CLUSTAL format seed alignment for MF_01599

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

NHAB_AERHH      -MPISLGQAFARNFLGNAPQWYKAAILLFLLINPIAFYL-DPFIAGWLLVVEFIFTLAMA
NHAB_AERS4      -MPISLGNAFAKNFLGNAPKWYKSAILLFLVINPIAFYL-DPFAAGWLLVVEFIFTLAMA
NHAB_VIBAL      -MPISLGNAFIKNFLGKAPDWYKVAIIAFLIINPIVFFLINPFVAGWLLVAEFIFTLAMA
NHAB_VIBPA      -MPISLGNAFIKNFLGKAPDWYKVAIIAFLIINPIVFFLINPFVAGWLLVAEFIFTLAMA
NHAB_VIBCB      -MPMSLGNAFIKNFLGKAPDWYKVAIIAFLIINPIVFFLIDPFVAGWLLVAEFIFTLAMA
NHAB_VIBVU      -MPMSLGNAFIKNFLGKAPDWYKVAIISFLIINPIVFFFVDPFVAGWLLVVEFIFTLAMA
NHAB_VIBVY      -MPMSLGNAFIKNFLGKAPDWYKVAIISFLIINPIVFFFVDPFVAGWLLVVEFIFTLAMA
NHAB_VIBCH      -MPMSLGNAFIKNFLGKAPDWYKVAIIAFLIINPIVFFFINPFLAGWLLVVEFIFTLAMA
NHAB_VIBC3      -MPMSLGNAFIKNFLGKAPDWYKVAIIAFLIINPIVFFFINPFLAGWLLVVEFIFTLAMA
NHAB_ALIF1      -MSISLGNAFIKNFLGKAPDWYKIAILSFLVINPLVFFFVDPFTAGWLLVVEFIFTLAMA
NHAB_PHOPR      -MAISLGNAFIKNFLGKAPDWYKITIISFLIINPFVFFLVDPFVAGWLLVVEFIFTLAMA
NHAB_HAEIN      ---MTNIQAFMKNFLGASPEWYKLAIVVFLIINPIVFFFISPFIAGWLLVAEFIFTLAMA
NHAB_HAEI8      ---MTNIQAFMKNFLGASPEWYKLAIVVFLIINPIVFFFISPFIAGWLLVAEFIFTLAMA
NHAB_ACTP2      ---MDSSNAIFKSFLGKAPEWYKICIIAFLVINPLIYFFISPFVAGWALVAEFIFTLSMA
NHAB_ACTPJ      ---MDSSNAIFKSFLGKAPEWYKICIIAFLVINPLIYFFISPFVAGWALVAEFIFTLSMA
NHAB_HAEDU      ---MNSSNAIFKTFLGSAPEWYKLCIITFLVINPLIYFFVSPFIAGWTLVAEFIFTLSMA
NHAB_MANSM      ---MSGYTAFFNNFLGKSPNWYKLSIIVFLILNPILYFLISPFIAGWCLVIEFIFTLAMA
NHAB_PASMU      ---MSYTQAFLRNFLGTSPNWYKITIVLFLIINPIIFFFISPFIAGWLLVAEFILTLAMA
NHAB_ACTSZ      ---MKYIQAFMNNFLGNSPDWYKVTIGVFLVINPFIFWF-HPFIAGWLLVAEFIFTLAMA
NHAB_ECOLI      -MEISWGRALWRNFLGQSPDWYKLALIIFLIVNPLIF-LISPFVAGWLLVAEFIFTLAMA
NHAB_ECO57      -MEISWGRALWRNFLGQSPDWYKLALIIFLIVNPLIF-LISPFVAGWLLVAEFIFTLAMA
NHAB_SHIBS      -MEISWGRALWRNFLGQSPDWYKLALIIFLIVNPLIF-LISPFVAGWLLVAEFIFTLAMA
