNP_PETMO       LMDAGVPIQ--KHVAGIAMGLIFEND------NFVVLTDILGMEDHLGDMDFKVAGTRDG
PNP_AQUAE       LFDAGVPMKDNKHVAGIAMGLILEKD------RYVILSDILGDEDHLGDMDFKVAGTKDG
PNP_TREDE       MLHAGVPMK--KPVAGIAMGLITEGND-----RYAILSDILGEEDHLGDMDFKVAGTADG
PNP_TREPA       LLHAGVPIK--KPVAGIAMGLITDGV------RYAILSDILGEEDHLGDMDFKVAGTCDG
PNP_BORBU       LMSAGVPVK--GQVAGIAMGLISEGD------KYVVLSDILGEEDHLGDMDFKVAGTKNG
PNP_DESVV       LMDAGVPIT--APVAGVAMGLIKEGD------QYVVLTDILGDEDALGDMDFKIAGTSEG
PNP_DESAG       LMDAGVPVK--APVAGIAMGLIKEDD------QFIVLTDILGDEDALGDMDFKIAGTAEG
PNP_LAWIP       LMDAGVPIS--APVAGVAMGLIKEDD------QFIVLTDIIGDEDAFGDMDFKIAGTTKG
PNP_SYNFM       LMDAGVPIT--EPVGGIAMGLVKEGD------KIIVLSDILGDEDHLGDMDFKVTGSERG
PNP_ANADF       LMDAGVPIK--APVAGIAMGLIKEGE------KIAILSDILGDEDHLGDMDFKVCGTAEG
PNP_MYXXD       LMDAGVPLK--APVAGIAMGLVKEGD------KIAILSDILGDEDHLGDMDFKVCGTSKG
PNP_SORC5       LMDAGVPIK--SPVAGIAMGLIMEGN------KYAVLSDILGDEDHLGDMDFKVCGTARG
PNP_GEOUR       MMDAGIPIK--APVAGIAMGLIKEGE------DFAILSDILGDEDHLGDMDFKVAGTAEG
PNP_PELPD       LMDAGVPIS--APVAGIAMGLIKEGE------KVAILSDILGDEDHLGDMDFKVAGSSDG
PNP_PELCD       LMDAGVPVS--EAVAGIAMGLIKEGD------DIVVLSDILGDEDHLGDMDFKVTGTREG
PNP_SYNAS       LMDGGVPVK--GVVAGIAMGLLKEGE------QVVILSDILGDEDHAGDMDFKVCGTSKG
PNP_DESPS       MMDAGVPLK--RPVSGIAMGLIKEGE------GVAILSDILGDEDHLGDMDFKVVGTCDG
PNP_BDEBA       LLDAGVPLK--GNVAGVAMGLIKEGD------RVAVLTDILGDEDHLGDMDFKVAGSPAG
PNP_BACV8       LMDAGVAMK--KPVSGIAMGLIKNAGEE----KYAVLSDILGDEDHLGDMDFKVTGTRDG
PNP_PORGI       LRDAGVQIR--KPVSGIAMGLISENQGK----NYAILSDILGDEDHLGDMDFKVTGTKDG
PNP_CYTH3       LMDAGIKIK--APVSGIAMGLITDTKTG----RWAVLSDILGDEDHLGDMDFKVTGTEKG
PNP_FLAPJ       LMDAGIQMI--RPVSGIAMGLITDGE------RFAVLSDILGDEDHLGDMDFKVTGTSEG
PNP_GRAFK       LMDAGVQMK--KPVSGIAMGLISDGDSG----KYAVLSDILGDEDHLGDMDFKVTGTADG
PNP_SULMW       LMDSGIIVK--RPVSGISMGLIMNYLTG----EAIILSDLLGDEDYIGDMDFKITGTEYG
PNP_CHLPD       LMDGGVPIR--KPVSGIAMGLIKEGD------AYSVLSDILGNEDHLGDMDFKVAGTEDG
PNP_CHLTE       AMDGGIPLK--KPVSGIAMGLIKEGD------RYAVLSDILGNEDHLGDMDFKVAGTRDG
PNP_PELLD       LMDGGVPLK--KPVSGIAMGLIKDGE------EYAVLSDILGNEDHLGDMDFKVAGTRDG
PNP_CHLCH       LMDGGVPIR--KPVSGIAMGLIKEND------KYAVLSDILGNEDHLGDMDFKVSGTRDG
PNP_SALRD       LMDAGVPIE--KPVAGIAMGLVQEDD------ETTVLTDILGQEDHLGDMDFKLTGTRDG
PNP_KORVE       LMDAGVPLK--APVAGIAMGLVKEG--D----DYAILTDIAGAEDHYGDMDFKVAGTTQG
PNP_SOLUE       LMQAGVPMT--AHVGGVAMGLVMEG--K----DYAILTDIAGAEDHYGDMDFKVAGTRDG
PNP_RHOBA       LMASGVPIS--NPVAGISVGLVQDGP-D----NWCLITDILGTEDHFGDMDFKIAGTQNG
PNP_ECOLI       LMDAGVPIK--AAVAGIAMGLVKEGDN------YVVLSDILGDEDHLGDMDFKVAGSRDG
PNP_PHOPR       LMDAGVPIK--ASVAGIAMGLVKEGDD------FVVLSDILGDEDHLGDMDFKVAGTDDG
PNP_HAEDU       LMDAGVPIK--ATVAGIAMGLVKEDEK------FVVLSDILGDEDHLGDMDFKVAGTRKG
PNP_COLP3       LMDAGVPIK--ASVAGIAMGLVKEGEK------FVVLSDILGDEDHLGDMDFKVAGTTGG
PNP_PSYIN       LMDAGVPLK--ASVAGIAMGLVKEGEE------FVVLSDILGDEDHLGDMDFKVAGTTEG
PNP_PSEA6       LMDAGVPIK--ASVAGIAMGLVKNDEN------FVVLSDILGDEDHLGDMDFKVAGTTEG
PNP_AERS4       LMDAGVPIK--ASVAGIAMGLVKEEEG------FVVLSDILGDEDHLGDMDFKVAGTTQG
PNP_SHELP       LMDAGVPIK--TSVAGIAMGLVKEGDD------FVVLSDILGDEDHLGDMDFKVAGTRDG
PNP_IDILO       LMDAGVPIK--SSVAGIAMGLVKEGDK------HVVLSDILGDEDHLGDMDFKVAGNTDG
PNP_PSEHT       LMNAGVPIK--ASVAGIAMGLVKEDDK------FVVLSDILGDEDHLGDMDFKVAGTAGG
PNP_BUCAP       LMDAGVPIK--SAVAGISMGLVKEGDK------YVLLSDILGDEDHLGDMDFKVSGTEEG
PNP_BUCBP       LMDAGVPIS--NAIAGIAMGLIKEGDD------FVVLTDILGDEDHLGDMDFKISGSKKG
PNP_BUCCC       LMDAGVPIK--SAIAGIAMGLIKENDS------YIILSDILGDEDYLGDMDFKVSGSRLG
PNP_WIGBR       LMDAGVPIS--SSVAGIAMGLIKEKDK------FVVLTDILGDEDYLGDMDFKVMGTREG
PNP_BLOFL       LMDAGVPIK--ESVAGVAMGLIKENSN------FIILSDIISDEDHIGDMDFKVSGTRTG
PNP_BLOPB       LMDAGVPIK--AAVAGVAMGLIKEGND------FVVLSDIVSDEDHIGDMDFKVSGSRQG
PNP_BAUCH       LMDAGVPIK--AAVAGVAMGLIKEDNN------FVILSDILSNEDYIGDMDFKVAGSKNG
PNP_NEIG1       LLSAGVPLK--AHVAGIAMGLILEGNK------FAVLTDILGDEDHLGDMDFKVAGTTEG
PNP_CHRVO       LLSAGVPLK--AHVAGIAMGLILEGNR------FAVLTDILGDEDHLGDMDFKVAGTAAG
PNP_METFK       LLDAGVPLK--AHVAGIAMGLIKEGNR------VAVLTDILGDEDHLGDMDFKVAGTESG
PNP_THIDA       LMDAGAPLK--AHVAGIAMGLIKEGNR------FAVLTDILGDEDHLGDMDFKVAGTENG
PNP_NITEC       LMDAGAPLK--AHVAGIAMGLIKEGNR------FAVLTDILGDEDHLGDMDFKVAGTEEG
PNP_NITMU       LMDAGVPLK--GHVAGIAMGLIKEGNR------FAVLTDILGDEDHLGDMDFKVAGTENG
PNP_VEREI       LMDAGVPMK--AHVAGIAMGLIKDGNR------FAVLTDILGDEDHLGDMDFKVAGTTAG
PNP_METPP       MMDAGVPLK--AHVAGIAMGLIKDGNR------FAVLTDILGDEDHLGDMDFKVAGTTTG
PNP_BORA1       MMDAGVPIT--DHVAGVAMGLILENGK------FAVLTDILGDEDHLGDMDFKVAGTENG
PNP_JANMA       LMDAGVPMQ--SHVAGIAMGLIKEGSK------FAVLTDILGDEDHLGDMDFKVAGTANG
PNP_RALSO       LMDAGVPVK--AHVAGVAMGLILEGNK------FAVLTDILGDEDHLGDMDFKVAGTDNG
PNP_POLAQ       MMDAGVPVK--AHVAGVAMGLILDGNR------FAVLTDILGDEDHLGDMDFKVAGTANG
PNP_PARXL       LMDAGVPMK--AHVAGIAMGLILEGNK------FAVLTDILGDEDHLGDMDFKVAGTEQG
PNP_DECAR       LLDAGVPLK--AHVAGIAMGLIKDGNR------FAVLTDILGDEDHLGDMDFKVAGSTTG
PNP_AROAE       MMDAGVPMK--AHVAGIAMGLIKEGNR------FAVLTDILGDEDHLGDMDFKVAGTENG
PNP_ALKEH       LMDAGVPVK--APVAGIAMGLIKEDEQ------FAVLSDILGDEDHLGDMDFKVAGTESG
PNP_HALHL       LMDAGVPLK--AQVAGIAMGLIKEGDE------FAVLTDILGDEDHLGDMDFKVAGSKDG
PNP_METCA       LMDAGVPTK--GAVAGIAMGLILEGEE------FAVLSDIMGDEDHLGDMDFKVAGTRDG
PNP_NITOC       LMDAGVPIK--APVAGIAMGLIKEKDR------FAVLSDILGDEDHLGDMDFKVAGTEKG
PNP_XYLFT       LMDAGVPVK--APVAGIAMGLVKEGER------FVVLSDILGDEDHLGDMDFKVAGTSEG
PNP_COXBR       LMDAGVPTK--APVAGIAMGLIKENDK------YAVLSDILGDEDHLGDMDFKVAGTSNG
PNP_DICNV       LMDAGVPVQ--TPVAGIAMGLIKEGDE------FAILTDILGDEDHLGDMDFKVAGSATG
PNP_PSEU5       LMDAGVPMK--APVAGIAMGLVKEGEK------FAVLTDILGDEDHLGDMDFKVAGTAKG
PNP_SACD2       LMDAGVPLK--APVAGIAMGLVKEDNG------FAVLTDILGDEDHLGDMDFKVAGTADG
PNP_HAHCH       LMDAGIPVK--APVAGIAMGLVKEGDS------FAVLTDILGDEDHLGDMDFKVAGTEKG
PNP_MARHV       LMDAGVPLK--APVAGIAMGLVKEGDK------FAVLTDILGDEDHLGDMDFKVAGTKEG
PNP_CHRSD       LMDAGVPLK--APVAGIAMGLVKDEDG------FAVLTDILGDEDHLGDMDFKVAGSTAG
PNP_ALCBS       LMDAGVPLT--APVAGIAMGLVKEEDGR-----YAVLSDILGDEDHLGDMDFKVAGTARG
PNP_ACIAD       LMDAGVPLK--APVAGIAMGLVKEGER------FAVLSDILGDEDHLGDMDFKVAGSANG
PNP_PSYWF       LMDAGVPLK--APVAGIAMGLVKEGDR------FAVLSDILGDEDHLGDMDFKVAGTKDG
PNP_HYDCU       LMHAGVPLA--APIAGIAMGLVKEESG------FAVLSDILGDEDHLGDMDFKVAGTEQG
PNP_LEGPA       LMDAGVPLK--APVAGVAMGLIKEGDR------YAVLTDILGDEDHLGDMDFKVAGTEKG
PNP_VESOH       LMDAGVPIK--APIAGIAMGLVKENDR------FTVLTDILGDEDHLGDMDFKVAGTSRG
PNP_FRATW       MMDAGVPIA--EPVAGIAMGLIKDGAK------YAVLSDILGDEDHLGDMDFKVAGTRYG
PNP_GRABC       LMDAGVPLK--RPVAGIAMGLIKEDR-A-----FAVLSDILGDEDHLGDMDFKVAGTEQG
PNP_ACICJ       LMDAGVPLP--RPVAGIAMGLIKEDK-G-----FAVLSDILGDEDHLGDMDFKVAGTEAG
PNP_GLUOX       LMDAGVPLP--RPVAGIAMGLIKEDR-G-----YAVLSDILGDEDHLGDMDFKVAGTADG
PNP_MAGSA       LMDAGVPLP--KPVAGIAMGLIKEGT-D-----FAVLSDILGDEDHLGDMDFKVAGTVDG
PNP_RHORT       LMDAGVPLK--NAVAGIAMGLIKEDE-R-----FAVLSDILGDEDHLGDMDFKVAGTANG
PNP_CHESB       LMDAGVPLA--KPVAGIAMGLIKEDD-R-----FAVLSDILGDEDHLGDMDFKVAGTAEG
PNP_BARBK       LMDAGVPLA--RPVAGIAMGLIKEGE-R-----FVILSDILGDEDHLGDMDFKVAGTKNG
PNP_NITHX       LMDAGVPLK--RPTAGIAMGLILEGS-R-----YAVLSDILGDEDHLGDMDFKVAGTEVG
PNP_AZOC5       LMDAGVPLK--SPVAGIAMGLILEGE-K-----FAVLSDILGDEDHLGDMDFKVAGTESG
PNP_PARL1       MMDAGVPLK--RAVAGIAMGLILEGE-R-----FAVLSDILGDEDHLGDMDFKVAGTQEG
PNP_MARMM       MMDAGVPIT--RPVSGIAMGLIKDPE-G-----IAVLSDILGDEDHLGDMDFKVAGTTEG
PNP_CAUVC       MMDAGVPLV--RPVSGIAMGLILEQD-G-----FAVLSDILGDEDHLGDMDFKVAGTSEG
PNP_HYPNA       MMDAGVPLT--RPVSGIAMGLILEGS-E-----FAVLSDILGDEDHLGDMDFKVAGTENG
PNP_PARDP       MMDAGVPLK--APVAGVAMGLILEEDGR-----WAVLTDILGDEDHLGDMDFKVAGTENG
PNP_SPHAL       MMDAGVPIK--RPVSGIAMGLILEGK-D-----YAILSDILGDEDHLGDMDFKVAGTSEG
PNP_NOVAD       MMDAGVPVK--RPVSGIAMGLILEGD-K-----FAVLSDILGDEDHLGDMDFKVAGTSEG
PNP_ERYLH       MMDAGVPLK--RPVSGIAMGLILEGD-D-----FTVLSDILGDEDHLGDMDFKVAGSEEG
PNP_ZYMMO       LMDAGVPLT--RPVSGIAMGLILEKD-G-----FAILSDIMGDEDHLGDMDFKVAGTEKG
PNP_PELUB       LMDAGVPIK--EPVAGIAMGLIKEGD-D-----FSVLSDILGDEDHLGDMDFKVAGTKDG
PNP_MAGMM       MQDAGVPIK--APVAGIAMGLVKEGD-A-----YAVLSDILGDEDHLGDMDFKVAGNADG
PNP_RICTY       LMYAGVPIK--APVAGIAMGLIK-EGDK-----FAILSDIIGDEDYFGDMDFKVAGTSKG
PNP_ORITB       LMEAGVPIK--THVAGIAMGLVLGEGNK-----FEILSDISGCEDHLGDMDFKVASTKNG
PNP_ANAMM       LMDTGVPLK--SSVAGIAMGLIK-EGDR-----YAVLSDIIGDEDYLGDMDFKVAGTKDG
PNP_ANAPZ       LMDTGVPLK--SSVAGIAMGLIK-EGDR-----YAILSDILGDEDYLGDMDFKVAGTREG
PNP_EHRRW       LMDTGVPIK--APVAGIAMGLIK-EGEK-----FIILSDILGDEDHLGDMDFKVAGTSSG
PNP_WOLTR       LMDTGVPIK--SPVAGIAMGLIK-DKND-----YVILSDILGDEDYLGDMDFKVAGTSEG
PNP_NEOSM       LMDTGVPIT--KHVAGIAMGLIT-DGVR-----SAVLSDISGDEDMLGDMDFKVAGTRNG
PNP_CHLCV       LMDAGVPIK--TPIAGIAMGLILDNDH------VTILSDISGLEDYLGDMDFKVAGNTEG
PNP_CHLPN       LMDAGVPIS--SPIAGIAMGLILDDQG------AIILSDISGLEDHLGDMDFKIAGSGKG
PNP_CHLMU       LMDAGVPIK--APVAGIAMGLILDQDK------AIVLSDISGIEDHLGDMDFKVAGTEEG
PNP_PARUW       LMDAGVAIK--RPVAGIAMGLILENER------FIILSDILGIEDALGDMDFKVTGDQNG
PNP_BACCN       MMDAGVPLK--APVAGIAMGLVKSG------EHYTILTDIQGMEDHLGDMDFKVAGTAKG
PNP_GEOTN       MMDAGVPIK--APVAGIAMGLVKNE------DHYTILTDIQGIEDHLGDMDFKVAGTRKG
PNP_OCEIH       MMDAGVPIK--APVAGIAMGLVKSG------DDYTILTDIQGMEDALGDMDFKVAGTANG
PNP_BACHD       MMDAGVPIK--APVAGIAMGLVKQD------EHVSVLTDIQGMEDALGDMDFKVAGTRKG
PNP_BACSK       MMDAGVPIK--APVAGIAMGLVKQG------EHMTVLTDIQGMEDALGDMDFKVAGTANG
PNP_LISIN       MLDAGVPIK--APVAGIAMGLVKLG------DDYTILSDIQGMEDHFGDMDFKVAGTKDG
PNP_ENTFA       LMDAGVPIK--APVAGIAMGLVSDG------ENYTILTDIQGLEDHLGDMDFKVAGTKDG
PNP_STAS1       LMDAGVPIK--APVAGIAMGLVTRD------DSYTILTDIQGMEDALGDMDFKVAGTAEG
PNP_STRMU       LMAGGVPIK--APVAGIAMGLISDG------TNYTVLTDIQGLEDHFGDMDFKVAGTREG
PNP_STRTD       LMAGGVPIK--APVAGIAMGLISDG------TNYTVLTDIQGLEDHFGDMDFKVAGTRLG
PNP_LACLA       LMAGGVPIK--APVAGIAMGLISDG------TNYTVLTDIQGLEDHFGDMDFKVAGTRDG
PNP_SPICI       LMAAGVPIT--APVVGIAMGLIKEK------NNYTILTDIQGMEDHLGDMDFKVAGTATG
PNP_ONYPE       LMASGVPLK--KAVAGMSVGLVFDQA----TNKYVILSDIQGLEDHVGDMDLKIAGTNKG
PNP_ACHLI       LMAAGVPIK--APVAGIAMGLIMDG------EHYSILSDIQGMEDHEGDMDFKVAGTKDG
PNP_FUSNN       LMSAGVPIK--EHVAGIAMGLIKEG------EEFTVLTDIMGLEDHLGDMDFKVAGTKSG
PNP_TRIV2       LMDAGVPIL--KPVSGAAMGLIK------EGDEVRVLTDIQGIEDFLGDMDFKVAGTDAG
PNP_TRIEI       LMDAGVPIV--KPVSGAAMGLIK------EDEEVRILTDIQGIEDFLGDMDFKVAGTDSG
PNP_ACAM1       LMDAGVPLA--KPVSGAAMGLIK------EGEEVRVLTDIQGIEDFLGDMDFKVAGTADG
PNP_SYNE7       LMDAGVPIK--KPVSGAAMGLIR------EGDEYRVLTDIQGIEDFLGDMDFKVAGTDQG
PNP_SYNY3       LMDAGVPIK--KPVSGAAMGLIK------EGDEIRILTDIQGIEDFLGDMDFKVAGTDSG
PNP_THEEB       LMDAGVPIR--KPVSGAAMGLIK------EGNEVRILTDIQGIEDFLGDMDFKVAGTDSG
PNP_PROMA       LLDAGVPLK--APVSGAAMGLIK------EGEEVRILTDIQGIEDFLGDMDFKVAGTEKG
PNP_PROMP       LLDAGVPLK--APVSGTAMGLIK------EGKEVRILTDIQGIEDFLGDMDFKVAGTEKG
PNP_SYNR3       LMDAGVPIA--APVAGAAMGLIR------EGSEVRVLTDIQGIEDFLGDMDFKVAGTEKG
PNP_SYNJA       LMDAGVPIK--APVSGVAMGLIK------EGDEVRILTDIQGIEDFLGDMDFKVAGTRAG
PNP_GLOVI       LMDAGVPIR--EPVSGVAMGLIK------EGDEVRILTDIQGIEDFLGDMDFKVAGTRDG
PNP_DEHM1       LMDAGVPVK--KAVAGISIGLITG-----ENDTYCTITDIEGIEDNYGDMDFKVAGTRDG
PNP4_ALKMQ      LLDAGVPIK--DMVAGIAMGLVK------ENDKIAILSDIQGMEDALGDMDFKVAGTDKG
PNP_ALKOO       LLDAGVPLK--DMVAGIAMGLVK------EGDAVAILSDIQGMEDHLGDMDFKVAGTAKG
PNP3_ALKMQ      LMDAGVPIK--RMVAGIAMGLIK------EDDQVVILSDIQGMEDALGDMDLKVAGTEEG
PNP_CLOD6       LLDAGVPIK--DMVAGIAMGLIK------HDGKVAVLSDIQGMEDHLGDMDFKVAGTEYG
PNP_CALS8       LMDAGVPIK--APVAGISIGLIT-K---EDG-SFITLTDIQGIEDFFGDMDFKVAGTREG
PNP_CALS4       LMDAGVPIK--APVAGIAMGLIK-E---ED--EVLILTDIQGIEDFLGDMDFKVAGTEKG
PNP_CLOPS       LLDAGVPIK--RPAAGIAMGLIT-S---KDLTEEEVLTDIQGLEDFFGDMDFKVAGTEEG
PNP_CLOB8       LLDAGVPIK--RPAAGIAMGLIT-S---EDLSEEAVLTDIQGIEDFFGDMDFKVAGTTEG
PNP_CLOBL       LLDAGVPIK--RPAAGIAMGLIT-S---DDLEREKVITDIQGIEDFFGDMDFKVAGTEKG
PNP_CLOTE       LLDAGVPIK--RPAAGIAMGLVT-N---DDLTEEKILTDIQGIEDFFGDMDFKVAGTEKG
PNP_CLONN       LLDAGVPMK--RPAAGIAMGLVT-S---EDLEKEEILTDIQGLEDFFGDMDFKVAGTEKG
PNP_CLOAB       LMDAGVPIK--RPAAGIAMGLIT-S---EDLSKEAVITDIQGLEDFFGDMDFKVAGTEKG
PNP_LACP7       LMAAGVPIK--KQVAGISCGLVTGD---TDDD-YLVLTDIQGLEDFFGDMDFKVAGTHDG
PNP_HUNT2       LMDAGVPIK--KPVAGISAGLVVDE---NNPDRFVTFMDIQGIEDFFGDMDFKVAGTKDG
PNP_CARHZ       LMDAGVPIK--APVAGVAMGLIK------EGDEVAILTDIQGIEDALGDMDFKVAGTKDG
PNP_MOOTA       LMDAGVPIK--APVAGVAMGLVK------ENDQVAILTDIQGLEDALGDMDFKVAGTKKG
PNP_DESRM       LMDAGVPLK--APVAGVAMGLIM------EEDQFTVLTDIQGLEDHLGDMDFKVAGSANG
PNP_PELTS       LMDAGVPIS--APVAGVAMGLIK------EGDNFTVLTDIQGFEDHLGDMDFKVAGTAKG
PNP_DESHY       LMDAGVPVK--SPVAGIAMGLIS------EENHIAILSDIQGMEDHDGDMDFKVAGTSQG
PNP_SYNWW       LMHAGVPIK--APVSGIAMGLVK------EGERFAIMSDIQGIEDALGDMDFKLAGTEKG
PNP_SYMTH       LMAAGVPIK--APVAGVAMGLVE-D---PETGRYAVLTDIQGIEDALGDMDFKVAGTKKG
PNP_CHLAA       LMDAGVPIK--APVAGVAMGLITG-----EDGRWRVLTDIQGLEDALGDMDFKVAGTAKG
PNP_ROSS1       LMDAGVPIK--APVAGVAMGLITG-----KDGRWRVLTDIQGIEDHLGDMDFKVAGTAKG
PNP_DEIRA       LMDAGVPLK--APVAGVAMGLVMEG------DNYRVLTDILGLEDALGDMDFKVCGTAEG
PNP_THET8       LMDAGVPIR--APVAGVAMGLVWEE------NRAVILTDILGLEDALGDMDFKVAGTRKG
PNP_RENSM       LLNAGVPLK--APVAGIAMGLVSDQ-VD-GQTRYAALTDILGAEDAFGDMDFKVAGTSEF
PNP_KINRD       LLNAGVPLR--AAVAGIAMGLISDT-VD-GETRYAALTDILGAEDAFGDMDFKVAGTKEF
PNP_STRAT       LLNAGVPLK--APVAGIAMGLISQE-IN-GETHYVALTDILGAEDAFGDMDFKVAGTKEF
PNP_NOCSJ       LLQAGVPLK--APVAGIAMGLVSGE-ID-GQLQYVALTDILGAEDAFGDMDFKVAGTREF
PNP_ACIC1       LLNAGVPLR--APVAGIAMGLISDT-VD-GETHYVTLTDILGAEDAYGDMDFKVAGTRDF
PNP_CUTAK       LLNAGVPLR--ASVAGIAMGLMSETDED-GKTKYLALTDILGAEDALGDMDFKVAGTSEF
PNP_FRACC       LLNAGVPLK--APVAGIAMGLIHAD------DSYVTLTDILGAEDAYGDMDFKVAGTRDF
PNP_THEFY       LMAAGVPLK--DMVAGIAMGLIYED------GKYVTLTDILGAEDAYGDMDFKVAGTRDL
PNP_RHOJR       LLNAGVPLK--APVAGIAMGLVSDQ-VD-GETRYVALTDILGAEDAFGDMDFKVAGTKDF
PNP_SACEN       LLNAGVPLK--APVAGIAMGLVSDE-ID-GKTHYVALTDILGAEDAFGDMDFKVAGTKEF
PNP_SALTO       LLSAGVPLK--APVAGIAMGLISDE-VE-GKTRYVTLTDILGAEDAFGDMDFKVAGTQEF
PNP_COREF       LYNAGVPLK--APVAGIAMGLVSDEVD--GKTEYVALTDILGAEDAFGDMDFKVAGTAEF
PNP_CORDI       LYNAGVPLK--APVAGIAMGLVSDEVD--GETRYVALTDILGAEDAFGDMDFKVAGTRQF
PNP_CORJK       LYNAGVPLK--APVAGIAMGLVTGKVGKAGKDKYVTLTDILGAEDAFGDMDFKVAGTPDF
PNP_LEIXX       LLNAGVPLR--APVAGIAMGLISDV--IDGETRYAALTDILGAEDALGDMDFKVAGTSEF
PNP_TROWT       LLNAGVPLR--APVAGIAMGLISGR--VDGEMRYVTLTDISGSEDALGDMDFKVAGTSDF
PNP_BIFLO       LLAAGVPLK--APVAGIAMGLVSGD--VDGKHIFKTLTDILGAEDAFGDMDFKVAGTSEF
PNP_RUBXD       LMDGGVPIK--APVAGVAMGLVKEG------DDYVILTDIQGLEDHMGDMDFKVAGTRDG
PNP_LEPIC       LMAAGVPIQ--GSVSGIAMGLFSDSSG-----KYAVLSDIAGLEDHFGDMDCKIAGTRKG
PNP_NITSB       LKAANIDLA--DLVAGVAMGLIVEDDK------YAILTDIMGLEDHDGDMDFKVAGTHDG
PNP_WOLSU       LKAAGINTT--ALVAGVAMGLIVEAEK------HAILTDIMGLEDHDGDMDFKIAGTSTG
PNP_SULDN       LRAADIETS--DTIAGIAMGMVSEGDK------YAILSDIMGLEDHDGDLDFKVTGSKDG
PNP_ARCB4       LKAAGIPIS--DLVAGVAMGMVVENDK------YAILTDIMGLEDHDGDMDFKVAGTSKG
PNP_CAMC5       LRAAGVDTQ--KLVAGVAMGLIFEGDK------HAVLTDIMGLEDHDGDMDFKVAGSSDG
PNP_CAMFF       LRAAGVETI--KLVAGVAMGLVFEGDE------HAVLTDIMGLEDHDGDMDFKVAGSKDG
PNP_CAMHC       LRAAGVSTL--KLVAGVAMGLIFEDDK------HAILTDIMGLEDHDGDMDFKVAGTREG
PNP_CAMJD       LKAAGVPSL--KLVAGVAMGLIFEDNK------YAVLTDIMGLEDHDGDMDFKVAGSKDG
PNP_HELHP       LCACGIKVE--SLIAGVAMGLVTQDEQ------CAILTDISGLEDHDGDMDFKVAGGYKG
PNP_HELPH       LYASGVEIH--DLVAGVAMGMVSEGQD------HAILSDISGLEDAEGDMDFKIAGNLEG
PNP_HELAH       LYASGVEIH--DLVAGVAMGMVSEGQD------YAILSDISGLEDAEGDMDFKIAGNLEG
PNP_HELPJ       LYASGVEIH--DLVAGVAMGMVSERQD------HAILSDISGLEDAEGDMDFKIAGNLEG
PNP_SULNB       LRAAEVDMV--ELVAGIAMGLVTDGER------VAVLTDIMGLEDHDGDMDFKIAGTRNG
                               * : *:.              : *: . **  **:* *: .    