NHAB_SHIDS      -MEISWGRALWRNFLGQSPDWYKLALIIFLIVNPLIF-LISPFVAGWLLVAEFIFTLAMA
NHAB_ECO24      -MEISWGRALWRNFLGQSPDWYKLALIIFLIVNPLIF-LISPFVAGWLLVAEFIFTLAMA
NHAB_ECOHS      -MEISWGRALWRNFLGQSPDWYKLALIIFLIVNPLIF-LISPFVAGWLLVAEFIFTLAMA
NHAB_SHISS      -MEISWGRALWRNFLGQSPDWYKLALIIFLIVNPLIF-LISPFVAGWLLVAEFIFTLAMA
NHAB_SHIFL      -MEISWGRALWRNFLGQSPDWYKLALIIFLIVNPLIF-LISPFVAGWLLVAEFIFTLAMA
NHAB_SHIF8      -MEISWGRALWRNFLGQSPDWYKLALIIFLIVNPLIF-LISPFVAGWLLVAEFIFTLAMA
NHAB_ECOUT      -MEISWGRALWRNFLGQSPDWYKLALIIFLIVNPLIF-LISPFVAGWLLVAEFIFTLAMA
NHAB_ECOK1      -MEISWGRALWRNFLGQSPDWYKLALIIFLIVNPLIF-LISPFVAGWLLVAEFIFTLAMA
NHAB_ECOL6      -MEISWGRALWRNFLGQSPDWYKLALIIFLIVNPLIF-LISPFVAGWLLVAEFIFTLAMA
NHAB_ECOL5      -MEISWGRALWRNFLGQSPDWYKLALIIFLIVNPLIF-LISPFVAGWLLVAEFIFTLAMA
NHAB_SALPA      -MEISWGRAMWRNFLGQSPDWYKLALLVFLIVNPFIF-LANPFVAGWLLVAEFIFTLAMA
NHAB_SALTI      -MEISWGRAMWRNFLGQSPDWYKLALLVFLIVNPFIF-LANPFVAGWLLVAEFIFTLAMA
NHAB_SALCH      -MEISWGRAMWRNFLGQSPDWYKLALLVFLIVNPFIF-LANPFIAGWLLVAEFIFTLAMA
NHAB_SALPB      -MEISWGRAMWRNFLGQSPDWYKLALLVFLIINPFIF-LANPFIAGWLLVAEFIFTLAMA
NHAB_SALTY      -MEISWGRAMWRNFLGQSPDWYKLALLVFLIVNPFIF-LANPFIAGWLLVAEFIFTLAMA
NHAB_SALAR      -MEISWGRAMWRNFLGQSPDWYKLALLVFLIINPLTF-FTNSFVAGWLLVAEFIFTLAMA
NHAB_CITK8      -MELSWGRAFWRNFLGQSPDWYKLALIAFLIANPLIF-FINPFVAGWLLVAEFIFTLAMA
NHAB_KLEP7      -MEISYGRALWRNFLGQSPDWYKLALIIFLIVNPLVF-AVAPFVAGWLLVVEFIFTLAMA
NHAB_CROS8      -MEISYGRALYRNFLGQSPDWYKLCLLGFLILNPLVF-WVSPFTAGWLLVIEFIFTLAMA
NHAB_ENT38      -MEISYGRALWRNFLGQSPDWYKLTLLAFLIINPLVF-IFQPFMAGWLLVAEFIFTLAMA
NHAB_SERP5      -METTFRSALVKNFLGQSPDWYKLAILVFLVVNPLVFFLVDPFIAGWLLVVEFIFTLAMA
NHAB_YERPE      -MDITNRQAVLKNFLGNSPDWYKLAIMGFLIINPLVFFFVSPFVAGWMLVIEFIFTLAMA
NHAB_YERPA      -MDITNRQAVLKNFLGNSPDWYKLAIMGFLIINPLVFFFVSPFVAGWMLVIEFIFTLAMA