PNP_FERNB       ITAFQMDCKVSGVSEELLRQALYQAKEARMFILDKLYETIS-EPRKELSPYAPRISWFFI
PNP_THEM4       ITAFQMDCKIAGVGEELLKKALKQARVARMRILDIMFETIK-EPRKSLSPYAPLIANIEI
PNP_THEP1       ITAFQMDCKVSGVSDELLMKALMQAREARMYILDRMYETIS-APRPHLSKYAPIIKVTKV
PNP_PSELT       ITAFQMDCKVSGVSADLLERALNQAKEARLYVLEKLYETIS-KPRDTLSKYAPVIKVISI
PNP_PETMO       ITAFQMDVKTSQVNKEVLQKALEKAKIARLKILDKMYETIP-QPRKELSPYVPIMKVFKI
PNP_AQUAE       ITSVQMDIKVKGITKEIMLDALKQAREGRLYILEKMYEAIP-EPRKEPHPYTPKVEVVDV
PNP_TREDE       ITGFQMDIKIAGVSPEIMKNALAQAKEGRMHILGIMNQCIS-APNAELSQYAPRVEMMTI
PNP_TREPA       ITGFQMDVKVEAVSASLMKEALQQARVGRLHILSVMNQTIS-APSVHISRYAPHIESFKI
PNP_BORBU       ITGFQMDIKIENVTKDLMRDALEQARIGRIHILSIMNTVIS-NSRVGISKYAPKIVQLQI
PNP_DESVV       ITAVQMDIKVKGLPTDVMARAMQQARDARLHILGEMGKVLE-APRAELSAYAPQHAEVFV
PNP_DESAG       VTAVQMDIKIDGLPAEVMGRALAQAREARLHILNEMAKVLP-EPRQALSKYAPQLSVVEV
PNP_LAWIP       ITAVQMDIKITGLTTDVMRKAMEQAREARIHILSEMAKALD-VPRSNLSQYAPQHAELVV
PNP_SYNFM       ITAIQMDVKIAGIDRGIMQRALEQARAGRIFILGKMKEVLS-APRPELSPYAPRVITIMI
PNP_ANADF       ITSIQMDIKIGGVTREILERALAQAADGRKHILGEMAKAIA-TPRESISAYAPRITTIKI
PNP_MYXXD       ITSIQMDIKITGLTTEIMSRALEQARQGRLHILGEMLKTLA-ESRKEISQYAPRITTIQI
PNP_SORC5       VTAIQMDIKIAGLSRQILAQALDQAREGRLHILGKMLETLP-TTRPELSQYAPRITTVRV
PNP_GEOUR       VTALQMDIKIGGVTREIMGIALKQALEGRLHILGRMADTIK-TSKSDLSTYAPRITTIYV
PNP_PELPD       ITALQMDIKIGGVTREIMQKALAQAREGRLHILGKMAETLG-APRPEMSSFAPRITTIWV
PNP_PELCD       ITALQMDIKIKGVSKEIMQQALEQAREGRLHILDKMAEAIT-APRSDLSPYAPRITTIQV
PNP_SYNAS       ITAMQMDIKIDGINEDILRKALAQAREGRLFIIDKILATIS-EPRKELSIYAPRITTVKV
PNP_DESPS       ITALQMDIKIDGVSRDIMSNALDQAKRGRMHILEEMSKGIA-EARAEVVEHAPKYFIHKI
PNP_BDEBA       ITALQMDIKIDSVSFEVMEQALAQAKEGRAHILNEMEKVMK-VPRGQISEFAPRIETIKI
PNP_BACV8       ITATQMDIKVDGLSFEILEKALLQAKEGREHILNKLTECIA-EPRKDLKPHAPRIETMTI
PNP_PORGI       ITATQMDIKVDGLSYEILENALEQAKQGRLHILGKIMEAQP-ETRDDLKPHAPRIEKMHI
PNP_CYTH3       ITACQMDIKVDGLSYDILSQALQQANRGRLHILSEMKKTLA-TPREDLKPHAPRMIMIQI
PNP_FLAPJ       ITACQMDIKIDGLKYEIMEAALAQARDGRLHILNILTETLA-TPKVDVKAYAPKIIMRTI
PNP_GRAFK       ITACQMDIKVKGLSYEILVNALKQARDGRLHILEKLTDTIA-QPNADVKAYAPKMITRRI
PNP_SULMW       MTACQMDIKISGITYDVLSYTIFKAKKGLLFIIKKMLTTLS-CPRKSLNITATKIYTFYI
PNP_CHLPD       ITACQMDIKIDGLDYHILETALEQARKGRLHILDKMEVAIP-ISRGELAQYAPRLTSIQI
PNP_CHLTE       ITACQMDIKIDGLDYHILETALEQARKGRLHILDVMAEAIP-ESRADIGKYAPRLTTIQI
PNP_PELLD       ITACQMDIKIDGLDYHILENALAQARRGRFHILDKMEEAIP-ASREELAQYAPRLTAIQV
PNP_CHLCH       ITACQMDIKIDGLDYHIVENALEQARKGRLHILNEMEKAIP-ASRTDLATYAPRLTTIKI
PNP_SALRD       ITACQMDMKIEGLSRDVMLKALKQSRDARHHILDRMEETIA-EPRAELSSHAPRLTKLTI
PNP_KORVE       ITALQMDIKIGGITAQIMREALEQARRGRLFILDKMNEVIQ-SPRTELSEFAPRFYTLQI
PNP_SOLUE       ITGMQMDIKVPNITTAIMKEALEQARRGRLFILDKMYEAMP-QANTAISQYAPRIYTLHI
PNP_RHOBA       ITGIQLDLKVTGVTNDIIRATLKQSREARIEILKKMLTTIP-RPRREISPTAPRLLRTKI
PNP_ECOLI       ISALQMDIKIEGITKEIMQVALNQAKGARLHILGVMEQAIN-APRGDISEFAPRIHTIKI
PNP_PHOPR       ITALQMDIKIEGITKEIMQIALNQAKGARKHILSVMDDAIG-THRDDISQFAPRIHTMKI
PNP_HAEDU       ITALQMDIKIEGITPEIMHIALNQAKGARMHILNVMEQALP-APRADLSDFAPRIHTMKI
PNP_COLP3       ITALQMDIKIEGITQEIMQIALNQAKAARTHILSVMDEAIG-GHRDDISEFAPRIHTMKV
PNP_PSYIN       ITALQMDIKIEGITREIMQIALNQAKAARLHILTVMDQALP-QGRADISQFAPRIHTIKI
PNP_PSEA6       ITALQMDIKIEGITQEIMQVALKQAKEARLHILGVMDQAIS-GHRDEMSEFAPRIYTLKI
PNP_AERS4       ITALQMDIKIEGITKEIMEIALKQARGARLHILKVMDEAIQ-APRAEISDFAPRIHTIKI
PNP_SHELP       VTALQMDIKIEGITKEIMQIALQQAYGARVHILNVMDQAIS-GHRAEISDHAPRITTLKI
PNP_IDILO       ITALQMDIKIDGITRDIMESALAQAKSARLHILKVMDEAIG-GHREELSTYAPRFTTIKI
PNP_PSEHT       ITALQMDIKIEGITQEIMQIALKQAKAARLHILEVMDKAIS-APSEELSQFAPRIYTMKI
PNP_BUCAP       ITALQMDIKIEGITNEIMRIALNKAKSARLHILNVMKQALS-KPRNEISEFAPRIHKIKI
PNP_BUCBP       ITALQMDIKVKGITNEIMKLALYQAKNARIHILNIMKKSLN-VPRKDISIFAPRIHTIKI
PNP_BUCCC       ITALQMDIKVSGITSDIIRSALYQAKSARLKILDIMENTLQ-IPRSDISKFAPRIYTIKI
PNP_WIGBR       VTALQMDIKIEGITSEILQVSLDKAKNARINILNEMDKVIK-KPKNEISIFAPRIYKIKI
PNP_BLOFL       ITALQMDIKIKGITYDIIEVSFKKARCALLRILDIMDQVIK-IPRKDISEFAPRIYSIKI
PNP_BLOPB       ITALQMDIKTDGITYDIINIALKKAKNARLQILDVMEQIIK-FPNQEISKFAPRIYSIKV
PNP_BAUCH       ITALQMDIKTKGITNNIIQLALNQAKDARMHILNMMEQVIS-MSRTDISPFAPRIHTIKI
PNP_NEIG1       VTALQMDIKIQGITKEIMQIALAQAKEARLHILDQMKAAVA-GP-QELSAHAPRLFTMKI
PNP_CHRVO       VTALQMDIKIQGITKEIMQVALEQAKEGRLHILGLMKEAVD-GP-QELSAHAPRLYVMKI
PNP_METFK       ITALQMDIKITGITAEIMRVALSQAKEGRLHILGLMKEAVG-EQPQELSEFAPRIITMKI
PNP_THIDA       VTALQMDIKITGITKEIMQAALTQAKEGRMHILGIMKASVS-ET-HEMSAYAPRIIAMKI
PNP_NITEC       ITALQMDIKIQGITKEIMQVALLQAKEGRLHILDIMKQSLP-IARDSVSVHAPRIIKFKI
PNP_NITMU       ITALQMDIKIQGITKEILHAALVQAREGRMHILAIMRQVLP-ARREDISEHAPRIIKIRI
PNP_VEREI       ITALQMDIKIQGITREIMQVALAQAKEARMHILGKMQQAIG-QAKTEVSNFAPKLYTMKI
PNP_METPP       VTALQMDIKIQGITKEIMQVALAQAKEARLHILGKMVEALG-GAKEELSVFAPRLYVMKI
PNP_BORA1       ITALQMDIKIQGITKEIMQVALAQAREGRLHILGKMRESLD-GSRTELSAFAPRMLTIKI
PNP_JANMA       ITALQMDIKIQGITKEIMQVALAQAKEGRVHILGEMEKAVPSGTTGELSDFAPRLITIKI
PNP_RALSO       ITALQMDIKVQGITKEIMQVALAQAKEGRLHILGKMQAAMG-HARTELSEHAPRMITVKI
PNP_POLAQ       ITALQMDIKVQGITKEIMQVALAQAKEGRLHILSKMQEAMG-SVRTELSAHAPRMVSFKI
PNP_PARXL       VTALQMDIKIQGITREIMQVALAQAKEGRLHILGKMTSAVS-GANTVLSDYAPRMITIKI
PNP_DECAR       ITALQMDIKIQGITKEIMQVALAQAKEARIHILNLMQESAA-GPREEMSAYAPRLYTFKI
PNP_AROAE       ITALQMDIKIQGITKEIMQVALAQAGEGRIHILALMKQALA-SHRGEVSEFAPRMLTMKI
PNP_ALKEH       VTALQMDIKIQGITREIMEQALEQAREGRLHILGEMNNAIS-GPRSEMSEYAPRLLTIRI
PNP_HALHL       VTALQMDIKIDGITREIMEQALDQARSGRLHILEQMNQVID-KPREQMSEYAPRLLTMRI
PNP_METCA       VTALQMDIKIDGITPEIMRQALHQAREGRMHILDKMAQALP-APRSEMSDYAPRITSFTI
PNP_NITOC       ITALQMDIKIDGITEEIMRTALSQAREGRFYILQKMNEIIS-TPRQEMSEYAPRMIVFKI
PNP_XYLFT       VSALQMDIKIEGITEEIMRQALQQAKVGRLHILGEMDKALA-APRAELSDYAPRLLTIKI
PNP_COXBR       VTALQMDIKIEGITKEIMEQALDQAKEGRLHILSIMNKVLD-KPRSQVSDLAPQYVTMKI
PNP_DICNV       VTALQMDIKINGITEEIMRQALSQAHEGRLHILEVMNQAIA-APRAELSDYAPRFSSMRI
PNP_PSEU5       VTALQMDIKIQGITEEIMEIALGQALEARLNILGQMSQVIA-QSRSELSANAPTMLAMKI
PNP_SACD2       VTALQMDIKIEGITEEIMEIALGQAMDARLHILAEMNRVIA-SPRKELSENAPQFHTMKI
PNP_HAHCH       VTALQMDIKINGITDEIMEIALEQALHARLHILGEMNKVIS-EPRDSVADNAPKMETIKI
PNP_MARHV       VTALQMDIKIQGITDEIMEIALEQANAARLHILDEMNKVIA-EPRAELSDRAPSITTIKI
PNP_CHRSD       VTALQMDIKIEGINEEIMETALQQAHEARLHILEQMNTVIA-QSRSEVSDNAPSMATIKI
PNP_ALCBS       VTALQMDIKIEGITEEIMEKALNQANAGRLHILGEMNKAIA-ESRSEVSDNAPTLLTLKI
PNP_ACIAD       ITALQMDIKIEGITEEIMEVALNQAYAGRMHILNEMNKVIS-RARAEISAHAPTFEVITI
PNP_PSYWF       ITALQMDIKIEGITSDIMEKALEQAHAGRIHILNAMNEVLP-ASRTEINAHAPNYAVIEI
PNP_HYDCU       VTALQMDIKITGITQEIMHIALKQAKEGRLHILKEMEKAIG-SSNQDVATTAPRFFTVKV
PNP_LEGPA       ITALQMDIKISGITNEIMERALEQALEGRTHILGVMNNALA-EHRTELSQHAPRITTMKV
PNP_VESOH       VNALQMDIKIQSITHEIMEIALKQAKEARLNILGQMNQVIC--EPNTSNKNTPKTTIIKI
PNP_FRATW       VTALQMDIKIKGISREILEQALEQARVGRLHILGIMNEVIK-EHKEAVSDVAPQIHVMNI
PNP_GRABC       VTSLQMDIKITSITTEIMRIALQQARDGRMHILGEMAKAIT-GARGSVAATAPRITVINV
PNP_ACICJ       VTSLQMDIKITSITPEIMKIALDQAKDGRLHILGEMSKALT-GAREGVSANAPRITVINV
PNP_GLUOX       VTALQMDIKITSITPEIMKIALEQAREGRIHILGEMAKALT-EGRGEVSGNAPKITTISV
PNP_MAGSA       VTALQMDIKITSITEEIMKIALGQAKDGRIHILGEMNKGLD-HARDSVSGNAPRITTISI
PNP_RHORT       ITSLQMDIKITSITKEIMNVALNQAKDGRIHILGEMTKALG-NARSDVSDFAPRITTIKV
PNP_CHESB       VTSLQMDIKITGITEEIMKVALEQAKDGRLHILGEMANALS-ESRGELGEFAPRIEVMHI
PNP_BARBK       ITSLQMDIKIDGITEDIMKIALEQAKDGRNHILNEMAKALT-DARTELSEFSPRIEMMTI
PNP_NITHX       ISSLQMDIKIAGITEEIMKVALAQAREGRIHILGEMAKALT-NARAELGEYAPRIETFKI
PNP_AZOC5       VTALQMDIKIAGITEEIMKVALAQAKDGRAHILGEMSKALT-SARAELGEHAPRIEVMKI
PNP_PARL1       VTSLQMDIKITGINERIMKQALAQAKGGRLHILGEMAKALD-TARPEMGEYAPRIEVITV
PNP_MARMM       VTSLQMDIKIAGIDEEIMKTALAQASGGRLHILEEMGKALG-EARTELGEFAPRIETITI
PNP_CAUVC       LTSLQMDIKIAGITPAIMEQALAQAKEGRAHILGEMNKAMD-APRADVGDFAPKIETINI
PNP_HYPNA       VTSLQMDIKVAGITKDIMGKALEQAKGGRMHILGEMGKALT-ASRGQLSENAPQMEIIKV
PNP_PARDP       ITSLQMDIKVAGITPEIMEQALAQAKDGRLHILGEMSKALS-EGRREFSAHAPRIETMTI
PNP_SPHAL       ITTMQMDIKIAGITREIFEAALAQAKEGRAHILGEMNKALG-EVRTELSAHAPRIETMQI
PNP_NOVAD       ITTMQMDIKVAGITREIFEVALRQASEGRAHILGEMTKALG-EARTELSAHAPRIETLQI
PNP_ERYLH       ITSLQMDIKVAGITQEIMTKALEQAKAGRAHILGKMTEALG-SSRGEVSKHAPRIETMQI
PNP_ZYMMO       ITSLQMDIKVAGITEEIMQKALEQAKGGRAHILGEMSKALG-EVRSEISNLAPRIETMSV
PNP_PELUB       ITSLQMDIKITGITFEIMEQALKQAKEGRIHILGEMNKALS-ESRADVGEHTPKMEQITV
PNP_MAGMM       ITALQMDIKITGITREIMAKALEQARAGRLHILGEMGKAMT-THRAEMSAYAPRIHTMKI
PNP_RICTY       ITALQMDIKISGIDFKIIQVALEQARHGRLHILEQMNKIIS-KPNSELSKNAPSSTTIKI
PNP_ORITB       ITALQLDIKVQGINLSMIESTFRQAKIGINHILNVMNNTIS-CPKSELSTYAPMVQTLEI
PNP_ANAMM       ITALQMDMKIRGIGFDIIEKSLQQAKDGRLFIIGKMDKVIK-ESREGVRDHVPRMESMII
PNP_ANAPZ       ITALQMDMKVKGIDFAVLGTALDQAKEGRFFIIEKMDRVIK-ESRGAVREHVPRMESMLI
PNP_EHRRW       ITALQMDMKISGISIEVIEKSLLQAKDGRMHILDKMNLVIQ-ESRECIKNHAPRIESIFI
PNP_WOLTR       ITALQMDMKISGISFEIVEKSLEQAKAGRLHILEKMNSVIS-EHSDDVKGHAPRMVSFYI
PNP_NEOSM       IVALQMDMKVRGISIATIRDALNQALAGRLHILEKMEHVIA-KPRESLKDSAPKILCYKI
PNP_CHLCV       ITAFQMDIKVEGITPTIMQAALAQAKAGRQHILDIMKEALA-APKTDLSQYAPRIETMQI
PNP_CHLPN       ITAFQMDIKVEGITPAIMKKALSQAKQGCNDILNIMNEALS-APKADLSQYAPRIETMQI
PNP_CHLMU       ITAFQMDIKVEGITHEIMEQALAQAKQGRSHILNLMTQVMS-SPNDSVSRYAPRIETMQI
PNP_PARUW       ITAFQMDIKVEGITIEIMRVALKQAKEGRVHILNKMLAVCP-TYKGEMSRYAPRIETIQI
PNP_BACCN       VTALQMDIKIDGLSREILEEALQQAKVGRMHILD-HMLSVIAEPRKELSEYAPKIITMTI
PNP_GEOTN       VTALQMDIKIKGLTRDILEEALQQARKGRLEILD-HMMQTLSEPRKELSKYAPKILIMHI
PNP_OCEIH       VTALQMDIKIDGLSRDILEEALSQAKKGRMQILD-SMLATIKEPKEELSEFAPKILTMAI
PNP_BACHD       VTALQMDIKISGIDRAILEQALEQARKGRMIILD-NMLEAISESRSELSPYAPKILTMTI
PNP_BACSK       VTALQMDIKISGINREVLEQALEQAKQGRMKILS-NMMEAIDKPRAELSEYAPKILTLTI
PNP_LISIN       ITALQMDIKIDGLSRQILDEALTQAKEGRLHILE-HLTSTISEPREELSAYAPKIITLNI
PNP_ENTFA       ITALQMDIKIQGITEQILTEALDQAKKARMEILE-ELTTTIAAPREELSQYAPKIEMIQI
PNP_STAS1       ITAIQMDIKIDGLTKEIIKEALDQAREGRLAILD-HMLQTIDTSRSELSAFAPKVVTMTI
PNP_STRMU       ITALQMDIKIEGITPQILEEALAQAKKARFEILD-VIEKVIPAPRLELAPTAPKIDTIKV
PNP_STRTD       ITALQMDIKISGITPAILEEALAQAKVARFEILD-VIESAIAEPRSELAPTAPKIDSIQI
PNP_LACLA       ITALQMDIKISGITPEILAEALAQAKTARFQILD-VIEATIAQPREELAPSAPKIDTITI
PNP_SPICI       ICALQMDIKIVGINKAILQEALKAAKKARLTILD-NVLATISAPRTHLAPTAPKMKTFMI
PNP_ONYPE       ITALQMDLKIQGIHFKILQEAFLQAKKGRLHILE-HMSQTISQPRLEVSKYAPKVCMMQI
PNP_ACHLI       ITALQMDIKIQGITTEIMKEALEQARKGRLHILS-HMNTVISETRTELSAFAPKVKMIRI
PNP_FUSNN       ITALQMDIKITGITEEIMRIALNQAHQARIQILE-LMNNTISKP-AELKSNVPRIQQITI
PNP_TRIV2       ITALQMDMKISGLSLEVIAQAIHQAKDARLHILD-KMLQTIDTPRTETSPYAPRLLTIKI
PNP_TRIEI       ITALQMDMKITGLPIEVIADAIHQAKPARIHILD-KMLSVLDLPRPDMSPYAPRLLSFKI
PNP_ACAM1       ITALQMDMKITGLSMKVIAEAIHQAKPARLHILD-KMLATIDSPRETMSPYAPRLLTIKI
PNP_SYNE7       ITALQMDMKIHGLPLEIIADAINQAKPARLHILN-KMLEAIATPRADLSTYAPRLFRIQI
PNP_SYNY3       ITALQMDMKIDGLSMEVVSKAIMQALPARLHILD-KMLATIREPRPELSPFAPRLLTLKI
PNP_THEEB       ITALQMDMKITGLPVAVIQQAIEQARPARLHILE-KMLAVLDKPRPQLPPSAPRLLTLQI
PNP_PROMA       ITALQMDMKMTGLPIKIIGEAINQAKPARTHILE-KMVQAIDKPRETLSPHAPRLLSFRI
PNP_PROMP       ITALQMDMKITGLPVSVISDAIKKARPARLHILE-KMQEAIDKPQESLSPHAPRLLSFRI
PNP_SYNR3       ITALQMDMKITGLAMKTIGEAVTQARPARLHILE-KMLEALDKPRDTMSPHAPRRLSFRI
PNP_SYNJA       ITALQMDMKITGITVDVVEKALLQAKAGRDYILD-KMLEVLPAPRPQLAKTAPRLLTFKV
PNP_GLOVI       ITALQMDIKIQGITLQILEAAIQQSKAGRLHILE-KMLIAIDKPRVELSPYAPRLLTLKI
PNP_DEHM1       ITAIQVDMKVKGISFDVIRDAIYQAKEARYTILE-VMDKALAQPKTELSPYAPRMYKISI
PNP4_ALKMQ      ITAIQMDIKIKGIHKDILKDALEQARVGRLHILD-KMKKAIDKPRPELSPFAPRVLKMKI
PNP_ALKOO       ITAIQMDIKIKGIDEPILKDALEQARVGRLYILD-KMKEAISSPRPELSPYAPRMLKMKI
PNP3_ALKMQ      ITAMQMDIKIAGIDRGIMETALEQARIGRLHILN-KMKESITSPRIELSSYAPKVTQIKV
PNP_CLOD6       ITAIQMDIKIDGIDKEILQRALKQAKEGRIHILG-EMRKTISQPKPELSPYAPKIVKMQI
PNP_CALS8       ITAIQLDIKIHGLTKEIIEKALYQAREARLKILD-FMQTVIDKPRSELSPYAPKIFKTTV
PNP_CALS4       VTAIQMDIKIPGIDRDILQMALEKARKARLYVLQ-KMLEVIKEPRKELSKYAPRVVRMVV
PNP_CLOPS       ITSIQVDTKIKGLSEKVIHDAIYGARKARLMILD-KIKECIPAPREEVSKYAPKTSTLQI