NHAB_YERPN      -MDITNRQAVLKNFLGNSPDWYKLAIMGFLIINPLVFFFVSPFVAGWMLVIEFIFTLAMA
NHAB_YERPP      -MDITNRQAVLKNFLGNSPDWYKLAIMGFLIINPLVFFFVSPFVAGWMLVIEFIFTLAMA
NHAB_YERPS      -MDITNRQAVLKNFLGNSPDWYKLAIMGFLIINPLVFFFVSPFVAGWMLVIEFIFTLAMA
NHAB_YERP3      -MDITNRQAVLKNFLGNSPDWYKLAIMGFLIINPLVFFFVSPFVAGWMLVIEFIFTLAMA
NHAB_YERE8      -MDITIRQAVLRNFLGNSPDWYKLAIIAFLIINPLVFFFVSPFVAGWMLVIEFIFTLAMA
NHAB_PHOLL      -METSILKTAVKNFLGNSPDWYKLAIIIFLIINPLIFFFINPFVTGWLLVIEFIFTLAMA
NHAB_PECAS      MIAMPLHRALLKNFLGYAPDWYKLTIFGFLLINPLLFYFVSPFWAGWLLVVEFIFTLGMA
NHAB_SHEB5      -MPATMSQAFIGNFLGNSPKWYKTAILSFLIINPLLFFYVDPFVAGWVLVLEFIFTLAMA
NHAB_SHEB8      -MPATMSQAFIGNFLGNSPKWYKTAILSFLIINPLLFFYVDPFVAGWVLVLEFIFTLAMA
NHAB_SHEB9      -MPATMSQAFIGNFLGNSPKWYKTAILSFLIINPLLFFYVDPFVAGWVLVLEFIFTLAMA
NHAB_SHEPC      -MPLTMSQAFIGNFLGNSPKWYKIAILSFLIINPILFFYVSPFVAGWVLVLEFIFTLAMA
NHAB_SHESW      -MPLTMSQAFIGNFLGNSPKWYKIAILSFLIINPILFFYVSPFVAGWVLVLEFIFTLAMA
NHAB_SHESM      -MPMTMSQAFIGNFLGNSPKWYKIAILSFLIINPILFFYVSPFVAGWVLVLEFIFTLAMA
NHAB_SHESR      -MPMTMSQAFIGNFLGNSPKWYKIAILSFLIINPILFFYVSPFVAGWVLVLEFIFTLAMA
NHAB_SHESA      -MPMTMSQAFIGNFLGNSPKWYKIAILSFLIINPILFFYVSPFVAGWVLVLEFIFTLAMA
NHAB_SHEON      -MPMTMSQAFIGNFLGNSPKWYKIAILSFLIINPILFFYVSPFVAGWVLVLEFIFTLAMA
NHAB_SHEAM      -MPLTLGQSLFANFLGNSPRWYKFAILSFLAINPILF-YLNPFIAGWVLVIQFIFTLAMA
NHAB_SHEHH      -MPVTMSRAILDNFLGNSPKWFKLAIISFLVINPIVF-YFNPFIAGWLLVVEFIFTLAMA
NHAB_SHEPA      -MPVTMSRAFLDNFLGNSPKWFKIAIISFLVINPIVF-YFNPFVAGWLLVVEFIFTLAMA
NHAB_SHELP      -MPVTMSQAFIDNFLGNSPKWFKIAILSFLVINPIVF-YLNPFVAGWLLVVEFIFTLAMA
NHAB_SHESH      -MPVTMSQAFIDNFLGNSPKWFKIAILSFLIINPIIF-YLNPFIAGWLLVVEFIFTLAMA
NHAB_SHEFN      -MQATKSQALFVNFLGNSPKWYKYAIMAFLVINPLLFFYVSPFVAGWVLVVEFIFTLAMA
NHAB_SHEDO      -MPANKIDALFVNFLGNSPKWYKLAILSFLVINPLIFFFINPFVAGWVLVLEFIFTLAMA