PNP_CLOB8       ITSIQVDTKLQGFSFNVVENAIRDARKARLTIID-KINECISTPKEDVSLYAPKTQIMSI
PNP_CLOBL       ITSIQFDTKIKGLSNSCVKDALEGAKKARLHILG-KIKECIPEPRKELSKYAPRTEIICI
PNP_CLOTE       ITALQVDTKISGLSDNCIKETLIKAKDARMYILG-KIKECIPEHRAELSPYAPRVYTMTI
PNP_CLONN       ITAIQVDTKIKGLSNDCIKKAITNARKARLTILE-VINNCIDKPREEVSKYAPKVFTMSI
PNP_CLOAB       ITAIQVDTKIHGLSKYCIKTAINDARKARLFILE-KMVACINEPRKELSTYAPRAYTINI
PNP_LACP7       ITAIQMDIKIHGLTRAIIEEAIRRTKEAREYIINEVMTPAIAEPRTEVGKYAPKIIQIQI
PNP_HUNT2       ITAIQVDIKIDGLTEEIIKQAFELTRKGRLYIIDNVLLKAIPEPRKQMSKYAPKIISTTI
PNP_CARHZ       ITALQMDIKIAGVTRDILTKALAQAREGRMHILG-KMLEVISEPRKELSPYAPRIIFTTV
PNP_MOOTA       ITALQMDIKIAGIDRSILERALEQARRGRLFILD-KILATIPEPRKELSPYAPRMLTITI
PNP_DESRM       VTALQMDIKIPGITREVFEQALEQAHRGRMFILG-KMLEVLSTPRAEISVHAPAIIRTSI
PNP_PELTS       ITALQMDIKIPGITREVFEKALAQAYEGRMHILN-KMLEVLPAPRPELSPHAPRIIHITI
PNP_DESHY       VTALQMDIKIKGVSREILERALTQAKEGRLFILD-KMLSVIEKPRPELSPFAPRIITASI
PNP_SYNWW       VTALQMDIKITGVNREIVEAALKQAREGRMFILK-KMLEAIDKPNEELSPYAPQMIRMQI
PNP_SYMTH       VTALQMDMKISGTSREILEKALMQAREGRMFIME-KMLACISEPRKELSPWAPRIITMKI
PNP_CHLAA       VTGLQMDIKTTGITYEIMREAFAQARAGRLFILD-KMNEVISAPRPELSIYAPRIMTIQI
PNP_ROSS1       VTGLQLDIKTTGITYEIMREAFAQAREGRLYILD-KMNAVISEPRKELSPYAPRIITLQI
PNP_DEIRA       VTALQMDIKVGGITPQIMREALAQAKEGRLHILG-KMAEVLAAPRAELSPTAPHILSLKI
PNP_THET8       VTALQMDNKVGGLPREVLKEALLQAREARLKILD-LMEAVLPAPRPELKPFAPRILSLKV
PNP_RENSM       VTAIQLDTKLDGIPASVLAAALKQAREARLHILG-VLNAAIDVP-DELSEFAPRVIAVKI
PNP_KINRD       VTAIQLDTKLDGIPASVLAGALTQARDARLHILD-VMAEAIDAP-DEMSPTAPRIITVKV
PNP_STRAT       VTALQLDTKLDGIPASVLAAALKQARDARLHILD-VMMEAIDTP-DEMSPNAPRIITVKI
PNP_NOCSJ       VTALQLDTKLDGIPAEVLAQALTQARDARLTILD-VMAEAIDEP-EEMSAYAPRIITITI
PNP_ACIC1       VTALQLDTKLDGIPASVLAAALPQAREARLTILD-VMAKAISEP-APMSPYAPRIITIKI
PNP_CUTAK       VTALQLDTKLDGIPADVLAGALKQAKEARTAILE-VMNEAIDSP-DEMAPTAPRIITVHI
PNP_FRACC       VTALQLDTKLDGIPASVLAAALQQARGARLAILD-VMAEAIGSP-DEMSAHAPRVISVKI
PNP_THEFY       ITALQLDTKLDGIPAEVLASALQQARGARLAILD-VMSEAINRP-AEISPHAPRILTVKV
PNP_RHOJR       VTALQLDTKLDGIPSKVLAGALSQAKDARATILE-VMAEAIDTP-DEMSPFAPRVTAIKV
PNP_SACEN       VTALQLDTKLDGIPSEVLAQALGQARDARFTILE-VMAEAIGKP-DEMSPHAPRVTSISI
PNP_SALTO       VTALQLDTKLDGIPSDVLAAALQQAYEARQTILE-VMQAAIEAP-ATMSDYAPRVTTVKI
PNP_COREF       ITALQLDTKLDGIPSKVLADALEQARDARLAILE-TMAEVIDGP-DEMSQFAPRITTIQI
PNP_CORDI       ITALQLDTKLDGIPSEVLAQALSQANDARNTILD-TMAEVIETP-DEMSDYAPRITAITV
PNP_CORJK       VTALQLDTKLDGIPSDVLAEALQQARTARLEILQ-LMEEAIDSP-DDMSDLAPHITSINI
PNP_LEIXX       VTAIQLDTKLDGIPSSVLASALKQAKDARTTILS-VLDAAIDAP-DEMAPTAPRVISVQI
PNP_TROWT       ITALQLDTKLDGIPAHVLSEALAHARSARLAILD-VLTRVIDSP-DQMSEYAPRVVRVKI
PNP_BIFLO       ITALQLDTKLDGIPADILAAALQQAKEARATILE-VINECIDGP-AEMSEFAPRIITTSV
PNP_RUBXD       ITALQMDMKITGVSAELLKEALEQARRGRLQILD-IMREEIAEPRPEISDHAPRVEVIQI
PNP_LEPIC       ITAFQMDLKVTGVSFDVLESVFEQAQRGRFHILDIMEKHIS-KASSTLAGTAPRIIVRNI
PNP_NITSB       VTAMQMDIKLGGVQQEILEQALQQAREARLHILKIMEEAAE--KIEINEENLPSSHTITV
PNP_WOLSU       ITAMQMDIKLGGLSMEILKEALYQAKEGREHILGIMEKAQS--EIIINDEILPSLQIFSI
PNP_SULDN       ITAMQMDIKLGGISLNILKEALYQAKEGRAHIINIMQEAEK--NISFNDGVLPSTDFFHI
PNP_ARCB4       ITALQMDIKLGGIELSVLKEALLQAKEGRTHILSLMKDAEK--DIVPS-GALPLIEQFAI
PNP_CAMC5       ITALQMDIKLGGISLEVLKEALYQAKRGREHILNLMHQADS--KIEVNEDVLPKLELFSV
PNP_CAMFF       ITALQMDIKLGGISLDVLKEALYQAKEARDHILNLMVKADE--EIVVNEDVLPKLELFSV
PNP_CAMHC       ITALQMDIKLGGISLEILREALNQAKDGRNYILNLMEVAND--DIIINEEILPKIEIFGV
PNP_CAMJD       ITALQMDIKLGGIDQETLKQALYQAKEGRIHILNIMEEATK--EIIVNEEVLPKLELFSV
PNP_HELHP       ISAMQMDIKLGGITQEILCQALFQAKEAREQILAIMEEARA--KIVLNDVILPKSESFMI
PNP_HELPH       ITAMQMDTKMSGIQLEILYQALLQAKEARKHILKIMHEAKE--KIVINFSHLPTTEIFNV
PNP_HELAH       ITAMQMDTKMSGIQLEILYQTLLQAKRVREHILKIMHEAKE--KIVINFSHLPTTEIFNV
PNP_HELPJ       ITAMQMDTKMSGIQLEVLYQALLQAKRARKHILKIMHEAKE--KIVINFSHLPQTEIFNV
PNP_SULNB       ITALQMDIKLGGIDLITLKVALEKAAQGKDHILDLMEEAEK--KMESS-QALPSTEHFSI
                :   *.* *        .   .  :      ::                   .      :

PNP_FERNB       DPTRSGELIGPGGKTIKSIIKMFDV-----EISLDDS----TGKVTVSGVD-AEKVQEAV
PNP_THEM4       DPMKVGELIGPGGKVIKSIVKEFDV-----EISIDDV----TGKVSVYGKD-QNKVNQAI
PNP_THEP1       DPEKVADVIGPGGRVIKKIIKDFDV-----KVEIDDE----TGLVKVVGSS-EENVDKAI
PNP_PSELT       DPSKVAEIIGPGGKIIKALIKDYDV-----KISVDDL----TGKVSVIGGN-EEKVDAAI
PNP_PETMO       PVSKIGEVIGPGGKNIKEISELYNV-----EVYIED-----DGKVKVTGHN-ANKVDEAI
PNP_AQUAE       PEEKAPLIIGPGGSTVKKIYDETGV-----KVWVGE-----QGKVYLFVFP-GGDVEKAK
PNP_TREDE       PEDKIGALIGPGGKNVKAISDKYNV-----TINTEN-----DGTVTIYSKDGTSDLKGAK
PNP_TREPA       AVEKIGALIGPGGKTVKSLSDQYRV-----TINTDS-----DGTVTVSGRD-AQSVFDAK
PNP_BORBU       DIDKISLVIGSTGKTVKAITDEFEV-----KVQIEQ-----NGKIILFGDD-DFKMQKAK
PNP_DESVV       NPDIIRIIIGPGGKNIKAITATTGA-----SIDIED-----SGRVSIFAPTL-EAMEMAR
PNP_DESAG       NPEIIRVIIGPGGKNIKAITSATGA-----SIDIED-----SGRISIFAPTK-ESMDMAR
PNP_LAWIP       NPDAIRMIIGPGGKNIKQITTVTGA-----AIDIND-----SGKISIFAPTS-EAMEQAK
PNP_SYNFM       NPEKIRDVIGPGGKVIRSIVAETGA-----KIDIED-----SGKVVIMSPDG-AACDKAV
PNP_ANADF       RPERIKDIIGPGGKTIKDITARTGT-----SINIED-----DGSVSIASPSQ-DKVEAAI
PNP_MYXXD       RPEFIKNVIGPGGKVIKDIIARTGA-----AINIED-----SGRVDIASANG-EAVKAAI
PNP_SORC5       KPDQIRLIIGPGGKTIKGIVDQTGV-----AIDVED-----DGTVNVASADS-DAVKRAL
PNP_GEOUR       KTDKIRDVIGSGGKNIRGITEATGV-----TIDIDD-----TGKINIASTDK-AACDLAI
PNP_PELPD       KTDKIRDVIGTGGKNIRNITETTGV-----TVDIED-----TGRINIASTSK-EACDLAI
PNP_PELCD       KPDQVRTVIGPGGKNVRGIIEATGC-----AIDIED-----DGRINIASADG-DACKAAI
PNP_SYNAS       KPEKVRAVIGTGGKNIRQIVSETGV-----TIDVED-----DGTVTIASSDM-EASARAI
PNP_DESPS       SQDKIRDIIGPGGKIIKELSAQYDA-----KIEVDD-----SGLVKMFVANG-ALAEALV
PNP_BDEBA       KPDKIREVIGSGGKVIRGITEATGV-----KIEIQD-----DGTINIASADP-EATKKAI
PNP_BACV8       PKEFIGAIIGPGGKIIQGMQEETGA-----TITIEE--TDGVGRIEIAGTNK-KCIDDAM
PNP_PORGI       GKEFIGAVIGPGGKIIQGIQEKSGA-----TVNIEE--VDGMGVIEISGTNK-PCIDAAI
PNP_CYTH3       PKELIGAVIGPGGKIIQEIQKTSGA-----TVNIEE--KDNAGWVSIFSKDK-TALDSAL
PNP_FLAPJ       PGNFIGALIGPGGKVIQELQKATGT-----TIVINE--VDEMGVVEILGTDP-AGIEAVL
PNP_GRAFK       PNEFIGALIGPGGKVIQELQKETGT-----TIVINEDPVTEEGIIEILGTEQ-EGIDKVI
PNP_SULMW       PKKLIGAVIGSGGKRIQEIQVSTET-----NIKIKE--KNYLGVIEILGKNE-TKLKIAI
PNP_CHLPD       PVDAIGLIIGKGGETIRSITEETGA-----EINIED-----DGTVTIACSSP-EGTNAAV
PNP_CHLTE       PVDAIGMVIGKGGETIRSITEETGA-----EINIDD-----DGTVTIACSSP-EATKAAV
PNP_PELLD       PVESIGLIIGKGGETIRSITEETGA-----EINIED-----DGTVTIACSSN-EGTKAAV
PNP_CHLCH       PSDCIGMVIGKGGETIRGITEETGA-----EINIAD-----DGTVTIACTTK-EGTDAAL
PNP_SALRD       DPDRIGAVIGPGGKVVKSVQEETNT-----EITVEE--EEGVGIVTIAATNQ-RDAEAAI
PNP_KORVE       PTDKIRDLIGPGGKVIRGIVEATGV-----KIDVED-----SGKVNVASSDQ-EAAKKAL
PNP_SOLUE       PTDKIRDVIGPGGKVIRGIIEQTGV-----KIDVED-----DGTIHVASADE-ASANKAI
PNP_RHOBA       SPDKIGALIGPGGKNIRGIQETTGA-----VIEVDD-----EGTVLVASSNK-ESAQEAM
PNP_ECOLI       NPDKIKDVIGKGGSVIRALTEETGT-----TIEIED-----DGTVKIAATDG-EKAKHAI
PNP_PHOPR       NSDKIKDVIGKGGAVIRALTEETGT-----TIEIED-----DGTIKIAATEG-AAAKEAI
PNP_HAEDU       DPKKIKDVIGKGGAVIRSLTEETGT-----SIDIDD-----DGTVKIAATDN-NAAKMVM
PNP_COLP3       SQDKIRDIIGKGGATIRQLTEETGT-----TIEIED-----DGTVKIAATSG-EQAEDAI
PNP_PSYIN       NTDKIRDVIGKGGAVIRSLCEETGT-----TIEIED-----DGTVKIAATSG-EQADDAI
PNP_PSEA6       DQDKIRDVIGKGGAMIRSITEASDT-----NIEIED-----DGTIKIFATER-AKADIAI
PNP_AERS4       NPEKIKDVIGKGGSVIRALTEETGT-----NIELDD-----DGTVRISAVAN-EAAMEAI
PNP_SHELP       NPEKIRDVIGKGGATIRALTEETGT-----TIELED-----DGTVKIASANG-DATKEAI
PNP_IDILO       DQDKIKDVIGKGGAVIRELTESTNT-----NIEIGD-----DGTIKVAASDQ-ADADAAI
PNP_PSEHT       PQKKIAEVIGKGGATIRQLTEETGT-----TIEIGD-----DGTIKIAATDG-ESAANAI
PNP_BUCAP       NPEKIKDVIGKGGSVIRMLTEETGT-----IIEIED-----DGTIKISATIG-EKAKNAI
PNP_BUCBP       NPEKIKDVIGKGGSVIRMLTEETGT-----TIEIED-----DGTVKISAVMQ-EKAKCAI
PNP_BUCCC       NPEKIKDVIGKGGSIIRMLTEETGT-----VIEIKD-----DGIVKISAING-EKAKYAI
PNP_WIGBR       NPEKIKDVIGKGGSVIRMLTEKTKS-----SIEIED-----DGTVKVISTDI-KNAQCAL
PNP_BLOFL       NPDKIKDVIGKGGSVIRALTEKTST-----IIDIED-----DGVIKVISLNA-EKAKQAV
PNP_BLOPB       NPDKIKDVIGKGGSVIRSLTEETNT-----IIDIED-----NGIIKIVALDY-DKAKQAI
PNP_BAUCH       HPDKIKDVIGKCGSVIRALTEETKT-----IIDIED-----DGTVTVAATDS-IKAQQAI
PNP_NEIG1       SQDKIRDVIGKGGETIRSITAETGT-----EINIAE-----DGTITIAATTQ-EAGDAAK
PNP_CHRVO       NPEKIREVIGKGGETIRSITKDTGC-----EINIEE-----DGTITIASVSS-EGAEAAK
PNP_METFK       NPEKIRDVIGKGGAVIRALTEETGT-----TIDIEE-----DGTIKIGCTSA-EAGEEAK
PNP_THIDA       NPEKIRDVIGKGGAVIRALTEETGT-----QIDIQE-----DGSVKIACTSM-EAGELAK
PNP_NITEC       NPEKIRDVIGKGGAVIRALTEETGT-----TIDISD-----DGSVTIASISN-EGGEQAK
PNP_NITMU       NPEKIRDVIGKGGAVIRALTEETGT-----TIDITD-----DGTVMIACVNA-EGGELAK
PNP_VEREI       NAEKIRDVIGKGGAVIRALTEETGC-----QINIEE-----DGTITIAATDA-AKADIAK
PNP_METPP       NPEKIRDVIGKGGATIRALTEETGT-----QINIEE-----DGTITIASTDG-DKAQAAM
PNP_BORA1       NPEKIRDVIGKGGATIRALTEETGT-----QIDISD-----DGTIVIASVDE-GQAKEAQ
PNP_JANMA       NPEKIRDVIGKGGAVIRALTEETGT-----QIDISD-----EGVVTIASVDA-AAGQEAK
PNP_RALSO       NPEKIRDVIGKGGSTIQALTKETGC-----TIDIQE-----DGTITIASTSS-EGMAEAK
PNP_POLAQ       HPDKIREVIGKGGATIQALTKETGC-----SIDIKD-----DGTVTIASTSA-EGMAEAK
PNP_PARXL       NPEKIRDVIGKGGSVIRALTEETGT-----TIDISD-----DGVVTIASTSS-EGMAEAK
PNP_DECAR       NPEKIRDVIGKGGAVIRALTEETGT-----TIDIQD-----DGTITIAATSG-EAAAAAR
PNP_AROAE       NPEKIRDVIGKGGAVIRGLQEETGT-----VIELQD-----DGSVTISSVSA-EGAQLAK
PNP_ALKEH       DPDKIRDVIGKGGATIRALTEETGT-----TIDISD-----DGKVTIASADK-AAADEAR
PNP_HALHL       DPERIRDVIGKGGATIRGLTEETGT-----NIDISD-----EGVVTIASADK-AAAEEAK
PNP_METCA       DPSKIREVIGKGGATIRAITEETGT-----SIDISD-----DGVVKIASVDK-QAGLEAR
PNP_NITOC       NPEKIRDVIGKGGATIRALTEETGT-----TIDIVD-----DGTVKIFSADK-ADGQEAK
PNP_XYLFT       HPDKIRDVIGKGGSTIQAITKETGT-----QIDIQD-----DGTIVIASVNN-AAAREAK
PNP_COXBR       NPEKIRDVIGKGGVVIREITEATNC-----AIDISD-----DGTIKIAAHTT-EEGEAAK
PNP_DICNV       DTEKIKDVIGKGGATIRSITEQTGT-----TIEIED-----DGSVKIAATDK-AAAANAR
PNP_PSEU5       DQDKIRDVIGKGGATIRAICEETKA-----SIDIED-----DGSIKIFGETK-EAAEAAK
PNP_SACD2       DPDKIRDIIGKGGATIRSITEETGA-----SIDIDD-----NGTIKIYADDG-DGMQAAI
PNP_HAHCH       DPDKIRDVIGKGGATIRSICEDTGA-----SIDIDD-----NGTVRIYAESK-LAADEAI
PNP_MARHV       HPDKIRDVIGKGGATIRGICDETGA-----SIDLDD-----DGNVKIYADNA-AAAQAAV
PNP_CHRSD       DPDKIRDVIGKGGATIRKICDDTGA-----SIDLDD-----DGTVRIYAEDK-TAAKAAI
PNP_ALCBS       NPDKIRDVIGKGGATIRALTEETGC-----TIDIED-----DGSVKIYGETR-EKADEAV
PNP_ACIAD       NPDKIRDVIGKGGATIRQITEETKA-----AIDIED-----NGTVRVFGETK-AAARAAI
PNP_PSYWF       NSDKIRDVIGKGGATIRQLTEDTGA-----VIDIDD-----NGTIRIFGENK-AATKEAI
PNP_HYDCU       KPEKVREIIGKGGATIRSITEETGV-----TIEIDD-----DGNVKIAAVDD-ESANAAK
PNP_LEGPA       AEDKIRTIIGKGGATIKGLIESTGV-----SIDIDD-----SGVIQLFSPDK-MALEEAQ
PNP_VESOH       KTDKIRDLIGRGGETIKGIISTSCA-----SIDVDD-----SGNVNIFSNNQ-KSFDTAV
PNP_FRATW       NPAKIKDVVGRGGATVKGIVEKTGA-----QIDTSD-----SGEVKVFAKDK-KSMDMAV
PNP_GRABC       PKEKIREVIGTGGKVIREIVEFSGA-----KIDIED-----DGTIKIASTSE-ESTQKAI
PNP_ACICJ       PKDKIRDVIGTGGKVIREIVEYSGC-----KIDIED-----DGTIKIAATSD-EQAQKAI
PNP_GLUOX       PKEKIRDVIGSGGKVIREIVEYSGA-----KVDIGD-----DGTVTIAASND-EQAQKAI
PNP_MAGSA       PKEKIREVIGTGGKVIREICEQTGA-----KIDIDD-----DGTIKVASVDA-DAAQRAI
PNP_RHORT       PPQKVREVIGSGGKVIREITEVTGT-----KIDIED-----DGTIKIASADA-EATQRAV
PNP_CHESB       PTDKIRDVIGTGGKVIREIVEKTGA-----KINIED-----DGTVKIASSNG-KEIEAAR
PNP_BARBK       PVEKIREVIGSGGKVIREIVEQTGA-----KINIED-----DGTIKIASPDT-KSIETAK
PNP_NITHX       PTDKIREVIGTGGKVIREIVEKTGA-----KINIED-----DGTVKVASNDG-EAMKAAI
PNP_AZOC5       AVDKIREVIGSGGKVIREIVEKTGA-----KINIED-----DGTIKIASASG-DSIKAAI
PNP_PARL1       PTDKIREVIGTGGKVIREIVEKTGA-----KVDISD-----DGTIKVASSDG-ESIRKAI
PNP_MARMM       PTDKIRDVIGSGGKVIREIVETTGA-----KVDVND-----DGVIKVSSSDG-ASIKAAL
PNP_CAUVC       PTDKIREVIGSGGKVIREIVATTGA-----KVDIND-----DGVVKVSASDG-AKIKAAI
PNP_HYPNA       PTDKIRDVIGSGGKVIRGIVDETGA-----KVNIDD-----DGTVQISAMDR-KSIDAAI
PNP_PARDP       PTDKIREVIGSGGKVIREIVETSGA-----KVDISD-----DGTIKIASANA-DSIKKAY