NHAB_PSEA6      -MQQSTIGAVYSNFLGQAPDWYKKSIIAFLIFNPILF-MADPYIAGWALVLEFIFTLAMA
NHAB_PSEAE      -MSSPLSQAFAQNFLGHSPRWYKLTVLAFLLLNPLLLWLAGPVTSAWVLVGEFIFTLAMA
NHAB_PSEAB      -MSSPLSQAFAQNFLGHSPRWYKLTVLAFLLLNPLLLWLAGPVTSAWVLVGEFIFTLAMA
NHAB_PSEA7      -MSSPLSQAFAQNFLGHSPRWYKLTILAFLLSNPLLLWLAGPTVAAWVLVGEFIFTLAMA
NHAB_PSEP1      -MSRSLTGALAHGFLGQSPLWYKAVICLFLVLNPLLLATIGPAAAGWALVIEFIFTLGMA
NHAB_PSEPG      -MSRSLTGALAHGFLGQSPLWYKAIICLFLVLNPLLLVTVGPVAAGWALVLEFIFTLGMA
NHAB_PSEPK      -MSRPLTGALAHGFLGKSPIWYKVVICLFLVLNPLLLVTIGPVATGWALVLEFIFTLAMA
NHAB_PSEE4      -MSRSLTGALAHSFLGQSPRWYKAVIALFLVLNPLLLATLGPVVTGWVLVIQFIFTLGMA
NHAB_PSEF5      -MSGSMAQAFAHNFLGQSPRWYKASIVAFLLLNPPLFFAVSPAAAGWCLVIEFIFTLAMA
NHAB_PSEPF      -MSGSMAQAFAHNFLGHSPRWYKACIVGFLMLNALVLWSVGPVAAGWLLVIEFIFTLAMA
NHAB_MARHV      -MPTTVISGFTHNFLGKAPVWYKQVILLFLVINPIVMYLLGPGVAGWLLIGEFIFTLAMA
NHAB_MARMS      -MKTTLSHALGNNFLGASPLWYKQVVIAFLIINPIAVVTLGPFVTGWLFIIEFIFTLAMA
NHAB_SACD2      -MPQSMTNAFWHNFLGHTPNWYKKTILGFLVIN-IVLSQVSPFLAGWALIIEFIFTLAMA
NHAB_HAHCH      -MVTTLPQAFYSNFLGNAPSWYKKAICLFLLINPVIFL-ISPYIAGWVLILEFIFTLAMA
NHAB_ALCBS      -MSATLGRAFVQNFLGQAPAWYKYTIVAFLLINPLVALTLGPVTAGWLLLAEFIFTLAMA
                             *** :* *:*  :  **  *        .  :.* :: :**:**.**

NHAB_AERHH      LKCYPLQPGGLLAIEAVLIGMTSAKQVKHELVANIEVLLLLVFMVAGIYFMKQLLLYVFT
NHAB_AERS4      LKCYPLQPGGLLAIEAVLIGMTSAEQVKHELVANIEVLLLLVFMVAGIYFMKQLLLYVFT
NHAB_VIBAL      LKCYPLQPGGLLAIEAIAIGMTSPAQVKHELVANIEVLLLLVFMVAGIYFMKHLLLFIFT
NHAB_VIBPA      LKCYPLQPGGLLAIEAIAIGMTSPAQVKHELVANIEVLLLLVFMVAGIYFMKQLLLFIFT
NHAB_VIBCB      LKCYPLQPGGLLAIEAVAIGMTSPAQVKHELVANIEVLLLLVFMVAGIYFMKQLLLFIFT
NHAB_VIBVU      LKCYPLQPGGLLAIEAIAIGMTSPEQVKHELVANIEVLLLLVFMVAGIYFMKQLLLFIFT
NHAB_VIBVY      LKCYPLQPGGLLAIEAIAIGMTSPEQVKHELVANIEVLLLLVFMVAGIYFMKQLLLFIFT