PNP_SPHAL       DKAKIRDVIGTGGKVIREIVATTGA-----KVDIDD-----EGLIKISSSDL-DQIEAAR
PNP_NOVAD       DKSKIRDVIGTGGKVIREIVATTGA-----KVDIDD-----EGLIKISSSDL-TQIEAAK
PNP_ERYLH       DKSKIRDVIGTGGKVIREIVAETGA-----KVDIDD-----EGVIKISSSNA-DEIEAAR
PNP_ZYMMO       PKDKIRDVIGTGGKVIREIVATTGA-----KVDIED-----DGTVRLSSSDP-ANIEAAR
PNP_PELUB       DKKDIAAVIGKGGATIREIVEKSGA-----KLDVND-----EGVVTVAAPDE-ESRNIAM
PNP_MAGMM       HPDKIREVIGSGGKVIRSITEETGC-----AIDIED-----DGTIRIASSDQ-ASAEQAV
PNP_RICTY       DKDKIKDIIGPGGKIIKEICETSNA-----KIDISD-----DGTVSVYAADR-DKIKVAL
PNP_ORITB       QKEKIRDVIGLGGKVIKELCKTFDV-----EIDISE-----NGEVKVWGNVG-ENVKKAV
PNP_ANAMM       DKNKIKNVIGTGGKNVREICEKTGV-----KIEISQ-----DGTVMIYAVSR-DAVEEAK
PNP_ANAPZ       DKGKIKNVIGAGGKNVREICEKTGA-----KIEISQ-----DGTVMIYAVGR-EAIESAK
PNP_EHRRW       NKDKIRNVIGSGGKNIREICEKTGA-----RVEIMQ-----DGTVMIYAINN-DAVEYAK
PNP_WOLTR       DKDKISAAIGAKGKNIRSVCERSNA-----KIEIGD-----DGKVSVFAMSS-AEAEIAK
PNP_NEOSM       DKDVVHKVIGSGGKTIRGISSDTSA-----KIDIDQ-----NNYVYIMADTE-EALMEAK
PNP_CHLCV       KPNKIATVIGPGGKQIRQIIEEAGV-----QIDIND-----SGLVSISASSP-QAIEKAK
PNP_CHLPN       KPTKIASVIGPGGKQIRQIIEETGV-----QIDVND-----LGVVSISASSA-SAINKAK
PNP_CHLMU       NTSKIATVIGPGGKQIRQIIERSGA-----QVDIND-----NGLINISANTQ-ESIDKAK
PNP_PARUW       KPSKIAVVIGPGGKQIRAIIEQTGV-----QIDIDD-----TGLVNIAAIDL-VSIEKAK
PNP_BACCN       NPDKIRDVIGPSGKQINKIIEETG-----VKIDIEQ-----DGTVFISSIDQ-QMNEKAK
PNP_GEOTN       NPDKIREVIGPSGKQINKIIDETG-----VKIDIEQ-----DGTIFISSVDE-EANQKAK
PNP_OCEIH       EPDKIRDVIGPSGKQINQIIDETG-----VKIDIEQ-----DGSIFISSTDN-EMNKKAK
PNP_BACHD       NPDKIRDVIGPSGKMINKIIEDTG-----VKIDIEQ-----DGTIYISSADT-NMNNKAR
PNP_BACSK       NPDKIRDVIGPSGKVINKIIEETG-----VKIDIEQ-----DGTVYISSLDT-AMNQKAK
PNP_LISIN       KPEKIKDVIGPGGKQINAIIEETG-----VKIDIEQ-----DGTVYIASQDQ-AMNRKAI
PNP_ENTFA       KPAKIKDVIGKGGETINSIIDETG-----VKIDIDQ-----DGNVSIASSDA-EMIKKAI
PNP_STAS1       KPEKIRDVIGPGGKKINEIIDETG-----VKLDIEQ-----DGTIFIGAVDK-DAIARAR
PNP_STRMU       DVDKIKIVIGKGGETIDKIIEETG-----VKIDIDE-----DGNIAIYSSDQ-EAINRTK
PNP_STRTD       PVDKIKVVIGKGGETIDKIIAETG-----VTIDIDE-----EGLVQIFSSDQ-DAIDRAK
PNP_LACLA       PVDKIKVVIGKGGEQIDKIIAETG-----VKIDIDD-----EGLCSIFSSDQ-AAIDRAK
PNP_SPICI       PVDKIREVIGPGGKMITAIIEKSDD----VKIDIED-----DGQVTIYHKET-TAIEKAY
PNP_ONYPE       KPEKIRDIIGSGGKIINQIIESHDG----VKIDIEQ-----DGRVFVMHSNL-ETVKKTV
PNP_ACHLI       NPDKIRDVIGAGGKIITQIIEDHNN----VKIDIEQ-----DGRVFIMHTDS-AWLNKTA
PNP_FUSNN       PKDKIAALIGPGGKNIKGIIEQTG-----ATVDITD-----DGLVSVFAKDA-DTLEKTL
PNP_TRIV2       DPDMIGLVIGPGGKTIKGITEETGA-----KIDIED-----DGTVTISAVDE-NKAKRAR
PNP_TRIEI       DPEMIGLVIGPGGKTIKGITEETGV-----KIDIDD-----DGTVTIAAADG-EKAKQAC
PNP_ACAM1       DPEQIGMIIGPGGKTIKGITEETGA-----KIDIED-----DGRVTISAVDE-KAASRAR
PNP_SYNE7       NPEQIGLVIGPGGKTIRSITEQTGA-----KIDIED-----TGAVTISAVDA-DSALRAK
PNP_SYNY3       EPEHIGMVIGPGGKTIKGITEQTSC-----KIDIAD-----DGTVTIASSEG-ERAERAR
PNP_THEEB       PPDMIGLVIGPGGKTVRGISEQYNV-----KVDISE-----EGLVTITAPNE-TNAKQAR
PNP_PROMA       DPELIGTVIGPGGRTIKGITERTNT-----KIDIED-----GGIVTIASHDG-VAAEEAQ
PNP_PROMP       DPELIGTVIGPGGRTIKGITERTNT-----KIDIED-----GGIVTIASHDG-AAAEEAQ
PNP_SYNR3       DPELIGTVIGPGGRTIKGITERTNT-----KIDIED-----TGIVTVASHDG-AAAEEAQ
PNP_SYNJA       DPEDIGKIIGPGGKMVRSITEATGA-----KVDISD-----DGTITVSSSVG-GQAEAAR
PNP_GLOVI       PVDMIGLVIGPGGKTIKRIVEETGA-----KVDIED-----DGTVVVSSIDG-AKALAAK
PNP_DEHM1       DPSKIGSVIGSGGKTIRSIIEQTNT-----TVDIEN-----DGTVVIGATDE-ASAQKAI
PNP4_ALKMQ      HPDKIRDVIGSGGKTINRIIDETGV-----KIDIDN-----DGTIFIAAESQ-EAVEKAI
PNP_ALKOO       HPDKIREVIGSGGKTINKIIEDTGV-----KIDIEN-----DGTIFIAAQTQ-EAGELAL
PNP3_ALKMQ      HPDKVREVIGAGGKVINKIIDETGC-----KITIEN-----DGTIYVAAPDQ-ESSRRAV
PNP_CLOD6       NPDKIKDVIGPGGKIITKIIDETGV-----KIDIEQ-----TGEVFISGIEI-DMIKKAQ
PNP_CALS8       DPEKIRDIIGPGGKMINKIIAKTNV-----KIDIEP-----DGRIFVAAPDD-ISGNRAI
PNP_CALS4       NPEKIRDIIGPAGKTITKIISETGV-----KIDIEE-----DGRLYITAPNL-EAGERAK
PNP_CLOPS       DPEKIRDVIGAGGKVINKIIADTGV-----KIDIKE-----DGLVYVSSAES-EGVKEAV
PNP_CLOB8       NPDKIRDVIGAGGKVINKIIQDTGV-----KIDIKE-----DGTVFVSSTDH-NGVNEAI
PNP_CLOBL       DPEKIRDVIGAGGKVINKIIADTNV-----KIEIKE-----DGKIFVTSNNEPEGVKKAI
PNP_CLOTE       APEKIRDVIGAGGKTINKIIGETGV-----QIDIKE-----DGKIYVMSSDS-VGANRAL
PNP_CLONN       NPSKIKDVIGAGGKTINKIIDETGV-----KIDIKE-----DGSVFVTAEDY-ESGKKAL
PNP_CLOAB       DTDKIRTLIGTGGKTINKIIEETGV-----KIDIRE-----DGTVFVLSSDA-DSANRAL
PNP_LACP7       DPQKIGDVVGQRGKTINAIIEQTGV-----KIDIND-----EGAVSVCGTDK-DMMDKAI
PNP_HUNT2       NPDKIREVIGPGGKMINKIIDETGV-----KIDIND-----DGRVYIFSSDI-QAGKRAR
PNP_CARHZ       DPEKIRDIIGPGGKIIKKIIDETGV-----KIDIED-----DGRIFIAAVDK-EAGEKAL
PNP_MOOTA       DPDKIRDIIGPGGKIIKKIIEETGV-----EIDVED-----DGRVFIASTDA-AAGERAL
PNP_DESRM       HPDKIRDIIGPGGKIIKKLVEETGA-----DIDIED-----DGRVFIAAVDR-EKGKRAL
PNP_PELTS       DPDKIRDVIGPGGKVIKKIVEETGA-----EIDIED-----DGRVFIAAVDQ-EKGRKAQ
PNP_DESHY       HPDKIREVIGPGGKTIKKIIDETGV-----KIDIED-----DGRVFISAVDG-EAGENAL
PNP_SYNWW       DPDKIREVIGPGGKTIHKIVDETGC-----KIDIED-----DGSLFIMATDE-EAAKKAR
PNP_SYMTH       SPEKIRDVIGKGGSTINKIIEETKVGHTKVEIDIQD-----DGTIYIAAVNL-EAGERAR
PNP_CHLAA       PVDKIGALIGPGGKTIRNICETTGA-----QIDIED-----DGRVFITTPDG-AAARQAI
PNP_ROSS1       NPEKIGALIGPGGKTVRGITEATGA-----QIDIEE-----DGRVYISTPDA-AAAQQAV
PNP_DEIRA       NPELIGKVIGPGGKQVREL-EAMGA-----QVTIEE-----DGTVRIFSASG-ESAEAVK
PNP_THET8       PVEKIGLVIGPGGKNVRAL-EELGV-----EVDIEE-----DGTVRIYSSDL-QAALEAK
PNP_RENSM       PVDKIGEVIGPKGKMINQIQEDTGA-----DISIED-----DGTVYIGATNG-PSADAAR
PNP_KINRD       PVDKIGEVIGPKGKMINQIQEDTGA-----DISIED-----DGTVFIGAVDG-PSAEAAR
PNP_STRAT       PVDKIGEVIGPKRQMINQIQEDTGA-----EITIED-----DGTIYIGAADG-PAAEAAR
PNP_NOCSJ       PVDKIGEVIGPKGKIINQIQDDTGA-----SISIED-----DGTIYIGATNG-EAAEAAK
PNP_ACIC1       PVDQIGAVIGPKGKIINQIQDDTGA-----EITIED-----DGTIYIGATEG-TAAEAAR
PNP_CUTAK       PVDKIGEVIGPKGKMINQIQDDTGA-----NISIED-----DGTIFIGADNG-DSAESAR
PNP_FRACC       PVDKIGEVIGPKGKMINQIQADSGA-----EITVED-----DGTIYIGAVDG-PSAESAR
PNP_THEFY       PIDKIGEVIGPKGKMINSIQDETGA-----EITIED-----DGTIYIGATDG-PSAEAAR
PNP_RHOJR       PVDKIGEVIGPKGKMINSITEQTGA-----NISIED-----DGTVFVGATDG-PSAQAAI
PNP_SACEN       PVDKIGEVIGPKGKMINSITEETGA-----EITIED-----DGTIYVGAADG-PSAEAAI
PNP_SALTO       PVDKIGMVIGPKGQTINAIQDETGA-----EISIED-----DGTIYVGATNG-PAAQAAV
PNP_COREF       PVSKIGELIGPKGKNINALTEETGA-----NISIED-----DGTVFISAASG-EAAEAAI
PNP_CORDI       PVNKIGEVIGPKGKTINSITEETGA-----NISIEE-----DGTVYVSAASG-AAAEAAI
PNP_CORJK       PQNKIGEVIGPKGKTINQITEETGA-----NITIED-----DGTVFISAVGG-ESAREAE
PNP_LEIXX       PVDKIGELIGPKGKTINAIQDETGA-----DISIDE-----DGTVYIGAVDG-PSAEAAR
PNP_TROWT       PVQKIGELIGPKGKVINSIQDETGA-----EISIED-----DGTVYIGSSQA-DSSEKAV
PNP_BIFLO       PVEKIGEVIGPKGKMINQIQEDTGA-----EIAIED-----DGTVFISSEGG-EAAEKAK
PNP_RUBXD       PTDKIGLLIGPGGKTINALQDEYGV-----NISVEN-----DGTVYVAGVEG-MSVKAAV
PNP_LEPIC       PKDRIGELIGPGGKNVRGISELTGA-----ELYIED-----DGKVTISGSNQ-ESAEKAA
PNP_NITSB       HPSKIVDIIGQAGKTIKEIIEKFEV-----SIDIDRD----KGKVKVTGKNRPKVIAACD
PNP_WOLSU       NPGRIVDIIGQAGKTIKEIIERFEV-----AIDLNRD----NGEVKVTGSNKQKVEAAKE
PNP_SULDN       NPSFIGDIIGQAGKTIREIIEKFEV-----AIDIDKK----DGKVKVTGKSKSGVQAARE
PNP_ARCB4       DPSKIMVVIGKAGATIKEIIEKFTV-----SIDLDKE----NGTVKVSGGNKQNIIDACE
PNP_CAMC5       DPSKIVDIIGQAGKTIKEIIERFEV-----SIDLDRE----KGEVKIAGGAKKNVDAAKD
PNP_CAMFF       DPSKIVDIIGQAGKTIKEIIEKFEV-----SIDLDRD----KGEVKIAGGERQKVEAAKD
PNP_CAMHC       DPNKMVDIIGQGGKTIKELIDKYEV-----SIDLERD----SGEVKIQGANKINVENAKS
PNP_CAMJD       DPSKIVDIIGQAGKTIKEIIEKFGV-----SIDLDRE----KGEVKIAGSQNEQIKAAKD
PNP_HELHP       PPHKIVEVIGAGGRVIKDIIERFEV-----SIDLARE----SGMVSVSASNVENLQKAKT
PNP_HELPH       APDKIVEIIGQGGRVIKEIVEKFEV-----KIDLNKP----SGEVKIMG-NKERVLKTKE
PNP_HELAH       APDKIIEIIGQGGRVIREIVEKFEV-----KIDLNKP----SGEVKIMG-NKERVLKTKE
PNP_HELPJ       APDKIIEIIGQGGRVIKEIVEKFEV-----KIDLNTP----SGEVKIMG-NKERVLKTKE
PNP_SULNB       NPQKIADIIGKAGATIRDIIEKFEV-----SIDLDRD----KGGVKLSGHDKEKVAAAKE
                        :*     :  :            :          .   :             

PNP_FERNB       EYIQ---------------------NMFRDI--SIGDLYTGKVTRVEN-------YGIFV
PNP_THEM4       EYIK---------------------TLTREI--EVGDMFEGKITRIEP-------YGLFV
PNP_THEP1       ELIR---------------------EIAKEI--EVGEVLEGKVTRIEP-------YGLFI
PNP_PSELT       EQIN---------------------SILKEI--SVGDVFSGKVTRIEP-------FGVFV
PNP_PETMO       NHIQ---------------------NLIAQV--EKGGIFEGTVKRVEK-------YGIFV
PNP_AQUAE       QMIQ---------------------DIVREV--EVGAVYKGTITRVEP-------YGVFV
PNP_TREDE       SIVK---------------------GITSDP--EVGMVYDGTVKKIMD-------FGAFV
PNP_TREPA       VAVV---------------------GLTEDP--RVGRVYQGVVKRIVE-------FGAFV
PNP_BORBU       ERIE---------------------SIVREP--KVGEIYEGTVKKINS-------FGAFI
PNP_DESVV       EMVQ---------------------YYDQRA--DIGKNYTGKVRKVLE-------IGAIV
PNP_DESAG       EMVM---------------------YYDQRP--ELGKNYTAKVRKIME-------IGAIV
PNP_LAWIP       QMIL---------------------YYDQRP--ELGKNYKGKVRKILE-------IGAIL
PNP_SYNFM       ERIR---------------------GLTQEP--EVGQLYMSRIVRVTD-------FGAFA
PNP_ANADF       KMIR---------------------SLTQEA--EIGKTYLGTVRKIAE-------FGAFV
PNP_MYXXD       AMIQ---------------------ALTREA--EIGKIYTGTVRKIAE-------FGAFV
PNP_SORC5       DIIK---------------------GLTAEP--EVGATYKGTVKRITD-------FGAFV
PNP_GEOUR       KMIR---------------------DLTAEA--EEGKLYMGLVKKVME-------FGAFV
PNP_PELPD       QMIR---------------------GLTDEA--EEGKLYMGIVKKIMD-------FGAFV
PNP_PELCD       KMIR---------------------NLTQEA--VVGKLYMATVKKIME-------FGAFV
PNP_SYNAS       AMVR---------------------WLTEDA--EVGKIYRGTVKKVVD-------FGAFV
PNP_DESPS       ERVK---------------------SITAEV--EVGAVYTGKVKTIKD-------FGAFV
PNP_BDEBA       AMIN---------------------DIIAEA--EVGKTYKGRIVKIAE-------FGAFV
PNP_BACV8       RIIK---------------------GIVAVP--EVGEVYVGKVRSVMP-------YGVFV
PNP_PORGI       GMIK---------------------GIVAMP--EVGETYPGKITSVMP-------YGCFV
PNP_CYTH3       SQIK---------------------GIVTLP--EVGEVYEGKVKSITA-------FGAFV
PNP_FLAPJ       AKIE---------------------SITFKP--QIGEAYEVKVIKMLD-------FGAVV
PNP_GRAFK       AKIE---------------------SITFKP--EKGSVYEVKVIKVLD-------FGAVV
PNP_SULMW       LKIK---------------------NITFVP--KVGTIYKAKVKNIKK-------FGVFV
PNP_CHLPD       ETIK---------------------TLISKP--EIGNTYLGKVRDIRDE------LGAFV
PNP_CHLTE       ETIK---------------------TLVSKP--EVGTIYMGKVRDIRDE------LGAFV
PNP_PELLD       EIIK---------------------ALIAKP--EVGTIYVGKVRDVRDE------LGAFV
PNP_CHLCH       ATIK---------------------SLTAKP--EVGNIYVGKVRDVRDE------LGAFV
PNP_SALRD       ERIK---------------------QIVAVP--EEGEDYVGTVKGIRD-------FGAFV
PNP_KORVE       KMIG---------------------DITATA--EVGKTYLGTVTRLAD-------FGAFV
PNP_SOLUE       QIIS---------------------DLTATA--EIGKTYLGKVVRLVD-------FGAFV
PNP_RHOBA       RQVE---------------------ACTATV--QIGKIYDGTVSSIKE-------FGAFV
PNP_ECOLI       RRIE---------------------EITAEI--EVGRVYTGKVTRIVD-------FGAFV
PNP_PHOPR       RRIE---------------------EITADV--EVGRIYTGKVMRIVD-------FGAFV
PNP_HAEDU       SRIE---------------------EIVAEV--EVNAIYTGKVSRVVD-------FGAFV
PNP_COLP3       NRIK---------------------ALTAEI--EVGTLYTGKVVRIVD-------FGAFV
PNP_PSYIN       NRIK---------------------ALTAEV--EVGTIYTGKVVRLAD-------FGAFV
PNP_PSEA6       SKIE---------------------QVTADV--EAGKTYEGKVTRIVD-------FGAFV
PNP_AERS4       RRIE---------------------AITAEI--EVNRIYEGKVVRLAD-------FGAFV
PNP_SHELP       RRIQ---------------------EITAEV--EVGTVYNGKVVRIVD-------FGAFV
PNP_IDILO       EKIK---------------------QLTANV--EVGKIYQGKVARIVD-------FGAFV
PNP_PSEHT       SRIE---------------------QLTAEL--EVGTIYEGKVVRIVD-------FGAFV
PNP_BUCAP       RRIE---------------------EITAEI--EVGRIYSGKVTRIVD-------FGAFI
PNP_BUCBP       QRIK---------------------EITAEV--EVGSVYTGKVTRIVD-------FGAFV
PNP_BUCCC       KRIQ---------------------EITEDI--QIGKIYSGKVTRILD-------FGAFV
PNP_WIGBR       KKIK---------------------DITHEI--KINKIYVAKITRISE-------FGIFA
PNP_BLOFL       DRIQ---------------------EITANI--AIGSIYTGRVTHIVD-------FGAFV
PNP_BLOPB       RRIN---------------------DITANV--EIGAVYTGKVSHIVE-------FGAFV
PNP_BAUCH       CRIK---------------------DITAEI--EVGSIYHGKVTRIVD-------FGAFI
PNP_NEIG1       KRIE---------------------EITAEV--EVGKVYEGTVVKILDNN-----VGAIV
PNP_CHRVO       KRIE---------------------EITVEV--EVGKVYEGTVVKILDNN-----VGAIV
PNP_METFK       KRIE---------------------AITAEV--EVGQVYDGTVLKLLD-------FGAIV
PNP_THIDA       KRIE---------------------EITAEV--EVGKVYEGPVIKLLD-------FGAIV
PNP_NITEC       RRIE---------------------NITADV--EVGKIYEGTVLKLLD-------FGAIV
PNP_NITMU       KRIE---------------------DITAEV--EVGRVYDGTVLKLLD-------FGAIV
PNP_VEREI       RRIE---------------------QITAEI--EIGKIYEGPVTKLLD-------FGALI
PNP_METPP       KRIE---------------------EITAEA--EIGKVYEGPVTKILD-------FGALV
PNP_BORA1       RRIV---------------------ELTADV--EVGQVYDGSVLRLLD-------FGAIV
PNP_JANMA       RRIE---------------------ELTASV--EVGKIYEGTVLKLLD-------FGAIV
PNP_RALSO       RRIE---------------------GITAEA--EVGKIYSGTVLKLLD-------FGAIV
PNP_POLAQ       ARIE---------------------GITAEA--EVGKIYEGPVVKLLE-------FGALV
PNP_PARXL       KRIE---------------------NITLEV--EVGQVYEGTVLKLLD-------FGAIV
PNP_DECAR       SRID---------------------AITAEV--EIGKIYEGTVLKILD-------FGAIV
PNP_AROAE       EKIE---------------------AITAEV--EVGKVYNGTVVRLLD-------FGAIV
PNP_ALKEH       RRIE---------------------LLTADV--EVGTVYEGKVSKLMD-------FGAFV
PNP_HALHL       KRIE---------------------LLTADV--EVGKVYDGKVAKLMD-------FGAFV
PNP_METCA       RRIE---------------------DITAEV--EVGKVYEGKVARLMD-------FGAFV
PNP_NITOC       RRVE---------------------EIVSDV--EVGKIYEGRVSRLMD-------FGAFV
PNP_XYLFT       RRIE---------------------QITSDV--EPGRIYEGKVAKIMD-------FGAFV
PNP_COXBR       RRIE---------------------ELTAEV--ELGKVYEGTVVKITD-------FGAFV
PNP_DICNV       RLIE---------------------EIVAEP--EIGRIYDAKVTKITD-------FGAFL
PNP_PSEU5       QRVL---------------------SITAEA--EIGKIYVGKVERIVD-------FGAFV
PNP_SACD2       ARIE---------------------EITAEA--EIGAVYQGKVVRIVD-------FGAFV
PNP_HAHCH       YRIT---------------------EITAEA--EVGKLYRGKVERIVE-------FGAFV
PNP_MARHV       NRVK---------------------EITAEI--EVGAIYKGRVERIVD-------FGAFV
PNP_CHRSD       DTVL---------------------AITAEP--EIGKLYRGTVARITD-------FGAFV
PNP_ALCBS       RRVE---------------------EITAEA--EVGAIYEGKVTRVVD-------FGAFV
PNP_ACIAD       AKIQ---------------------ALTAEV--EPGKIYDGKVIRIVE-------FGAFV
PNP_PSYWF       RQIE---------------------AITAEV--EVGKVYKGTVARVVD-------FGAFV
PNP_HYDCU       ARIA---------------------EITAEP--EIGKVYDAKVVKIVD-------FGAFV
PNP_LEGPA       KQIK---------------------ALIAEI--EVGQTYQGKVSKIVD-------FGAFI
PNP_VESOH       QMVK---------------------DVTAIP--EVNKVYTGKVVKIVE-------FGAFI
PNP_FRATW       AMIE---------------------EIVAEV--EEGQVYKGKIVKLLD-------SGVFV
PNP_GRABC       DRIQ---------------------GIVAEP--EVGKIYNGKVVKTAD-------FGAFV
PNP_ACICJ       DRIR---------------------SLTSEP--EVGQIYTGKVVKIAD-------FGAFV
PNP_GLUOX       ARIE---------------------GIVAEP--EIGRIYEGKVVKTAD-------FGAFV
PNP_MAGSA       DWIR---------------------GIVAEP--ELGVIYNGKVVKVVD-------FGAFV
PNP_RHORT       DWIK---------------------GIVAEP--EIGVVYTGKVVKIMD-------FGAFV
PNP_CHESB       KWIH---------------------SIVAEP--EVGEIYEGTVVKTAD-------FGAFV
PNP_BARBK       SWIH---------------------SIVDEP--EVGTIYQGTVVKTTE-------FGAFI
PNP_NITHX       KWIK---------------------SIASDP--EVGQIYEGTVVKVME-------FGAFV
PNP_AZOC5       NWIK---------------------SIASEP--EVGAIYDGTVVKVVD-------FGAFV
PNP_PARL1       AWIQ---------------------GIVAEP--EVGKIYEGTVVKAVD-------FGAFV
PNP_MARMM       DWIH---------------------GLTAEP--EEGQIYKGKVVKVMD-------FGAFV
PNP_CAUVC       DWIK---------------------SITDEA--EVGKIYDGKVVKVVD-------FGAFV
PNP_HYPNA       KMIK---------------------GITAEA--EVGEIYEGKVVSMKD-------FGIFV
PNP_PARDP       DMIY---------------------SIVAEP--EEGKIYVGKVVKLVD-------FGAFV
PNP_SPHAL       KWIA---------------------GIVEEA--EVGKIYDGKVVNLVD-------FGAFV
PNP_NOVAD       NWIL---------------------GIVEEA--EVGKIYKGKVVNIVD-------FGAFV
PNP_ERYLH       KWIE---------------------GIVEEA--EVGKIYNGKVVNIVD-------FGAFV
PNP_ZYMMO       EWIN---------------------GIVEEP--EVGKIYNGKVVNIVD-------FGAFV
PNP_PELUB       QMIK---------------------DITAKA--ELNKIYSGKVMKIME-------FGAFV
PNP_MAGMM       KIIK---------------------SIVAEV--EKGQVYEGKVVRITD-------FGAFV
PNP_RICTY       DKIK---------------------AIAVEP--EIGEIFNGTVMKVLD-------SGAFI
PNP_ORITB       QSIE---------------------NIVFVP--QIGDIFDGEVVKVIE-------SGAFI
PNP_ANAMM       NMIM---------------------CIVSEP--EVGKVFSGVISEIAK-------YGAFV
PNP_ANAPZ       DMIT---------------------GIVSEP--EVGKIYSGEVCELAK-------YGAFV
PNP_EHRRW       NMIM---------------------DIVSEP--EIGKVFDGTVIEIVK-------FGAFV
PNP_WOLTR       NMMI---------------------DSITEL--EQGAIVDVKVVKIDK-------SIVEL
PNP_NEOSM       TRVDMASGASD--------------SNVPQL--KIGELYDGKIVSVVD-------FGLFV
PNP_CHLCV       SMIE---------------------GLVGEV--EVGKIYEGRVTSIVP-------FGAFV
PNP_CHLPN       EIIE---------------------GLVGEV--EVGKTYRGRVTSVVA-------FGAFV
PNP_CHLMU       ELIE---------------------GLTGEV--EVGKIYNGRVTSVVA-------FGAFV
PNP_PARUW       AIIH---------------------GLTAEI--EIGRIYSGKAISIAP-------FGVFV
PNP_BACCN       KIIE---------------------DIVREV--QVGEIYLGKVKRIEK-------FGAFV
PNP_GEOTN       QIIE---------------------DIVREV--EVGQVYLGKVKRIEK-------FGAFV
PNP_OCEIH       QIIE---------------------DLVREV--EVGQIYLGKVKRIEK-------FGAFV
PNP_BACHD       EIIE---------------------DIVREV--EVGQMYLGTVKRIEK-------FGAFV
PNP_BACSK       QIIE---------------------DLVREV--QVGETYHGKVKRIEK-------FGAFV
PNP_LISIN       AIIE---------------------DIVREV--EVGEVYTGKVRRIEK-------FGAFV
PNP_ENTFA       KIIE---------------------ELTKEV--EVGQVYLAKVVRIEK-------FGAFV
PNP_STAS1       SIIE---------------------DITREA--EVGQVYEGKVKRIEK-------YGAFV
PNP_STRMU       EIIA---------------------SLVREA--KVGEIYEAEVVRIEK-------FGAFV
PNP_STRTD       TIIS---------------------DLVREA--KVGEVYTVPVVRIEK-------FGAFV
PNP_LACLA       EIIA---------------------ELVREA--KVGEIYDAKVVRIES-------FGAFV
PNP_SPICI       QLIK---------------------AIAMPV--VVGEKIIGPVVKIEK-------FGVFV
PNP_ONYPE       AFIE---------------------SLIQEI--QIGTCYQASILRFLSDKQGK-MIGAVA
PNP_ACHLI       AYIE---------------------SLVREA--KVGELYEAKVTRLLMDKDGKKIQGVFA
PNP_FUSNN       KLVD---------------------SFVREV--EYNEVYEGRVVSIMK-------FGAFM
PNP_TRIV2       NIVQ---------------------GMTRKL--NEGDVYAGRVTRIIP-------IGAFV
PNP_TRIEI       NIIQ---------------------GMTKKL--NPGDVYVGRVTRIIP-------IGAFV
PNP_ACAM1       QIIA---------------------GMTRKL--AAGDVFLGKVTRIIP-------IGAFV
PNP_SYNE7       SIIE---------------------GMTRTI--TAGDVYIGKVTRIIP-------IGAFV
PNP_SYNY3       QMIY---------------------NMTRKL--NEGEVYLGRVTRIIP-------IGAFV
PNP_THEEB       AAIE---------------------GLTRKL--NAGDVYLGRVTRIIP-------IGAFV
PNP_PROMA       KIIE---------------------GLTRKV--HEGEVFTGSITRIIP-------IGAFV
PNP_PROMP       KIIE---------------------GLTRKV--HEGEIFPGVVTRIIP-------IGAFV
PNP_SYNR3       KIIE---------------------GLTRRV--SEGEYFDGKVTRVIP-------IGAFV
PNP_SYNJA       AMIE---------------------NLVRRV--EEGQVYLGKVTRIIP-------IGAFV
PNP_GLOVI       QIIE---------------------GMTRTV--EVDKVYLGTVTRIIPN------LGAFV
PNP_DEHM1       KIIE---------------------DLTKDV--EAGSVYTGKVTRIMT-------FGAFV
PNP4_ALKMQ      IIIE---------------------NIIKDP--EVGQNYTGKVIKIMN-------FGAFL
PNP_ALKOO       SIIN---------------------NIVREP--EIGDIFKGKVIKLMN-------FGAFV
PNP3_ALKMQ      EMIE---------------------LIVKDP--VVGEVYTGKVIKIMD-------FGAFV
PNP_CLOD6       ELIN---------------------NIVVEP--EVGKTYKGKVSRIMN-------FGAFV
PNP_CALS8       SMIE---------------------GIGREI--EVGQFFLGKVTRTAS-------YGAFV
PNP_CALS4       QMIE---------------------AITKDI--EVGGIYLGKVLRIAP-------FGAFV
PNP_CLOPS       KIIE---------------------GLTKEV--KSGEIYLGKVTKIAQ-------FGAFV
PNP_CLOB8       KIIE---------------------GLTKEV--KAGEVYLGKVTKITT-------FGAFV
PNP_CLOBL       SIIE---------------------GLTKEV--VQGEIYLGKVTKTTN-------FGAFV
PNP_CLOTE       KMIN---------------------DLTKDV--EAGEIYLGKVTRTTN-------FGAFV
PNP_CLONN       AMID---------------------GYSREV--KEGEVYLGKVTKIAN-------FGAFV
PNP_CLOAB       KMID---------------------DLTKDV--KVGEVYLGKVTKITN-------FGAFV
PNP_LACP7       NMIR---------------------TIVTEF--EEGQVFEGKVISIKE-------FGAFL
PNP_HUNT2       SMIE---------------------AIAKDI--EPGQVFLGRVIRVTS-------FGAFV
PNP_CARHZ       NIIE---------------------NLTKEI--EVGKVYLGKVTRIAD-------FGAFV
PNP_MOOTA       KIIE---------------------SLTQDV--ETGKVYNGKVTRVTD-------FGAFV
PNP_DESRM       EIIQ---------------------SITAEV--QVGKLYNGKVTRVTD-------FGCFV
PNP_PELTS       EIIE---------------------TLTKEV--QTGEIYTGRVTRITD-------FGCFV
PNP_DESHY       KIIQ---------------------ALTQEV--EVGRIYNGRVTRIMD-------FGAFV
PNP_SYNWW       FFVE---------------------SIVAEV--EVGKTYMGTVKRIMD-------FGAFV
PNP_SYMTH       QMIE---------------------ALVKDP--EPGMIYTGRVTRLMQ-------FGAFV
PNP_CHLAA       SMIE---------------------GLTREA--KVGDIFLGKVVSIKP-------FGAFV
PNP_ROSS1       AMVE---------------------ALTREI--KVGDIFLGKVVRIMP-------FGAFV
PNP_DEIRA       ARIE---------------------AVTKEA--KVGEEFEGTVVKIAP-------FGAFV
PNP_THET8       KRIE---------------------DLTREA--KVGEIYEGTVTRITP-------FGAFI
PNP_RENSM       SAIN---------------------AIANPQIPEIGERYLGTVVKTTT-------FGAFV
PNP_KINRD       AAVN---------------------AIANPTMPEVGERYLGTVVKTTT-------FGAFV
PNP_STRAT       ATIN---------------------GIANPTSPEVGERILGSVVKTTT-------FGAFV
PNP_NOCSJ       NAVN---------------------AIANPTMPEVGERYLGTVVKTTN-------FGAFV
PNP_ACIC1       AAIS---------------------AIANPQLPEVGERYLGTVVKATP-------FGVFV
PNP_CUTAK       SMIN---------------------AIANPQMPEVGERYLGTVVKTTS-------FGAFV
PNP_FRACC       SAIN---------------------AIANPQMPEVGERYLGTIVKITN-------FGAFV
PNP_THEFY       DAIN---------------------SIANPTMPEVGERYLGTVVKTTA-------FGAFV
PNP_RHOJR       DMIN---------------------AIANPQLPKVGERFLGTVVKTTA-------FGAFV
PNP_SACEN       DKIN---------------------AIANPQLPKVGERFLGTVVKTAA-------FGAFV
PNP_SALTO       ERIN---------------------GIANPTLPKVGDRFLGTVVKTAA-------FGAFI
PNP_COREF       EKIN---------------------ALANPQLPKVGERFLGTVVKATA-------FGAFV
PNP_CORDI       EKIN---------------------AIANPQLPKVGERFLGTVVKTTA-------FGAFV
PNP_CORJK       EKIN---------------------AIANPQQPKVGDRFLGTVVKTTA-------FGAFV
PNP_LEIXX       AQVN---------------------VIANPTNPEVGEQFLGTVVKNAA-------FGAFV
PNP_TROWT       AMVN---------------------SIVNPVEPCVGSQFLGTVVKNMP-------FGSFI
PNP_BIFLO       AIID---------------------QIANPHVPEAGETYNGKVVKTTS-------FGAFV
PNP_RUBXD       SAIK---------------------GMTKEV--EAGDIYVGKVVKTTN-------FGAFV
PNP_LEPIC       KMVD---------------------GFFAEV--EVGKIYEGKVKRIAD-------FGAFV
PNP_NITSB       YIQEITNKP--------KPEP-----VKFQE----GDILKGKIKRTTN-------FGAFV
PNP_WOLSU       HILSISNQE--------APQR-----VRVADVYSAGEVFKGKVKKIVD-------FGAFI
PNP_SULDN       HIEGIVSTP--------KMPK-----IEYKV----GDIHKGIVKKIVE-------FGAFI
PNP_ARCB4       HIKTISNNA--------PSKKDASKNIDFEKLYSEDEVVIGKVERLAD-------FGAFI
PNP_CAMC5       YIISITSKENSRGFGKKPHGHDRRDKDRQKPTFNIGDEFDGVVKSVVD-------FGAFI
PNP_CAMFF       YIIQITQKE------QRSGGFRNKREYKNVTPFNIGDEFEGEIKKMAA-------FGAFI
PNP_CAMHC       DILNIVKKSND---FKKGSKFGHHHERKETSNFQVGEEFDGVVKKIMD-------FGAFI
PNP_CAMJD       YIINITSSQ---------KGTKKGSKDKDISDFELGQEFQGIVKKIAP-------FGAFV
PNP_HELHP       FILQLVSSA----------GTKKEYEKVDWESYAVGERFVGKIKKIVD-------FGIFV
PNP_HELPH       FILNYLHSL-----------------DQELEQYAIDEVLEAQVKRIVD-------FGAFL
PNP_HELAH       FILNYLHSL-----------------DQELEQYAIDEVLEAQVKRIVD-------FGAFL
PNP_HELPJ       FILNYLHSL-----------------DQELEQYAIDEVLEAQVKRIVD-------FGAFL
PNP_SULNB       HIEKIANAP-----------------VRKQMQYEVGKTYVGKVKKIVD-------FGIFV
                                                   .                        