NHAB_VIBCH      LKCYPLQPGGLLAIEAIAIGMTSPGQVKHELVANIEVLLLLVFMVAGIYFMKQLLLFIFT
NHAB_VIBC3      LKCYPLQPGGLLAIEAIAIGMTSPGQVKHELVANIEVLLLLVFMVAGIYFMKQLLLFIFT
NHAB_ALIF1      LKCYPLQPGGLLAIEAIAIGMTSPEQVKHELVANIEVLLLLVFMVAGIYFMKQLLLFIFT
NHAB_PHOPR      LKCYPLQPGGLLAIEAVAIGMTSPAQVKHELVANIEVLLLLIFMVAGIYFMKQLLLYIFT
NHAB_HAEIN      LKCYPLQPGGLLAIEAIIIGMTNAKHVKAEIMANFEVILLLIFMVAGIFFMKQLLLYVFT
NHAB_HAEI8      LKCYPLQPGGLLAIEAIIIGMTNAKHVKAEIMANFEVILLLIFMVAGIFFMKQLLLYVFT
NHAB_ACTP2      LKCYPLQPGGLLAIEAVFIGMTSAHHVKEEIMANFEVILLLMFMVAGIYFMKQLLLYVFT
NHAB_ACTPJ      LKCYPLQPGGLLAIEAVFIGMTSAHHVKEEIMANFEVILLLMFMVAGIYFMKQLLLYVFT
NHAB_HAEDU      LKCYPLQPGGLLAIEAVAIGMTSPHHVKHEIIANFEVILLLMFMVAGIYFMKQLLLYVFT
NHAB_MANSM      LKCYPLQPGGLLAFEAIAIGMTSPAHVKAEIMASFEVILLLMFMVAGIYFMKQLLLFAFT
NHAB_PASMU      LKCYPLQPGGLLALEAVAIGMTHPEHVKAEIIANFEVILLLIFMVAGIYFMKRLLLFVFT
NHAB_ACTSZ      LKCYPLQPGGMLALEAVTIGMTSPEHVKAEILANFEVILLLMFMVAGIYFMKQLLLYAFT
NHAB_ECOLI      LKCYPLLPGGLLAIEAVFIGMTSAEHVREEVAANLEVLLLLMFMVAGIYFMKQLLLFIFT
NHAB_ECO57      LKCYPLLPGGLLAIEAVFIGMTSAEHVREEVAANLEVLLLLMFMVAGIYFMKQLLLFIFT
NHAB_SHIBS      LKCYPLLPGGLLAIEAVFIGMTSAEHVREEVAANLEVLLLLMFMVAGIYFMKQLLLFIFT
NHAB_SHIDS      LKCYPLLPGGLLAIEAVFIGMTSAEHVREEVAANLEVLLLLMFMVAGIYFMKQLLLFIFT
NHAB_ECO24      LKCYPLLPGGLLAIEAVFIGMTSAEHVREEVAANLEVLLLLMFMVAGIYFMKQLLLFIFT
NHAB_ECOHS      LKCYPLLPGGLLAIEAVFIGMTSAEHVREEVAANLEVLLLLMFMVAGIYFMKQLLLFIFT
NHAB_SHISS      LKCYPLLPGGLLAIEAVFIGMTSAEHVREEVAANLEVLLLLMFMVAGIYFMKQLLLFIFT
NHAB_SHIFL      LKCYPLLPGGLLAIEAVFIGMTSAEHVREEVAANLEVLLLLMFMVAGIYFMKQLLLFIFT
NHAB_SHIF8      LKCYPLLPGGLLAIEAVFIGMTSAEHVREEVAANLEVLLLLMFMVAGIYFMKQLLLFIFT
NHAB_ECOUT      LKCYPLLPGGLLAIEAVFIGMTSAEHVREEVAANLEVLLLLMFMVAGIYFMKQLLLFIFT
NHAB_ECOK1      LKCYPLLPGGLLAIEAVFIGMTSAEHVREEVAANLEVLLLLMFMVAGIYFMKQLLLFIFT