PNP_FERNB       EIMP------GKIGLVHSSKLGN-------------VKP---T---------------SF
PNP_THEM4       ELMP------GKIGLAHSSKLGN-------------DSKEFRK---------------KY
PNP_THEP1       EVRP------GKIGLLHQSKVGE-------------DMRQFLK---------------KV
PNP_PSELT       EISP------GKVGLLHQSKLIT-------------DLK-------------------TV
PNP_PETMO       EVLP------GKVGMLHVSNLKD-------------KLE-------------------SF
PNP_AQUAE       ELWP------GKIGLLHVSKMAE-------------PVRSATE---------------KY
PNP_TREDE       EILP------GKEGLCHISKLSR------------SRVEKVSD---------------VL
PNP_TREPA       EIFP------GKEGLCHVSKLSR------------SRVSKVSD---------------VL
PNP_BORBU       ELTP------AKEGFLSTRLKPRDSKYGSGRFGNSNRYSRFGGGGENIRGNAGLVRPPKL
PNP_DESVV       EIL------PNLEALVHISQLDT------------NRVEQASDV---------------A
PNP_DESAG       EIL------PNCEALIHISQLDT------------SRVEKTEDV---------------V
PNP_LAWIP       EIM------PNVEAFVHISQLAV------------EHIAQVTDV---------------V
PNP_SYNFM       EIL------PNIEGLIHISQLEH------------RRVRKVTDV---------------V
PNP_ANADF       ELF------PGTDGLIHISELSD------------KRVKSVSDV---------------L
PNP_MYXXD       ELF------PGTDGLIHISELSD------------KRVKSVSDV---------------L
PNP_SORC5       EIL------PNTDGLLHISEMAH------------TRVERVEDV---------------V
PNP_GEOUR       EIF------PGTDGLVHISELDT------------ERVKNVTDI---------------L
PNP_PELPD       EIL------PGTDGLVHISELDT------------KRVKTVTEV---------------L
PNP_PELCD       EIF------PGTEGLVHISELAK------------ERVKKVTDI---------------L
PNP_SYNAS       EIL------PGTEGLLHISQLAK------------ERVNKVTDI---------------V
PNP_DESPS       EIL------PGTDGLVHISELAL------------ERVKDVTDV---------------V
PNP_BDEBA       EIL------PNTQGLLHISEISN------------ERVRAVSDV---------------L
PNP_BACV8       EFL------PGKDGLLHISEIDW------------KRLETIEEAG--------------L
PNP_PORGI       EFL------PGKEGLLHISEVDW------------KRFETIEDTN--------------L
PNP_CYTH3       EFL------PGKDGLLHISEIKW------------ERLDTMEGV---------------L
PNP_FLAPJ       EYTAV----PGNEVLLHVSELAW------------ERTENVTDV---------------V
PNP_GRAFK       EYMDA----PGNEVLLHISELAW------------ERTNDVNDV---------------L
PNP_SULMW       KIS------KYLEGLLHIYEISW------------L---TKVESF--------------I
PNP_CHLPD       EFL------PKTDGLVHISEISK------------ERVTKVSDH---------------L
PNP_CHLTE       EFL------PKTDGLVHISEIAR------------ERIAKVSDV---------------L
PNP_PELLD       EFI------PKTDGLVHISEISR------------ERVTKVSDH---------------L
PNP_CHLCH       EFL------PKTDGLVHISEISS------------TRVAKVSDH---------------L
PNP_SALRD       EIM------PEKTGLLHVSEIDY------------DYVENVEDY---------------L
PNP_KORVE       EIL------PGTDGLLHISEVAE------------HRIKDVKDE---------------L
PNP_SOLUE       EIF------PGTDGLLHISEIAE------------NRIKDVRDE---------------L
PNP_RHOBA       EIL------PGRDGLVHISEMSG------------GYISSLDQV---------------I
PNP_ECOLI       AIGG------GKEGLVHISQIAD------------KRVEKVTDY---------------L
PNP_PHOPR       SVIG------AKEGLVHISQIAQ------------ERVEKVSDH---------------L
PNP_HAEDU       TILG------GKEGLVHISQITD------------ARVERVSDY---------------L
PNP_COLP3       NVLP------GKDGLVHISQISE------------ERVNNVSEV---------------L
PNP_PSYIN       NILP------GKDGLVHISQICE------------ERVQKVSDH---------------L
PNP_PSEA6       EILP------GKEGLVHISQIAH------------ERVNKVADH---------------L
PNP_AERS4       NILP------GKDGLVHISQITD------------ARVQNVADF---------------L
PNP_SHELP       TILP------GKDGLVHISQIAE------------ERVANVSDY---------------L
PNP_IDILO       TVLP------GKDGLVHISQIAE------------ERVNDVNEY---------------L
PNP_PSEHT       NILP------GKDGLVHISQIST------------ERVNNVTDH---------------L
PNP_BUCAP       SIGI------GKEGLVHISQISN------------KRVEKVSDH---------------L
PNP_BUCBP       SIGI------GKEGLVHISQIAH------------KRVDKVSDH---------------L
PNP_BUCCC       SIGF------GKEGLIHISQISN------------KRIDKVINH---------------L
PNP_WIGBR       CLIN------NKEGLIHVSKIPY------------KKFSDINNN---------------F
PNP_BLOFL       TLFA------GKEGLVHISQITE------------KRVNRVSDY---------------L
PNP_BLOPB       TILS------GKEGLVHISQISE------------RRINKVTDY---------------L
PNP_BAUCH       AISS------NKEGLVHISQITN------------KRVEKVADY---------------L
PNP_NEIG1       SVMP------GKDGLVHISQIAH------------ERVRNVGDY---------------L
PNP_CHRVO       SILP------GKDGLVHISQIAN------------ERIKNVSDY---------------L
PNP_METFK       SLLP------GKDGLLHISQIAH------------QRVNAVADF---------------L
PNP_THIDA       NVLP------GRDGLLHISQIAH------------ERVNTIGDY---------------L
PNP_NITEC       SILP------GKDGLLHISQIAN------------ERVESVADH---------------L
PNP_NITMU       SVLP------GKDGLLHISQIAN------------ERVNNVGDH---------------L
PNP_VEREI       NLLP------GKDGLLHISQIAH------------ERVERVSDY---------------L
PNP_METPP       NILP------GKDGLLHISQIAH------------QRVEKVTDF---------------L
PNP_BORA1       QVLP------GRDGLLHISEIAN------------YRIANINDV---------------L
PNP_JANMA       QVMP------GKDGLLHISQIAN------------ERVNAVADY---------------L
PNP_RALSO       NILP------GKDGLLHISEIAN------------ERVNQVSDY---------------V
PNP_POLAQ       NILP------GKDGLLHISEISN------------ERVKEVKDY---------------L
PNP_PARXL       NILP------GKDGLLHISEIAN------------ERIKDINDY---------------L
PNP_DECAR       SVLP------GKDGLLHISQIAQ------------ERVNKVEDY---------------V
PNP_AROAE       NIMP------GRDGLLHVSQIAN------------ERVNNVADY---------------V
PNP_ALKEH       NILP------GRDGLVHISQISN------------ERVERVGDY---------------L
PNP_HALHL       NILP------GRDGLVHISQISN------------NRVENVADE---------------L
PNP_METCA       TILP------GKDGLVHISQISD------------EHVEKVSDK---------------L
PNP_NITOC       TILP------GKDGLLHISQISA------------ERVKNVSDK---------------L
PNP_XYLFT       TILP------GKDGLVHVSQISS------------ERVERVGDK---------------L
PNP_COXBR       QILP------NTQGLVHISQIAQ------------ERVENVRDY---------------L
PNP_DICNV       QFLP------GKEGLVHISQIAD------------YRVNDVRDE---------------L
PNP_PSEU5       NILP------GKDGLVHISQISD------------QRIEKVTDV---------------L
PNP_SACD2       NFLP------GKDGLVHISQIAH------------ERVQNVSDY---------------L
PNP_HAHCH       NILP------GKDGLVHISQIAQ------------ERVENVTDY---------------L
PNP_MARHV       NILP------GKDGLVHISQISE------------RRIENVTDE---------------L
PNP_CHRSD       TFMP------GTDGLVHISQIVP------------ERVNDVRDY---------------L
PNP_ALCBS       AIMP------GTEGLLHISQIAE------------ERVEKVTDY---------------V
PNP_ACIAD       NIMP------GTDGLLHISQISN------------ERVANVSDV---------------L
PNP_PSYWF       TVLP------GTDGLVHISQIAD------------ERVESVSDY---------------L
PNP_HYDCU       SYMP------GREGLVHVSQIAD------------ERVEDVNEY---------------L
PNP_LEGPA       NLLP------GKDGLLHISQICA------------ERTQKVEEV---------------L
PNP_VESOH       NIMP------NQDGLLHISEISH------------ERVEKVKDH---------------I
PNP_FRATW       NLLG------SQDGYLPFSEI--------------EQAGMKTNS---------------L
PNP_GRABC       NFLG------SRDGLVHISELQQ------------GRVNKTSDV---------------I
PNP_ACICJ       NFFG------ARDGLVHISELAQ------------GRVARTGDV---------------V
PNP_GLUOX       NFLG------PRDGLVHISELAE------------GRVAKTSDV---------------V
PNP_MAGSA       NFLG------SRDGLVHISELAR------------ERVAKTADV---------------V
PNP_RHORT       NFLG------TRDGLVHISELSQ------------DRVKKVGDV---------------V
PNP_CHESB       NFFG------PRDGLVHISQLAP------------ERVQKTTDV---------------V
PNP_BARBK       NFFG------SHDGLVHISQLAS------------KRVAKTTDV---------------V
PNP_NITHX       NFFG------AKDGLVHISQLAA------------NRVQKSSDI---------------V
PNP_AZOC5       NFFG------SKDGLVHISQLSK------------ERVAKSSDV---------------V
PNP_PARL1       NFFG------PRDGLVHISQMAP------------TRVEQVSDV---------------V
PNP_MARMM       NFFG------PKDGLVHVSQLKA------------ERVNHPSDV---------------V
PNP_CAUVC       NFFG------AKDGLVHVSQISN------------ERVAKPSDV---------------L
PNP_HYPNA       NFFG------PKDGLVHVSQMAN------------KRIGHPKEM---------------V
PNP_PARDP       NFFG------KRDGLVHVSQIAG------------KRLNHPNEV---------------L
PNP_SPHAL       NFMG------GKDGLVHVSEIRN------------ERVEKVADV---------------L
PNP_NOVAD       NFMG------GKDGLVHVSEMKN------------ERVEKPTDV---------------V
PNP_ERYLH       NFMG------GKDGLVHVSEMKN------------ERVEKPTDV---------------V
PNP_ZYMMO       NFMG------GRDGLVHVSEIKN------------ERVNKVSDV---------------L
PNP_PELUB       NFLG------KQDGLVHISELAT------------KRVEKVTDI---------------V
PNP_MAGMM       NILP------NKDGLVHISQLAN------------RRVQNVTDV---------------V
PNP_RICTY       NYLG------NKDGFVHISEISE------------TRIDKVSSV---------------L
PNP_ORITB       KYVT------GRDGFVHISEIND------------THIKDINAH---------------V
PNP_ANAMM       SFLG------GRRGLVHISEIKN------------EHIGSVSDV---------------L
PNP_ANAPZ       TFLG------ARKGLVHISEIRN------------EHINAVADV---------------L
PNP_EHRRW       SFLG------GKRGLIHISEIKN------------EHINAVGSV---------------I
PNP_WOLTR       ELFN------GRKGKMHISEVAN------------QHIESIESI---------------L
PNP_NEOSM       VLPN------KQEGLVHISEISK------------NRVNDIRAD---------------Y
PNP_CHLCV       EILP------GKEGLCHISEFSK------------QRIENVGDF---------------V
PNP_CHLPN       EVLP------GKEGLCHISECSR------------QRIENISDV---------------V
PNP_CHLMU       EVLP------GKEGLCHISELSK------------QKVDNVADF---------------V
PNP_PARUW       EILP------GKEGLCHISEFDV------------NRINSLDEF---------------V
PNP_BACCN       ELFS------GKDGLVHISELAL------------ERVGKVEDV---------------V
PNP_GEOTN       ELFN------GKDGLVHISELAE------------ERIGKVEDI---------------V
PNP_OCEIH       ELFK------GKDGLVHISELAE------------ERTNKVEDV---------------V
PNP_BACHD       ELFK------GKDGLVHISQLAE------------ERVNKVEDV---------------V
PNP_BACSK       ELFK------GKDGLLHISQIAE------------ERINKVEDV---------------F
PNP_LISIN       ELFK------GTDGLVHISELAH------------ERVGKVEDI---------------L
PNP_ENTFA       NLIK------GKDGLIHISQLAN------------ERVNNVEDV---------------V
PNP_STAS1       ELFP------GKDALVHISQIAN------------ERIDKVEDV---------------L
PNP_STRMU       HLFD------KTDALVHISEIAW------------TRTNKVEDV---------------L
PNP_STRTD       HLFN------KTDALVHISELAW------------KHTEHVEDV---------------V
PNP_LACLA       NLFG------KQDAMVHISEMAW------------ARTENVEDV---------------V
PNP_SPICI       HLKE------NLDGLIHISKLAK------------QHVEKAEDI---------------V
PNP_ONYPE       QVCP------GIEGLIHVNQ---------------KKFQKITDV---------------L
PNP_ACHLI       EIFP------GTEGLVHISKWEK------------ERTESLDGK---------------V
PNP_FUSNN       EILP------GKEGLLHISEISP------------ERVEKVEDV---------------L
PNP_TRIV2       EFLP------GKEGMIHISQLAD------------YRVGKVEDE---------------V
PNP_TRIEI       EVFA------GKEGMVHISQIAD------------YRVGKVEDE---------------L
PNP_ACAM1       EIAP------SKEGMIHISQLAD------------YRVGKVEDE---------------V
PNP_SYNE7       EFLP------GKEGMIHISQIAD------------YRVARVEDE---------------L
PNP_SYNY3       EVLP------GKEGMIHISQLTE------------GRVGKVEDE---------------V
PNP_THEEB       ELLP------GKEGMIHISQLAE------------YRVGKVEDE---------------V
PNP_PROMA       EILP------GKEGMIHISQLSE------------ARVEKVEDV---------------V
PNP_PROMP       EILP------GKEGMVHISQLSE------------ARVERVEDV---------------V
PNP_SYNR3       EILP------GKEGMIHISQLSD------------QRVEKVEDV---------------V
PNP_SYNJA       EFLP------GKEGMIHISQLAE------------YRVSRVEDE---------------I
PNP_GLOVI       EVMP------GKEGLVHISQLAE------------HRVRKVEDE---------------L
PNP_DEHM1       EILP------GKEGMVHISELAD------------HRVEKVEDV---------------V
PNP4_ALKMQ      EILP------GKEGLLHVSNIAH------------ERVNKVEDV---------------L
PNP_ALKOO       EILP------GKEGLVHISNLAH------------ERVNKVEDV---------------L
PNP3_ALKMQ      EILP------GKEGLVHISNLAH------------ERVTKVTDV---------------L
PNP_CLOD6       EILP------GKEGLLHISHIAH------------ERVAKVEDV---------------L
PNP_CALS8       EIYP------GKEGLVHISQLDN------------KKLKSVDEV---------------V
PNP_CALS4       EIAP------GKEGLVHISNLSK------------KRVRRVEDV---------------V
PNP_CLOPS       EVLP------NKEGLVHISKLDN------------KRVEKVEDI---------------V
PNP_CLOB8       EILP------SKEGLVHISKLAK------------ERVNKVEDV---------------V
PNP_CLOBL       EILP------GKEGLVHISKLDF------------ARVEKVEDV---------------V
PNP_CLOTE       EILP------GKEGLVHISKLDF------------TRVNKVEDV---------------V
PNP_CLONN       EILP------GKEGLVHISKLDV------------KRVNKVEDV---------------V
PNP_CLOAB       EVLP------GKEGLVHISKLDI------------NKVNKVEDV---------------V
PNP_LACP7       EFAP------GKEGMVHISKISK------------ERINHVEDV---------------L
PNP_HUNT2       EFLP------GKEGLVHISKLDK------------KRVERVEDI---------------V
PNP_CARHZ       EVVPGVLGLPGKEGLVHISQLAH------------SRVKRVEDV---------------V
PNP_MOOTA       EVIPRVLGMPGKEGLVHISQLAN------------ERVEKVEDV---------------V
PNP_DESRM       EVIPGVMGLPGKEGLVHISQLAF------------QRVEKTEDI---------------V
PNP_PELTS       EIIPGVLGMQGKEGLVHISQLAH------------HRVNRVEDV---------------V
PNP_DESHY       EVIPGVLGLSGKEGLVHISQLAH------------GRVEKVEDV---------------V
PNP_SYNWW       EIIPGVLGTSGKEGLVHISQLAE------------ERVNKVRDV---------------V
PNP_SYMTH       EILP------GKEGLVHISELSD------------KRVARVEDV---------------V
PNP_CHLAA       NILP------GKDGMVHVSELDE------------KRVENVEDV---------------V
PNP_ROSS1       NLAP------GKDGMVHVSELDV------------GRVENVEDV---------------I
PNP_DEIRA       NLFP------GQDGMLHISQLSE------------QRVENVEDV---------------L
PNP_THET8       SLFP------GTEGLLHISQIAP------------GRVARVEDH---------------L
PNP_RENSM       SLTP------GKDGLLHVTELRKIN--------DGKRVDNVDDV---------------V
PNP_KINRD       SLMP------GKDGLLHISQLRKLS--------GGKRVDNVEDV---------------V
PNP_STRAT       SLLP------GKDGLLHISQIRKLA--------GGKRVENVEDV---------------L
PNP_NOCSJ       SLMP------GKDGLLHISKLRSLA--------GGKRVDAVEDV---------------V
PNP_ACIC1       SLLP------GKDGLLHISELRKMA--------GGRRVENVEDV---------------L
PNP_CUTAK       SLLP------GKDGLLHISKMRDLN--------DGKRVEAVEDV---------------L
PNP_FRACC       SLTP------GRDGLLHVSKLKTLS--------GGKRVEKVEDV---------------L
PNP_THEFY       SLLP------GKDGLLHISQIRKMH--------GGQRIENVEDV---------------I
PNP_RHOJR       SLLP------GRDGLVHISKLGS-----------GKRIAKVEDV---------------V
PNP_SACEN       SLLP------GKDGLVHISKLGN-----------GKRIGKVEDV---------------V
PNP_SALTO       SLLP------GRDGLLHISKVGD-----------GKRVEKVEDF---------------L
PNP_COREF       SLLP------GRDGLVHISKLGN-----------GKRVEKVEDV---------------V
PNP_CORDI       SLLP------GRDGLVHISKLGG-----------GKRIEKVEDV---------------V
PNP_CORJK       SLLP------GRDGLIHISNLGG-----------DRRIERVEDE---------------V
PNP_LEIXX       SLLP------GKDGLLHISEVRKLA--------GGKRVESVDDV---------------L
PNP_TROWT       SLVP------GKDGLLHISEIRKMV--------DGRHLESVDEV---------------L
PNP_BIFLO       NLTP------GTDGLLHISQIRNLA--------NGERIDAVEDV---------------L
PNP_RUBXD       ELTP------GRDGLLHISRLAP----------GKQRVRRVEDV---------------L
PNP_LEPIC       EILP------GKEGLCHISKIDF------------KRVNSVKDI---------------V
PNP_NITSB       ELPG------GVDGLLHISKLSSG------------RVERVED---------------VV
PNP_WOLSU       ELPK------GGDGLLHVSKIVQH------------RDQRIDE---------------VI
PNP_SULDN       ELPD------GVDGLLHISKISDQ------------RVEKVSD---------------IL
PNP_ARCB4       LLPK------GGEGLLHISKISKD------------RVKNVAD---------------VL
PNP_CAMC5       ELKD------GVDGLLHISKIKT-----------------------------------PL
PNP_CAMFF       SLRD------GVDGLLHISKIVS-----------------------------------PL
PNP_CAMHC       SLKD------GIDGLLHVSKIKT-----------------------------------QL
PNP_CAMJD       ELKN------GVDGLLHSSKIKHL----------------------------------DL
PNP_HELHP       ELPR------GGDGLIHISKITKD------------KTQQLSE---------------IF
PNP_HELPH       SLPK------GGEGLLRKQNMDRC------------QV--------------------VL
PNP_HELAH       SLPK------GGEGLLRKQHMERC------------QV--------------------AL
PNP_HELPJ       SLPK------GGEGLLRKQNMDKC------------QV--------------------IL
PNP_SULNB       EMPD------GFDALLHISKVAKE------------RVNNLNE---------------RY
                                                                            

PNP_FERNB       KVGDKIKVEVINIDD-AGRLQFRRLEE---------------------------------
PNP_THEM4       KVGDVIKVVVVNIDD-SGRIQLGKAEE---------------------------------
PNP_THEP1       KVGDTIKVQVINIDD-LGRLQFKRVTEGENTQHGKTHSKRN-------------------
PNP_PSELT       KIGETMRVKVSNIDN-LGRLQLEEFSDSPDHKHGEKRSFKRHRKNDN-------------
PNP_PETMO       KIGDKVKVEVMKVED-QGKFQLKQLKEEN-------------------------------
PNP_AQUAE       KVGEEIIVKVLDLDE-LGRPRFTTIGIEDVGTEKKEVKPKVGDVYEGKVVRVEPYGAFIE
PNP_TREDE       KEGQEIPVKLLEIDK-LGRLNLSYVDALEERSK---------------------------
PNP_TREPA       QEGQRICVKLIDIDR-MGRLNLSYIDALEGKSGGLDTTK---------------------
PNP_BORBU       EEGQRIKVKIIDIDK-FGKIDLEIVRDKDY------------------------------
PNP_DESVV       RLGEDMVVKVIEIN--GDRIRA-----SRKAVLLEEQGIEWK------------------
PNP_DESAG       QLGQDVEVKVIEIN--DGRVRA-----SRKAVMLEAQGVEWD------------------
PNP_LAWIP       QLGEDMIIKVIEIT--GDRVRA-----SRKAVLLEEEGITWT------------------
PNP_SYNFM       QEGDEVLVKVIEIDK-DGRIRL-----SRKAALEKPEG----------------------
PNP_ANADF       SEGEEVLVKVISVDR-AGKIRL-----SRKEALAEAAGKKPE------------------
PNP_MYXXD       NEGDEVLVKVVSIDK-TGKIRL-----SRKEAMAERAAQQGA------------------
PNP_SORC5       KEGDSLDVKVLSVDR-EGKIRL-----SRRELLPLPEGEEGD------------------
PNP_GEOUR       KEGDKVLVKCIGIDK-QGKIKL-----SRKEALGATLPE---------------------
PNP_PELPD       NEGDRVLVKCIGVDK-NGKVKL-----SRKEALGLNPDGTPA------------------
PNP_PELCD       QEGDQVLVKCLDIDR-QGKIKL-----SRKEALGQSLPEEG-------------------
PNP_SYNAS       NEGDEVIVKVLEVDK-QGKIRL-----SRKEALGSDI-----------------------
PNP_DESPS       NEGDTIEVKVLDVDN-RGRIRL-----SRKALLG--------------------------
PNP_BDEBA       KEGEIIDVKVLEVDR-SGRVKL-----SRKALLQ--------------------------
PNP_BACV8       KEGDEIEVKLLDI---DPKTGK--FKLSHKVLLPRPE-----------------------
PNP_PORGI       KEGESINVKLLDI---DPKTGK--FKLSRKVLLEKPEGYVEP------------------
PNP_CYTH3       EVGETVKVKLVEV---DKKTGK--YRLSRKVLIPKPE-----------------------
PNP_FLAPJ       NMGDVFMVKYLGL---DPKTRK--EKVSRKALLPRP------------------------
PNP_GRAFK       KLGDVLDVKYFGL---DPKTRK--DKVSRKALMEKPEGYKER------------------
PNP_SULMW       RKGDIISVKYLGK---NNKFRK--IKLSHKMIFSRYY-----------------------
PNP_CHLPD       KVGDRVKVKLVDIRK-DPRTGKNRFALSIKAVESEPEKSDEN------------------
PNP_CHLTE       KVGDRIKVKLIDVRK-DPRTGKTKFALSIKALLDTDQQAETN------------------
PNP_PELLD       KVGDRIKVKLVDIRK-DPRTGKTRFALSMKAVDEEPVNGTEA------------------
PNP_CHLCH       KVGDKVTVKLVDVRK-DPRTGKTKFALSIKALEQPKQ---EG------------------
PNP_SALRD       EVGDKVKVHLLEV----HDDGK--MRLTRKPFVSEEN-----------------------
PNP_KORVE       HEGDQVLVKVLAVDG--NRIKL-----SRKAVLKEQRAKMATEGGGDGGPAPEVEHSEHG
PNP_SOLUE       KEGDQILVKCLALEG--NKIKL-----SRKAVLKEQREKMKQ------------------
PNP_RHOBA       AVGDAMKVLVIDVDE-HDRVKL-----SRRKALEELGE----------------------
PNP_ECOLI       QMGQEVPVKVLEVDR-QGRIRLSIKEATEQSQPAAAPEAPAAEQGE--------------
PNP_PHOPR       QMGQEVQVKVLEIDR-QGRIRLSMKEAVADQNPATVQDEQPQG-----------------
PNP_HAEDU       SVGQEVNVKVVEIDR-QNRIRLTMKDLDNNLSTNVTPEAVVQEESTEN------------
PNP_COLP3       TEGQEVKVKVLEVDR-QGRVRLSIKEAMEKPAAEATPAAE--------------------
PNP_PSYIN       KEGQEVKVKVLEVDR-QGRVRLSIKEAAEKTTAE--------------------------
PNP_PSEA6       SEGQIINVKVMEIDR-QNRVRLSIKELLEKPAAPAEGNE---------------------
PNP_AERS4       KLGDVVKVKVLEVDR-QGRVRLSIKEANAPTEAVAPAADVAAVEEPAAE-----------
PNP_SHELP       EVGQEVKVKVMEVDR-QGRVRLSMKEAQPKEEAASE------------------------
PNP_IDILO       KVGDVVPVKVLEIDR-QGRVRLSMKEAAEKKEEPAPEAPAEPAAEEENKSEE--------
PNP_PSEHT       SEGQEVKVKVLEVDR-QGRVRLSIKEAMES-AAPAADAPTDA------------------
PNP_BUCAP       TVDQIISVKVLEIDR-QGRLRLSIKEVENSIISNKSINNIYI------------------
PNP_BUCBP       RLHQEIFVKVLEVDR-QGRLRLSIKGAK--------------------------------
PNP_BUCCC       KINQIIFVKVLEVDR-QGRIRLSMKNI---------------------------------
PNP_WIGBR       KIGQIISVKVIEIDR-YGRIRLSFTGTDKNKNKKFFNKNN--------------------
PNP_BLOFL       KLGQEVLVKVLEIDR-QGRMRLSMRGINHI------------------------------
PNP_BLOPB       KLGQKVLVKVLEIDR-QGRIRLSMKGVHQVSA----------------------------
PNP_BAUCH       SIDQIVLVKVLEVDR-QGRIRLSMKDTNLTNK----------------------------
PNP_NEIG1       QVGQVVNVKALEVDD-RGRVRLSIKALLDAPVR----------EENAAE-----------
PNP_CHRVO       KEGQVVKVKAIEMDD-RGRIRLSIKALLEEEAK----------TAQATADAFGLKTQ---
PNP_METFK       KEGQVVKVKVLEVDD-KGRVRLSAKALIEAPSA----------EAPEEPAVAATGADQQ-
PNP_THIDA       KEGQVVRVKILEADE-KGRLRLSMKALLEAPAP----------TSGGEEHAS--------
PNP_NITEC       KEGQIIRVKVLEADD-KGRLRLSMKAASTEAAA----------TPENGEK----------
PNP_NITMU       KEGQVVRVKVLEADD-KGRLRLSMKAVATDVAD----------NAAT-------------
PNP_VEREI       SEGQIVRVKVMEADE-RGRVKLSMKVLAERPAPGSDRFGTGSERPAPGSDRPALAEREPR
PNP_METPP       TEGQIVKVKVLETDE-KGRIKLSLKALLERPEGYVEEERPRREYGDRGDRGDRGRDRGDR
PNP_BORA1       KVGQQVRVKVIEADE-KGRLRLSVKAIGGIEQ----------QQAAADVPAQAETPAE--
PNP_JANMA       QEGQQVRVKVLETDD-RGRLKLSMKAAVAEEN----------PEPAAAQE----------
PNP_RALSO       KEGQMVRVKLLSTDE-KGRMRLSIKAAKAEEG----DVPATAPQAPGAGDATSQQQ----
PNP_POLAQ       AEGQVVRVKLLAADE-RGRLRLSLKAAMADEGGTIAPLAGAAEVVAEEAPASGESA----
PNP_PARXL       KDGQQVKVKVIQTDE-KGRVRLSAKALLNDAA-----------NGAPQGEPTPQQ-----
PNP_DECAR       KEGQIVRVKVLETDD-RGRVKLSMKAAAADEG--------TVAQPVAAPEAAVQQQQ---
PNP_AROAE       KEGQAVRVKVLETDE-RGKIRLSMKALLDQPA--------E-------------------
PNP_ALKEH       KEGDTVRVKVLEVDR-QGRIRLSMKAVQDGE-----------------------------
PNP_HALHL       SEGDSVRVKVLEVDR-QGRIRLSMKAVEEE------------------------------
PNP_METCA       AEGDMVKVKVLEIDR-QGRVRLSMKAVE--------------------------------
PNP_NITOC       SEGDVIRVKVLEVDK-QGRVRLSVKAIGNE------------------------------
PNP_XYLFT       KEGDVVRVKVLEVDK-QGRIRLSIKAVEEEVASI--------------------------
PNP_COXBR       EEGQVIRVKVIEIDR-QGRVRLSMKQID--------------------------------
PNP_DICNV       TEGQEVKVKLLEIDR-QGRVRLSIKEAK--------------------------------
PNP_PSEU5       KEGQEVKVLVLDVDN-RGRIKLSIKDVAAAEASGV-------------------------
PNP_SACD2       KEGQDIEVKCMDIDQ-RGRIKLSIKELLPAPEAETAEAPAGEGEE---------------
PNP_HAHCH       KEGQEVVVKVLDIDA-RGRIKLSMKEVTEDEK-ASMAG----------------------
PNP_MARHV       SEGQEVLVKVLDVDN-RGRVKLSMKEVKEGEQPTDFAD----------------------
PNP_CHRSD       SEGQEVIVKVLDIDN-RNRVKLSIKEVTAEEKAAFEATPAE-------------------
PNP_ALCBS       NEGEIIKVKVLDVDQ-RGRIKLSMKEAKED------------------------------
PNP_ACIAD       KEGQDVKVQVADVDN-RGRIKLSMKDIEQA------------------------------
PNP_PSYWF       SEGQQINVLVQDVDN-RGRIKLTMKGVEQEQTQA--------------------------
PNP_HYDCU       KEGQEIKVRLTDVDK-QGRVKLSIKAV---------------------------------
PNP_LEGPA       QEGQEIEVFVAGIDK-QGRVKLEWKDKPQAEAKEVEGASVSATFLTMEEQSEEINSGNKI
PNP_VESOH       REGDKIDVKVIGLD--RGRIKLSRKVLLEK------------------------------
PNP_FRATW       VEGQGLEVLVQNIDR-GGRVKLSLVAR---------------------------------
PNP_GRABC       NVGDVVKVKVLGFDD-RGKVKLSMRLVDQTTGEDISDKVGPKGGRGGRGEGDLAE-----
PNP_ACICJ       KVGDTVKVKMIGLDD-RGKVKLSMRVVDQATGADISDQVGAKGGR----REDAAE-----
PNP_GLUOX       KQGDAVKVKVIGFDD-RGKVKLSMRVVDQATGADITESVGAKPGR--PPRRDAE------
PNP_MAGSA       KQGDVVKVKVLGFDD-RGKVKLSMKQVDQTTGEDISAQLEAERAASKRERHHED------
PNP_RHORT       NVGDQVKVKCVGFDD-RGKIKLSMKQVDQVTGADLSTQAPAEE-----------------
PNP_CHESB       KEGDKVFVKLMGFDE-RGKVRLSMKVVDQETGKEIVQE---KKEEKQEAEG---------
PNP_BARBK       KEGDKVWVQLMGFDE-RGKIRLSMKVVDQQTGKEIPQDDLIKTEKEQNPDEKNKSEKKRH
PNP_NITHX       KEGDKVKVKLLGFDD-RGKTRLSMKAVDQQTGEDLEAAGHKAEKADAPREAAGE------
PNP_AZOC5       KEGDKVKVKLVGFDE-RGKTRLSMKAVDQTTGEDLEAKAKSEKDAAKEGDEAGAAE----
PNP_PARL1       KEGDKVKVKLLGFDD-RGKVRLSMKHVNQETGEEIVYENEPAEQPREKREGGGGRGRRRE
PNP_MARMM       KEGQEVYVKLLGFDD-RGKVRLSMKIIDQETGEEIKKEQEDAE-----------------
PNP_CAUVC       KEGQMVKVKLLGFDD-RGKTKLSMKVVDQETGEDLSKKEAAAEEA---------------
PNP_HYPNA       KEGDKVWVKLMGFDE-RGKVRLSMKVVDQETGKELAEEAGDDASED--------------
PNP_PARDP       KEGQEVKVKLLGFDD-RGKVRLGMKMVDQETGEEIAPEKKEETAEG--------------
PNP_SPHAL       SEGQDVKVKVLEIDP-RGKVRLSMRVVDQETGAELEDTRPAREPRE-RGDRGDRGDRGPR
PNP_NOVAD       KEGQDVYVKVLEIDQ-RGKVRLSMRVVDQETGAELEDTRPPREPREPRGDRGDRGDRGDR
PNP_ERYLH       SEGQEVKVKVLEIDQ-RGKVRLSMRVVDQETGEELEDTRP---PREPRGDRGPRSGGGDR
PNP_ZYMMO       SEGQEVKVKVLEIDN-RGKVRLSMRVVDQETGAELDDNRPPRENAERRGGERPRRDRGPR
PNP_PELUB       KEGDEVKVKVIGFD--RGKVKLSMKQAAE-------------------------------
PNP_MAGMM       KEGDVVTVKVLDVDR-QGRVKLTMKEMEEGAAE---------------------------
PNP_RICTY       KQGDIVKVKLIGFDN-KGKAKLTIKNAC------KDHSLNNPKQKNNVKE----------
PNP_ORITB       KLGDKVKVKIIGIDH-KNRVKLTLRTD-------KEHCKNKNEQYNDITT----------
PNP_ANAMM       AVDDKVKVLVIGIDK-D-HVQLSMRRVDQDSGDLLEHESYSSSKKNGPQSGDASGGASGF
PNP_ANAPZ       AVGDKVKVLVIDMDK-D-HIQLSMRRIDQETGDQVDCELYAPQRRNGVAAGNTVGDSSVN
PNP_EHRRW       SVNDKVKVLVIGIDR-E-YVQLSMRRVDQETGEPIDGELYNIRKTNSDSDDSFLSSGSVN
PNP_WOLTR       KQGDTFKALVIDFEK-GGCPKLSRRRVDQETGDFFEGELYNEEKKDSSNDRDYYNSP---
PNP_NEOSM       TEGQAVTVRIKDIGS-DGKIKLTMRIDEDRVG--SGGSSSSPKKRFGAHP----------
PNP_CHLCV       KQGDILAVKLLSINE-KGQYKLSHKATLSE------------------------------
PNP_CHLPN       KEGDIIDVKLLSINE-KGQLKLSHKATLE-------------------------------
PNP_CHLMU       KEGDRLAVKLLSINE-KGQLKLSHKATLE-------------------------------
PNP_PARUW       KQGDMLMVKVLDINE-RGQIKLSRKATLQSQ-----------------------------
PNP_BACCN       KIGDEISVKVIEIDK-QGRVNLSRKVLLKEEQ----------------------------
PNP_GEOTN       SIGDEILVKVTEIDK-QGRVNLSRKAVLREQRG---------------------------
PNP_OCEIH       SIDDQIMVKVKEIDR-QGRVNLSRKAVIQDEKK---------------------------
PNP_BACHD       KIGDEILVKVMEIDN-QGRVNLSRKAVLKEQK----------------------------
PNP_BACSK       KLGDEVDVRVTEIDN-QGRVNLSRKVLLKEQRE---------------------------
PNP_LISIN       KLGDEVTVKVIEVDH-QGRVNLSRKALLEKKEQ---------------------------
PNP_ENTFA       KLGDEVLVKVTEIDK-QGRVNVSRKALLNEENK---------------------------
PNP_STAS1       KVGDIFKIKVTEIDK-QGRVNASHKALL--------------------------------
PNP_STRMU       AVGDKVTVKVVKVDD-KGRIDASMKALLPRPP-----------RSEKSN----KED----
PNP_STRTD       KVGDMVTVKIIKIDE-KGRVDASIKTLLPKPE-----------KNEDGE----NGEEHRH
PNP_LACLA       KLGDTVKVKIMKIDD-KGRVDASMRALVEKPEGYVEPERKPRERRENGDRRKGNGNSNRG
PNP_SPICI       QLNDIVKVKVIEIDG-KGKIKLQLIEILPKK-----------------------------
PNP_ONYPE       KIGETVSVKCTKIND-RGRIDFLLLPKNTQEKNS--------------------------
PNP_ACHLI       KVGDQILVKVVKIDE-RGRVDLS--RKDAL------------------------------
PNP_FUSNN       SVGDVFKVRVISMEG--GKISLSKKKV---------------------------------
PNP_TRIV2       AVGDEVIVKVREIDN-KGRINLTRLGIHPDQAAAAREAAAVNR-----------------
PNP_TRIEI       AIGDEVIVKVREIDS-KGRVNLTRLNIHPDEAAAARANAMNY------------------
PNP_ACAM1       TVGDEVVVKIRELDN-RGRINLTRLGIHPEEAAAARAGGSES------------------
PNP_SYNE7       TVGDEVVVKVREIDQ-KGRVNLTRKGIDPEEVSAARAAVEAS------------------
PNP_SYNY3       GVGDEVIVKVREIDS-KGRLNLTRLGIHPDEAAEARRNASRG------------------
PNP_THEEB       KIGDEIVVKIREVDS-KGRINLTRLGIHPDEAEAARSNSVV-------------------
PNP_PROMA       KVGDEVTVRVREIDN-RGRINLTLRGIPQNGDMQYYPQPTPTPVAPLM------------
PNP_PROMP       RQGDEVTVRVREIDS-RGRINLTLRGVAQNGGMSY-PEPTPTPVAPLN------------
PNP_SYNR3       NVGDEVRVRVREIDN-RGRINLTLRGVPQDG-----SDPQPTVILPIGES----------
PNP_SYNJA       AVADEVVVKVRSIDH-KGRVNLTRLGISPEEAARVRNHHP--------------------
PNP_GLOVI       NVGDEVVVKVKEIDQ-KGRINLTRRGIHPSEVEEARGQ----------------------
PNP_DEHM1       KVGDEITVKVTEIDS-QGRINLSRRVILNPNAVPISRNRDSQPRRSGPFRPQDRSNS---
PNP4_ALKMQ      EVGQEIEVKVMEIDQ-QGKINLSRKALLPKESKAENTKEEKA------------------
PNP_ALKOO       AVGDEIDVKVIEIDQ-QGKVSLSRKALLPKDNDKKQDDPQKA------------------
PNP3_ALKMQ      AEGDLIEVKLMEINP-QGKIGLSRKALLPKPETKSETQSE--------------------
PNP_CLOD6       NIGDEVEVKVTEIDE-KGRVNLSRKVLLPKPEHKNK------------------------
PNP_CALS8       KVGDLVLVKVIGIDR-LGRIALSRKEAL---NVTYSRKAK--------------------
PNP_CALS4       KVGDNILVKVTEIDK-LGRIVLSRKDAMPDEEESDNRKSDNRKK----------------
PNP_CLOPS       SVGDEILVKVTEIDS-QGRINLSRKDAIKEAEEENKQQ----------------------
PNP_CLOB8       SIGDEILVKVTEIDN-QGRINLSRKDALVEQENKEEK-----------------------
PNP_CLOBL       SVGDEILVKVTDIDN-QGRINLSRKDAIAKKEEEKDK-----------------------
PNP_CLOTE       SVGDEILVKVTDIDD-QGRINLSRRDAIKKEEDEKTKENNH-------------------
PNP_CLONN       SVGDEILVKVTEIDS-MGRVNLSRKDAIKDSENNQDKDTEK-------------------
PNP_CLOAB       SVGDEILVKVTDIDN-QGRVNLSRKDVLKQQESNNSKEK---------------------
PNP_LACP7       TLGDVVKVVCLGKDK-MGRISFSIKDYKEEN-----------------------------
PNP_HUNT2       RVGDQILVKVIEIDK-QGRVNLSRKDAMEDEWDK--------------------------
PNP_CARHZ       KEGDQILVKAIGYDN-QGRLKLSRKDAIPAEEVREKKNPPIHKPRREGK-----------
PNP_MOOTA       QEGDYILVKAIGFDP-QGRLKLSRKEALNESTVGEGGHRHFRRAGREGGHRGLNNRRQSR
PNP_DESRM       KEGEVIAVKAIGYDQ-QGRLKLSKKEAMRDMGLAPAESTSEQPEKRERRPFSRPKATKE-
PNP_PELTS       KEGDVILVKVTGYDS-QGRLKLSKKEATP-----PPESTAMK-EGRAHRPSRRRESAR--
PNP_DESHY       KLGDDILVKATGIDK-QGRLNLSRKEALPNPNPSSNPNPNGITANRNPRNS---------
PNP_SYNWW       DIGDQILVKVTEIDR-QGRVNLSRKAVLKSAVKK--------------------------
PNP_SYMTH       NIGDEVTVKVTEIDR-LGRINLSIKDAMPKQAASQPSGRPEARQPQPKPGQGKPGPAKAG
PNP_CHLAA       SLGDEINVMVIDIDRTTGKISLSRRAVLTGETPEERKAAGAAPRPRPREEQRGGRDEPRS
PNP_ROSS1       KMGDEINVMVIGIEPGTGKVSLSRRALLTGETAEDRRAAGAGRGLRDGGGRSGGSD----
PNP_DEIRA       TVGDKLKVKIANIDD-RGKIDLIRPELEGKVPLREPRAPRGGDRGPRRDSDRGGDRGPRR
PNP_THET8       KVGDVIKVKVHRIDE-RGKIDLIRPELEGKIPPRRRR-----------------------
PNP_RENSM       SVGQKIQVEITKIDD-RGKLSLSPVVAEDAAAADSAEAAEPAEAAAN-------------
PNP_KINRD       AVGQKVQVEIAEIDP-RGKLSLVPVVAEEASAE--AAAAEPADA----------------
PNP_STRAT       GVGQKVQVEIAEIDS-RGKLSLIPVIEGEEAAS--DEKKDDAEQ----------------
PNP_NOCSJ       SVGQKIQVQIAEIDD-RGKLSLVPVVEGDQADSDTAEAGSEEE-----------------
PNP_ACIC1       KVGDKIQVEIRDIDA-RGKLSLVPVDVPGAVLAEDAGAGESAASGGAPRSAGGPQPREHQ
PNP_CUTAK       SVGQKIQVEIAEVDD-RGKLSLVLASDEDDADE---------------------------
PNP_FRACC       TVGQKLQVEITEIDS-RGKISLSPSAEAADAAAAAS------------------------
PNP_THEFY       SIGEKIHVEVRDIDE-RGKLSLVPVEVIEAEAVAAPNGGESPNGAKKTDASGNGAKQPRR
PNP_RHOJR       SVGSKLRVEIADIDN-RGKISLIPVEEDGAAAPAEQSEEAAAEK----------------
PNP_SACEN       NVGDKLRVEIADIDS-RGKISLVVVDDEAENADKGGESEETSEQGA--------------
PNP_SALTO       NVGDKVEVEIADIDQ-RGKIYLDKVRPEGAEAPAEGAAERPAGRDRGDRGPRDRGDRGGR
PNP_COREF       TVGEKLQVEIADIDN-RGKISLVPVVEED-------------------------------
PNP_CORDI       NVGDKLEVEILDIDN-RGKISLAPVKNED-------------------------------
PNP_CORJK       SVGDKLEVEIADIDN-RGKISLVLVEEN--------------------------------
PNP_LEIXX       SIGQKILVEITKIDD-RGKLSLAPVLADEAETHGHDAASEGPTEG---------------
PNP_TROWT       SVGQKVLVEVSKIDD-RGKLCLVAVK----------------------------------
PNP_BIFLO       KEGDTVEVIVQGVDD-RGKISLAIPGFEDQENNARPSRGDRDDRRGGRGRGDRDDRRGGR
PNP_RUBXD       NEGDVVKVRVLEIDK-QNRISLEMVED---------------------------------
PNP_LEPIC       KEGDIIRVKVLNVDK-TGKIDLSRKDALEEEQV---------------------------
PNP_NITSB       NIGDEVEVEVLSQKG--HKIELGLRQVLKKA-----------------------------
PNP_WOLSU       KEGEEIEVQILSINK--NKVELGRATRPN-------------------------------
PNP_SULDN       KEGEEINVEILEFKG--NKISLGIA-----------------------------------
PNP_ARCB4       SIGQELEVKVLKVKK--DRIELSSAN----------------------------------
PNP_CAMC5       NVGDRLKVCVSEQKG--NKISLSLVE----------------------------------
PNP_CAMFF       KEGDTIKVKVSDIKG--GKISLDLN-----------------------------------
PNP_CAMHC       SEGDTLRVKVEEIKR--GKISLELCE----------------------------------
PNP_CAMJD       SENQSLKVKISEIKN--GKISVDLCE----------------------------------
PNP_HELHP       HNVSELECEILSQNK--NKVELGLVE----------------------------------
PNP_HELPH       KEGDSIRCRVISFNK--GKIALDLA-----------------------------------
PNP_HELAH       KEGDSIRCRVISFNK--GKIALDLA-----------------------------------
PNP_HELPJ       KEGDSIRCRVISFNK--GKIALDLA-----------------------------------
PNP_SULNB       HEGDDITVVVMEQKG--KKVELATPEYLA-------------------------------
                   . .                                                      

PNP_FERNB       ------------------------------------------------------------
PNP_THEM4       ------------------------------------------------------------
PNP_THEP1       ------------------------------------------------------------
PNP_PSELT       ------------------------------------------------------------
PNP_PETMO       ------------------------------------------------------------
PNP_AQUAE       YAPGKVGLLHVSKMKERVKDARQKYKVGDVVKVKVVEIDEQGRPKFTDDV----------
PNP_TREDE       ------------------------------------------------------------
PNP_TREPA       ------------------------------------------------------------
PNP_BORBU       ------------------------------------------------------------
PNP_DESVV       -------------------------------------PEDTARPSGPREGGRRDGGRDGR
PNP_DESAG       -------------------------------------PADTARPP------RKPRDRDDR
PNP_LAWIP       -------------------------------------PEESSRFS---------------
PNP_SYNFM       ------------------------------------------------------------
PNP_ANADF       -------------------------------------GAAETKGEPAK------------
PNP_MYXXD       -------------------------------------AAGEAAAQPAPAPTQPDAKA---
PNP_SORC5       -------------------------------------RARERMAQARDAGPPPRRDGPGG
PNP_GEOUR       ------------------------------------------------------------
PNP_PELPD       -------------------------------------TDAPAGE----------------
PNP_PELCD       ------------------------------------------------------------
PNP_SYNAS       ------------------------------------------------------------
PNP_DESPS       ------------------------------------------------------------
PNP_BDEBA       ------------------------------------------------------------
PNP_BACV8       -----------------------------------------KQEKK--------------
PNP_PORGI       -------------------------------------QPRERRERR----EGGREGGRNF
PNP_CYTH3       -----------------------------------------QQATS----NS--------
PNP_FLAPJ       --------------------------------------PRE-------------------
PNP_GRAFK       -------------------------------------APRDRDDKRGSRDNNRGRDNRGR
PNP_SULMW       ---------------------------------------LNKNLK---------------
PNP_CHLPD       -------------------------------------KAGTEGN----------------
PNP_CHLTE       -------------------------------------GEAKPARD---------------
PNP_PELLD       -------------------------------------GAAPENN----------------
PNP_CHLCH       -------------------------------------GEATQN-----------------
PNP_SALRD       ---------------------------------------GEQNE----------------
PNP_KORVE       APGGVTFEGGYEGGDEPEVEEGEPNFNRDDAPGSHGATQPHSGGDRPDRGPRPHGGGGGA
PNP_SOLUE       -------------GKE--------------------------------------------
PNP_RHOBA       --------------EDPLAVEGE------------GGGDSEGGGDGEDRPRRRRGGSGGG
PNP_ECOLI       ------------------------------------------------------------
PNP_PHOPR       ------------------------------------------------------------
PNP_HAEDU       ------------------------------------------------------------
PNP_COLP3       ------------------------------------------------------------
PNP_PSYIN       ------------------------------------------------------------
PNP_PSEA6       ------------------------------------------------------------
PNP_AERS4       ------------------------------------------------------------
PNP_SHELP       ------------------------------------------------------------
PNP_IDILO       ------------------------------------------------------------
PNP_PSEHT       ------------------------------------------------------------
PNP_BUCAP       ------------------------------------------------------------
PNP_BUCBP       ------------------------------------------------------------
PNP_BUCCC       ------------------------------------------------------------
PNP_WIGBR       ------------------------------------------------------------
PNP_BLOFL       ------------------------------------------------------------
PNP_BLOPB       ------------------------------------------------------------
PNP_BAUCH       ------------------------------------------------------------
PNP_NEIG1       ------------------------------------------------------------
PNP_CHRVO       ------------------------------------------------------------
PNP_METFK       ------------------------------------------------------------
PNP_THIDA       ------------------------------------------------------------
PNP_NITEC       ------------------------------------------------------------
PNP_NITMU       ------------------------------------------------------------
PNP_VEREI       REMRDHGHPPSEQQQQQSPPADTGSGQRVG------------------------------
PNP_METPP       PPRRERGDAP-----QAAPESDVPSPQAE-------------------------------
PNP_BORA1       ------------------------------------------------------------
PNP_JANMA       ------------------------------------------------------------
PNP_RALSO       ------------------------------------------------------------
PNP_POLAQ       ------------------------------------------------------------
PNP_PARXL       ------------------------------------------------------------
PNP_DECAR       ------------------------------------------------------------
PNP_AROAE       ------------------------------------------------------------
PNP_ALKEH       ------------------------------------------------------------
PNP_HALHL       ------------------------------------------------------------
PNP_METCA       ------------------------------------------------------------
PNP_NITOC       ------------------------------------------------------------
PNP_XYLFT       ------------------------------------------------------------
PNP_COXBR       ------------------------------------------------------------
PNP_DICNV       ------------------------------------------------------------
PNP_PSEU5       ------------------------------------------------------------
PNP_SACD2       ------------------------------------------------------------
PNP_HAHCH       ------------------------------------------------------------
PNP_MARHV       ------------------------------------------------------------
PNP_CHRSD       ------------------------------------------------------------
PNP_ALCBS       ------------------------------------------------------------
PNP_ACIAD       ------------------------------------------------------------
PNP_PSYWF       ------------------------------------------------------------
PNP_HYDCU       ------------------------------------------------------------
PNP_LEGPA       SEEEE-------------------------------------------------------
PNP_VESOH       ------------------------------------------------------------
PNP_FRATW       ------------------------------------------------------------
PNP_GRABC       ------------------------------------------------------------
PNP_ACICJ       ------------------------------------------------------------
PNP_GLUOX       ------------------------------------------------------------
PNP_MAGSA       ------------------------------------------------------------
PNP_RHORT       ------------------------------------------------------------
PNP_CHESB       ------------------------------------------------------------
PNP_BARBK       NRKKED------------------------------------------------------
PNP_NITHX       ------------------------------------------------------------
PNP_AZOC5       ------------------------------------------------------------
PNP_PARL1       RD----------------------------------------------------------
PNP_MARMM       ------------------------------------------------------------
PNP_CAUVC       ------------------------------------------------------------
PNP_HYPNA       ------------------------------------------------------------
PNP_PARDP       ------------------------------------------------------------
PNP_SPHAL       RD-GGDRN--RGGRERGPRRDGGGDRGPRRERSEDGPEDQGHVPDFLKD-----------
PNP_NOVAD       RGPRGDRGPRREGGDRGPRREGG-DR-PRRDR-DDGP-APDHMPAFLKSDD---------
PNP_ERYLH       RGGRGGPRRGGGGGGGGGRDRGG------RDGGNDGG-GEAHVPDFLKD-----------
PNP_ZYMMO       RE----------SGDRPARRDME----------------PEFAPAFLRKDS---------
PNP_PELUB       ------------------------------------------------------------
PNP_MAGMM       ------------------------------------------------------------
PNP_RICTY       -----------------------DSEP------------------------EQRRDASKK
PNP_ORITB       -----------------------TTGG------------------------VKKK-----
PNP_ANAMM       R-----------DYASGPARERRRSGG--------------SGGRP----VRRRSAGSSG
PNP_ANAPZ       GGGAGSVYVPRGDYGGASAGRNGRGGGKRDGAAKSSSSAGNGGGRSSSSTRRRHSAGSSG
PNP_EHRRW       N--------------RHGSEKKRRGSG-----------------------RSRRSSGGSS
PNP_WOLTR       --------------------FNRKSG------------------------HRKRPVHSRS
PNP_NEOSM       ----------------------RKNG-------------------------KDNRSNNSE
PNP_CHLCV       ------------------------------------------------------------
PNP_CHLPN       ------------------------------------------------------------
PNP_CHLMU       ------------------------------------------------------------
PNP_PARUW       ------------------------------------------------------------
PNP_BACCN       ----EKEVAKEEATQE--------------------------------------------
PNP_GEOTN       ----AGELPKETREKRGRRPERHRMKP---------------------------------
PNP_OCEIH       ----AKEQAK--------------------------------------------------
PNP_BACHD       ----KAEEQNQK------------------------------------------------
PNP_BACSK       ----KLEKEEAKDTANE-------------------------------------------
PNP_LISIN       ----PEGDKKPQAEKKFYPKTKKPESK---------------------------------
PNP_ENTFA       -------------EK---------------------------------------------
PNP_STAS1       ------------------------------------------------------------
PNP_STRMU       ----HQSVRHHGSPKDD--KGKEKYDK---------------------------------
PNP_STRTD       CCCSHHKPDHHSESMEAPKKSDESETKE--------------------------------
PNP_LACLA       NGFDRRNNDRNNQGNKVGNHSFELRERKSHIDEEFPELSTKKPE----------------
PNP_SPICI       ------------------------------------------------------------
PNP_ONYPE       ------------------------------------------------------------
PNP_ACHLI       ------------------------------------------------------------
PNP_FUSNN       ------------------------------------------------------------
PNP_TRIV2       ------------------------------------------------------------
PNP_TRIEI       ------------------------------------------------------------
PNP_ACAM1       ------------------------------------------------------------
PNP_SYNE7       ------------------------------------------------------------
PNP_SYNY3       ------------------------------------------------------------
PNP_THEEB       ------------------------------------------------------------
PNP_PROMA       ------------------------------------------------------------
PNP_PROMP       ------------------------------------------------------------
PNP_SYNR3       ------------------------------------------------------------
PNP_SYNJA       ------------------------------------------------------------
PNP_GLOVI       ------------------------------------------------------------
PNP_DEHM1       ------------------------------------------------------------
PNP4_ALKMQ      ------------------------------------------------------------
PNP_ALKOO       ------------------------------------------------------------
PNP3_ALKMQ      ------------------------------------------------------------
PNP_CLOD6       ------------------------------------------------------------
PNP_CALS8       ------------------------------------------------------------
PNP_CALS4       ------------------------------------------------------------
PNP_CLOPS       ------------------------------------------------------------
PNP_CLOB8       ------------------------------------------------------------
PNP_CLOBL       ------------------------------------------------------------
PNP_CLOTE       ------------------------------------------------------------
PNP_CLONN       ------------------------------------------------------------
PNP_CLOAB       ------------------------------------------------------------
PNP_LACP7       ------------------------------------------------------------
PNP_HUNT2       ------------------------------------------------------------
PNP_CARHZ       ------------------------------------------------------------
PNP_MOOTA       ------------------------------------------------------------
PNP_DESRM       ------------------------------------------------------------
PNP_PELTS       ------------------------------------------------------------
PNP_DESHY       ------------------------------------------------------------
PNP_SYNWW       ------------------------------------------------------------
PNP_SYMTH       AGRPGPGKPGPGRHGR--------------------------------------------
PNP_CHLAA       LRDELRGPRREGDRPRPRRRDD--------------------------------------
PNP_ROSS1       -RGGDRGPRGD-DRQRPRRR----------------------------------------
PNP_DEIRA       EFSDRGPRPEGARSERPEGQRTERPATAPATQESSQSSDAPAAPVFPRRED---------
PNP_THET8       ------------------------------------------------------------
PNP_RENSM       ------------------------------------------------------------
PNP_KINRD       ------------------------------------------------------------
PNP_STRAT       ------------------------------------------------------------
PNP_NOCSJ       ------------------------------------------------------------
PNP_ACIC1       GPGRPRGRGGDHGGEGRQRTRRRH------------------------------------
PNP_CUTAK       ------------------------------------------------------------
PNP_FRACC       ------------------------------------------------------------
PNP_THEFY       RRRTRSSSRSSENT----------------------------------------------
PNP_RHOJR       ------------------------------------------------------------
PNP_SACEN       ------------------------------------------------------------
PNP_SALTO       GPDRGDSGDGGDGGEGGESRPRRRTRRS--------------------------------
PNP_COREF       ------------------------------------------------------------
PNP_CORDI       ------------------------------------------------------------
PNP_CORJK       ------------------------------------------------------------
PNP_LEIXX       ------------------------------------------------------------
PNP_TROWT       ------------------------------------------------------------
PNP_BIFLO       GRRSERDDRDFDDRDDRPRRRRSDDFEDDYDDRPRRRRSDDRDFDRDDRDDDRPRRRRSA
PNP_RUBXD       ------------------------------------------------------------
PNP_LEPIC       ------------------------------------------------------------
PNP_NITSB       ------------------------------------------------------------
PNP_WOLSU       ------------------------------------------------------------
PNP_SULDN       ------------------------------------------------------------
PNP_ARCB4       ------------------------------------------------------------
PNP_CAMC5       ------------------------------------------------------------
PNP_CAMFF       ------------------------------------------------------------
PNP_CAMHC       ------------------------------------------------------------
PNP_CAMJD       ------------------------------------------------------------
PNP_HELHP       ------------------------------------------------------------
PNP_HELPH       ------------------------------------------------------------
PNP_HELAH       ------------------------------------------------------------
PNP_HELPJ       ------------------------------------------------------------
PNP_SULNB       ------------------------------------------------------------
                                                                            

PNP_FERNB       ------------------------------------------------------------
PNP_THEM4       ------------------------------------------------------------
PNP_THEP1       ------------------------------------------------------------
PNP_PSELT       ------------------------------------------------------------
PNP_PETMO       ------------------------------------------------------------
PNP_AQUAE       ------------------------------------------------------------
PNP_TREDE       ------------------------------------------------------------
PNP_TREPA       ------------------------------------------------------------
PNP_BORBU       ------------------------------------------------------------
PNP_DESVV       RDGGRDGRRDGGRDGGRRDGGRRDGGRDRN------------------------------
PNP_DESAG       --GDRGGRGDRGDRGGR--NGRGGDRRDRR------------------------------
PNP_LAWIP       -KGNRNG--DRSRHNNR--------ERTRRT-----------------------------
PNP_SYNFM       --GGQ-------------------------------------------------------
PNP_ANADF       ------------------------------------------------------------
PNP_MYXXD       ------------------------------------------------------------
PNP_SORC5       RGGDRGGDRGSRPGLDRDRGGPPRERRERRS-----------------------------
PNP_GEOUR       ------------------------------------------------------------
PNP_PELPD       ------------------------------------------------------------
PNP_PELCD       ------------------------------------------------------------
PNP_SYNAS       ------------------------------------------------------------
PNP_DESPS       ------------------------------------------------------------
PNP_BDEBA       ------------------------------------------------------------
PNP_BACV8       ------------------------------------------------------------
PNP_PORGI       ERRGGDRDHREPRG----------------------------------------------
PNP_CYTH3       ------------------------------------------------------------
PNP_FLAPJ       ----------EKKE----------------------------------------------
PNP_GRAFK       DNRRDDRKPRENKD----------------------------------------------
PNP_SULMW       ------------------------------------------------------------
PNP_CHLPD       ------------------------------------------------------------
PNP_CHLTE       ------------------------------------------------------------
PNP_PELLD       ------------------------------------------------------------
PNP_CHLCH       ------------------------------------------------------------
PNP_SALRD       ------------------------------------------------------------
PNP_KORVE       GRGGRGRRPGGGGGGGRGGHGGRGGGGGGRGRG---------------------------
PNP_SOLUE       ------------------------------------------------------------
PNP_RHOBA       GGGGRGRGPRRSGGGRDRD-----------------------------------------
PNP_ECOLI       ------------------------------------------------------------
PNP_PHOPR       ------------------------------------------------------------
PNP_HAEDU       ------------------------------------------------------------
PNP_COLP3       ------------------------------------------------------------
PNP_PSYIN       ------------------------------------------------------------
PNP_PSEA6       ------------------------------------------------------------
PNP_AERS4       ------------------------------------------------------------
PNP_SHELP       ------------------------------------------------------------
PNP_IDILO       ------------------------------------------------------------
PNP_PSEHT       ------------------------------------------------------------
PNP_BUCAP       ------------------------------------------------------------
PNP_BUCBP       ------------------------------------------------------------
PNP_BUCCC       ------------------------------------------------------------
PNP_WIGBR       ------------------------------------------------------------
PNP_BLOFL       ------------------------------------------------------------
PNP_BLOPB       ------------------------------------------------------------
PNP_BAUCH       ------------------------------------------------------------
PNP_NEIG1       ------------------------------------------------------------
PNP_CHRVO       ------------------------------------------------------------
PNP_METFK       ------------------------------------------------------------
PNP_THIDA       ------------------------------------------------------------
PNP_NITEC       ------------------------------------------------------------
PNP_NITMU       ------------------------------------------------------------
PNP_VEREI       ------------------------------------------------------------
PNP_METPP       ------------------------------------------------------------
PNP_BORA1       ------------------------------------------------------------
PNP_JANMA       ------------------------------------------------------------
PNP_RALSO       ------------------------------------------------------------
PNP_POLAQ       ------------------------------------------------------------
PNP_PARXL       ------------------------------------------------------------
PNP_DECAR       ------------------------------------------------------------
PNP_AROAE       ------------------------------------------------------------
PNP_ALKEH       ------------------------------------------------------------
PNP_HALHL       ------------------------------------------------------------
PNP_METCA       ------------------------------------------------------------
PNP_NITOC       ------------------------------------------------------------
PNP_XYLFT       ------------------------------------------------------------
PNP_COXBR       ------------------------------------------------------------
PNP_DICNV       ------------------------------------------------------------
PNP_PSEU5       ------------------------------------------------------------
PNP_SACD2       ------------------------------------------------------------
PNP_HAHCH       ------------------------------------------------------------
PNP_MARHV       ------------------------------------------------------------
PNP_CHRSD       ------------------------------------------------------------
PNP_ALCBS       ------------------------------------------------------------
PNP_ACIAD       ------------------------------------------------------------
PNP_PSYWF       ------------------------------------------------------------
PNP_HYDCU       ------------------------------------------------------------
PNP_LEGPA       ------------------------------------------------------------
PNP_VESOH       ------------------------------------------------------------
PNP_FRATW       ------------------------------------------------------------
PNP_GRABC       ------------------------------------------------------------
PNP_ACICJ       ------------------------------------------------------------
PNP_GLUOX       ------------------------------------------------------------
PNP_MAGSA       ------------------------------------------------------------
PNP_RHORT       ------------------------------------------------------------
PNP_CHESB       ------------------------------------------------------------
PNP_BARBK       ------------------------------------------------------------
PNP_NITHX       ------------------------------------------------------------
PNP_AZOC5       ------------------------------------------------------------
PNP_PARL1       ------------------------------------------------------------
PNP_MARMM       ------------------------------------------------------------
PNP_CAUVC       ------------------------------------------------------------
PNP_HYPNA       ------------------------------------------------------------
PNP_PARDP       ------------------------------------------------------------
PNP_SPHAL       ------------------------------------------------------------
PNP_NOVAD       ------------------------------------------------------------
PNP_ERYLH       ------------------------------------------------------------
PNP_ZYMMO       ------------------------------------------------------------
PNP_PELUB       ------------------------------------------------------------
PNP_MAGMM       ------------------------------------------------------------
PNP_RICTY       RTWNEDNNTEMSEV-------------------------ITERKYFT-------------
PNP_ORITB       ----IKIAPKEAAV-------------------------ISNRKYFD-------------
PNP_ANAMM       SGSGGYYSVPQHVGTPDPVNGNDR-RRGSGPQHASGGGGNKKPRFF--------------
PNP_ANAPZ       YSSDSSSGNTKSSSSESSGGTGGRGRNGANGDVQNGPAAPKKPRFF--------------
PNP_EHRRW       YHRDDLHNNGFGNG------------NRSFNDNRNGNEVPRKPRFF--------------
PNP_WOLTR       SFSNRNNRPKFGND-------------------------DSSSSFY--------------
PNP_NEOSM       RGFNERSGSAEGSS-------------------------ISRKRFF--------------
PNP_CHLCV       ------------------------------------------------------------
PNP_CHLPN       ------------------------------------------------------------
PNP_CHLMU       ------------------------------------------------------------
PNP_PARUW       ------------------------------------------------------------
PNP_BACCN       ------------------------------------------------------------
PNP_GEOTN       ------------------------------------------------------------
PNP_OCEIH       ------------------------------------------------------------
PNP_BACHD       ------------------------------------------------------------
PNP_BACSK       ------------------------------------------------------------
PNP_LISIN       ------------------------------------------------------------
PNP_ENTFA       ------------------------------------------------------------
PNP_STAS1       ------------------------------------------------------------
PNP_STRMU       ------------------------------------------------------------
PNP_STRTD       ------------------------------------------------------------
PNP_LACLA       ------------------------------------------------------------
PNP_SPICI       ------------------------------------------------------------
PNP_ONYPE       ------------------------------------------------------------
PNP_ACHLI       ------------------------------------------------------------
PNP_FUSNN       ------------------------------------------------------------
PNP_TRIV2       ------------------------------------------------------------
PNP_TRIEI       ------------------------------------------------------------
PNP_ACAM1       ------------------------------------------------------------
PNP_SYNE7       ------------------------------------------------------------
PNP_SYNY3       ------------------------------------------------------------
PNP_THEEB       ------------------------------------------------------------
PNP_PROMA       ------------------------------------------------------------
PNP_PROMP       ------------------------------------------------------------
PNP_SYNR3       ------------------------------------------------------------
PNP_SYNJA       ------------------------------------------------------------
PNP_GLOVI       ------------------------------------------------------------
PNP_DEHM1       ------------------------------------------------------------
PNP4_ALKMQ      ------------------------------------------------------------
PNP_ALKOO       ------------------------------------------------------------
PNP3_ALKMQ      ------------------------------------------------------------
PNP_CLOD6       ------------------------------------------------------------
PNP_CALS8       ------------------------------------------------------------
PNP_CALS4       ------------------------------------------------------------
PNP_CLOPS       ------------------------------------------------------------
PNP_CLOB8       ------------------------------------------------------------
PNP_CLOBL       ------------------------------------------------------------
PNP_CLOTE       ------------------------------------------------------------
PNP_CLONN       ------------------------------------------------------------
PNP_CLOAB       ------------------------------------------------------------
PNP_LACP7       ------------------------------------------------------------
PNP_HUNT2       ------------------------------------------------------------
PNP_CARHZ       ------------------------------------------------------------
PNP_MOOTA       ------------------------------------------------------------
PNP_DESRM       ------------------------------------------------------------
PNP_PELTS       ------------------------------------------------------------
PNP_DESHY       ------------------------------------------------------------
PNP_SYNWW       ------------------------------------------------------------
PNP_SYMTH       ------------------------------------------------------------
PNP_CHLAA       ------------------------------------------------------------
PNP_ROSS1       ------------------------------------------------------------
PNP_DEIRA       ------------------------------------------------------------
PNP_THET8       ------------------------------------------------------------
PNP_RENSM       ------------------------------------------------------------
PNP_KINRD       ------------------------------------------------------------
PNP_STRAT       ------------------------------------------------------------
PNP_NOCSJ       ------------------------------------------------------------
PNP_ACIC1       ------------------------------------------------------------
PNP_CUTAK       ------------------------------------------------------------
PNP_FRACC       ------------------------------------------------------------
PNP_THEFY       ------------------------------------------------------------
PNP_RHOJR       ------------------------------------------------------------
PNP_SACEN       ------------------------------------------------------------
PNP_SALTO       ------------------------------------------------------------
PNP_COREF       ------------------------------------------------------------
PNP_CORDI       ------------------------------------------------------------
PNP_CORJK       ------------------------------------------------------------
PNP_LEIXX       ------------------------------------------------------------
PNP_TROWT       ------------------------------------------------------------
PNP_BIFLO       DRDFDDRDDRDARDSRDDDRPRRRRSSDRDDRGDRDDRRGGSRGRGRGSDRNPRYATDDN
PNP_RUBXD       ------------------------------------------------------------
PNP_LEPIC       ------------------------------------------------------------
PNP_NITSB       ------------------------------------------------------------
PNP_WOLSU       ------------------------------------------------------------
PNP_SULDN       ------------------------------------------------------------
PNP_ARCB4       ------------------------------------------------------------
PNP_CAMC5       ------------------------------------------------------------
PNP_CAMFF       ------------------------------------------------------------
PNP_CAMHC       ------------------------------------------------------------
PNP_CAMJD       ------------------------------------------------------------
PNP_HELHP       ------------------------------------------------------------
PNP_HELPH       ------------------------------------------------------------
PNP_HELAH       ------------------------------------------------------------
PNP_HELPJ       ------------------------------------------------------------
PNP_SULNB       ------------------------------------------------------------
                                                                            

PNP_FERNB       ----------------------------
PNP_THEM4       ----------------------------
PNP_THEP1       ----------------------------
PNP_PSELT       ----------------------------
PNP_PETMO       ----------------------------
PNP_AQUAE       ----------------------------
PNP_TREDE       ----------------------------
PNP_TREPA       ----------------------------
PNP_BORBU       ----------------------------
PNP_DESVV       ----------------------------
PNP_DESAG       ----------------------------
PNP_LAWIP       ----------------------------
PNP_SYNFM       ----------------------------
PNP_ANADF       ----------------------------
PNP_MYXXD       ----------------------------
PNP_SORC5       ----------------------------
PNP_GEOUR       ----------------------------
PNP_PELPD       ----------------------------
PNP_PELCD       ----------------------------
PNP_SYNAS       ----------------------------
PNP_DESPS       ----------------------------
PNP_BDEBA       ----------------------------
PNP_BACV8       ----------------------------
PNP_PORGI       ----------------------------
PNP_CYTH3       ----------------------------
PNP_FLAPJ       ----------------------------
PNP_GRAFK       ----------------------------
PNP_SULMW       ----------------------------
PNP_CHLPD       ----------------------------
PNP_CHLTE       ----------------------------
PNP_PELLD       ----------------------------
PNP_CHLCH       ----------------------------
PNP_SALRD       ----------------------------
PNP_KORVE       ----------------------------
PNP_SOLUE       ----------------------------
PNP_RHOBA       ----------------------------
PNP_ECOLI       ----------------------------
PNP_PHOPR       ----------------------------
PNP_HAEDU       ----------------------------
PNP_COLP3       ----------------------------
PNP_PSYIN       ----------------------------
PNP_PSEA6       ----------------------------
PNP_AERS4       ----------------------------
PNP_SHELP       ----------------------------
PNP_IDILO       ----------------------------
PNP_PSEHT       ----------------------------
PNP_BUCAP       ----------------------------
PNP_BUCBP       ----------------------------
PNP_BUCCC       ----------------------------
PNP_WIGBR       ----------------------------
PNP_BLOFL       ----------------------------
PNP_BLOPB       ----------------------------
PNP_BAUCH       ----------------------------
PNP_NEIG1       ----------------------------
PNP_CHRVO       ----------------------------
PNP_METFK       ----------------------------
PNP_THIDA       ----------------------------
PNP_NITEC       ----------------------------
PNP_NITMU       ----------------------------
PNP_VEREI       ----------------------------
PNP_METPP       ----------------------------
PNP_BORA1       ----------------------------
PNP_JANMA       ----------------------------
PNP_RALSO       ----------------------------
PNP_POLAQ       ----------------------------
PNP_PARXL       ----------------------------
PNP_DECAR       ----------------------------
PNP_AROAE       ----------------------------
PNP_ALKEH       ----------------------------
PNP_HALHL       ----------------------------
PNP_METCA       ----------------------------
PNP_NITOC       ----------------------------
PNP_XYLFT       ----------------------------
PNP_COXBR       ----------------------------
PNP_DICNV       ----------------------------
PNP_PSEU5       ----------------------------
PNP_SACD2       ----------------------------
PNP_HAHCH       ----------------------------
PNP_MARHV       ----------------------------
PNP_CHRSD       ----------------------------
PNP_ALCBS       ----------------------------
PNP_ACIAD       ----------------------------
PNP_PSYWF       ----------------------------
PNP_HYDCU       ----------------------------
PNP_LEGPA       ----------------------------
PNP_VESOH       ----------------------------
PNP_FRATW       ----------------------------
PNP_GRABC       ----------------------------
PNP_ACICJ       ----------------------------
PNP_GLUOX       ----------------------------
PNP_MAGSA       ----------------------------
PNP_RHORT       ----------------------------
PNP_CHESB       ----------------------------
PNP_BARBK       ----------------------------
PNP_NITHX       ----------------------------
PNP_AZOC5       ----------------------------
PNP_PARL1       ----------------------------
PNP_MARMM       ----------------------------
PNP_CAUVC       ----------------------------
PNP_HYPNA       ----------------------------
PNP_PARDP       ----------------------------
PNP_SPHAL       ----------------------------
PNP_NOVAD       ----------------------------
PNP_ERYLH       ----------------------------
PNP_ZYMMO       ----------------------------
PNP_PELUB       ----------------------------
PNP_MAGMM       ----------------------------
PNP_RICTY       ----------------------------
PNP_ORITB       ----------------------------
PNP_ANAMM       ----------------------------
PNP_ANAPZ       ----------------------------
PNP_EHRRW       ----------------------------
PNP_WOLTR       ----------------------------
PNP_NEOSM       ----------------------------
PNP_CHLCV       ----------------------------
PNP_CHLPN       ----------------------------
PNP_CHLMU       ----------------------------
PNP_PARUW       ----------------------------
PNP_BACCN       ----------------------------
PNP_GEOTN       ----------------------------
PNP_OCEIH       ----------------------------
PNP_BACHD       ----------------------------
PNP_BACSK       ----------------------------
PNP_LISIN       ----------------------------
PNP_ENTFA       ----------------------------
PNP_STAS1       ----------------------------
PNP_STRMU       ----------------------------
PNP_STRTD       ----------------------------
PNP_LACLA       ----------------------------
PNP_SPICI       ----------------------------
PNP_ONYPE       ----------------------------
PNP_ACHLI       ----------------------------
PNP_FUSNN       ----------------------------
PNP_TRIV2       ----------------------------
PNP_TRIEI       ----------------------------
PNP_ACAM1       ----------------------------
PNP_SYNE7       ----------------------------
PNP_SYNY3       ----------------------------
PNP_THEEB       ----------------------------
PNP_PROMA       ----------------------------
PNP_PROMP       ----------------------------
PNP_SYNR3       ----------------------------
PNP_SYNJA       ----------------------------
PNP_GLOVI       ----------------------------
PNP_DEHM1       ----------------------------
PNP4_ALKMQ      ----------------------------
PNP_ALKOO       ----------------------------
PNP3_ALKMQ      ----------------------------
PNP_CLOD6       ----------------------------
PNP_CALS8       ----------------------------
PNP_CALS4       ----------------------------
PNP_CLOPS       ----------------------------
PNP_CLOB8       ----------------------------
PNP_CLOBL       ----------------------------
PNP_CLOTE       ----------------------------
PNP_CLONN       ----------------------------
PNP_CLOAB       ----------------------------
PNP_LACP7       ----------------------------
PNP_HUNT2       ----------------------------
PNP_CARHZ       ----------------------------
PNP_MOOTA       ----------------------------
PNP_DESRM       ----------------------------
PNP_PELTS       ----------------------------
PNP_DESHY       ----------------------------
PNP_SYNWW       ----------------------------
PNP_SYMTH       ----------------------------
PNP_CHLAA       ----------------------------
PNP_ROSS1       ----------------------------
PNP_DEIRA       ----------------------------
PNP_THET8       ----------------------------
PNP_RENSM       ----------------------------
PNP_KINRD       ----------------------------
PNP_STRAT       ----------------------------
PNP_NOCSJ       ----------------------------
PNP_ACIC1       ----------------------------
PNP_CUTAK       ----------------------------
PNP_FRACC       ----------------------------
PNP_THEFY       ----------------------------
PNP_RHOJR       ----------------------------
PNP_SACEN       ----------------------------
PNP_SALTO       ----------------------------
PNP_COREF       ----------------------------
PNP_CORDI       ----------------------------
PNP_CORJK       ----------------------------
PNP_LEIXX       ----------------------------
PNP_TROWT       ----------------------------
PNP_BIFLO       YDDYRADREERTERPRRRVRRDFDPFED
PNP_RUBXD       ----------------------------
PNP_LEPIC       ----------------------------
PNP_NITSB       ----------------------------
PNP_WOLSU       ----------------------------
PNP_SULDN       ----------------------------
PNP_ARCB4       ----------------------------
PNP_CAMC5       ----------------------------
PNP_CAMFF       ----------------------------
PNP_CAMHC       ----------------------------
PNP_CAMJD       ----------------------------
PNP_HELHP       ----------------------------
PNP_HELPH       ----------------------------
PNP_HELAH       ----------------------------
PNP_HELPJ       ----------------------------
PNP_SULNB       ----------------------------