NHAB_ECOL6      LKCYPLLPGGLLAIEAVFIGMTSAEHVREEVAANLEVLLLLMFMVAGIYFMKQLLLFIFT
NHAB_ECOL5      LKCYPLLPGGLLAIEAVFIGMTSAEHVREEVAANLEVLLLLMFMVAGIYFMKQLLLFIFT
NHAB_SALPA      LKCYPLLPGGLLAIEAVIIGMTSAAHVREEVAANLEVLLLLMFMVAGIYFMKQLLLFIFT
NHAB_SALTI      LKCYPLLPGGLLAIEAVIIGMTSAAHVREEVAANLEVLLLLMFMVAGIYFMKQLLLFIFT
NHAB_SALCH      LKCYPLLPGGLLAIEAVIIGMTSAAHVREEVAANLEVLLLLMFMVAGIYFMKQLLLFIFT
NHAB_SALPB      LKCYPLLPGGLLAIEAVIIGMTSAAHVREEVAANLEVLLLLMFMVAGIYFMKQLLLFIFT
NHAB_SALTY      LKCYPLLPGGLLAIEAVIIGMTSAAHVREEVAANLEVLLLLMFMVAGIYFMKQLLLFIFT
NHAB_SALAR      LKCYPLLPGGLLAIEAVVIGMTSAAHVREEVAANLEVLLLLMFMVAGIYFMKQLLLFIFT
NHAB_CITK8      LKCYPLLPGGLLAIEAVIIGMTSAAHVREEVAANLEVLLLLMFMVAGIYFMKQLLLFIFT
NHAB_KLEP7      LKCYPLLPGGLLAIEALLIGMTSPAHVREEIAGNLEVLLLLMFMVAGIYFMKQLLLFVFT
NHAB_CROS8      LKCYPLLPGGLLAVEALFIGMTSAEHVREEVANNLAVVLLLIFMVAGIYFMKQLLLLIFT
NHAB_ENT38      LKCYPLLPGGLLAIEAVVIGMTSAERVKDELATNLEVLLLLMFMVAGIYFMKQLLLFIFT
NHAB_SERP5      LKCYPLLPGGLLAIESVLIGMTSPDRVGEEIAHNLEVLLLLIFMVAGIYFMKQLLLFVFT
NHAB_YERPE      LKCYPLQPGGLLAIQAVAIGMTSPHQVAEEIANNLEVLLLLVFMVAGIYFMKQLLLFVFT
NHAB_YERPA      LKCYPLQPGGLLAIQAVAIGMTSPHQVAEEIANNLEVLLLLVFMVAGIYFMKQLLLFVFT
NHAB_YERPN      LKCYPLQPGGLLAIQAVAIGMTSPHQVAEEIANNLEVLLLLVFMVAGIYFMKQLLLFVFT
NHAB_YERPP      LKCYPLQPGGLLAIQAVAIGMTSPHQVAEEIANNLEVLLLLVFMVAGIYFMKQLLLFVFT
NHAB_YERPS      LKCYPLQPGGLLAIQAVAIGMTSPHQVAEEIANNLEVLLLLVFMVAGIYFMKQLLLFVFT
NHAB_YERP3      LKCYPLQPGGLLAIQAVAIGMTSPHQVAEEIANNLEVLLLLVFMVAGIYFMKQLLLFVFT
NHAB_YERE8      LKCYPLQPGGLLAIQAVAIGMTSPHQVAEEIANNLEVLLLLIFMVAGIYFMKQLLLFIFT
NHAB_PHOLL      LKCYPLQPGGLLAIEAVIIGMTSPQQVGHEIANNLEVVLLLIFMVAGIYFMKQLLLFAFT
NHAB_PECAS      LKCYPLQPGGLLALQAILIGMTSPQQVWHEVTGNIEVLMLLVFMVAGIYFMKQLLLFVFT
NHAB_SHEB5      LKCYPLQPGGLLAIEAVAIGMTSASQVLHEIEANLEVLLLLVFMVAGIYFMKQLLLFGFT
NHAB_SHEB8      LKCYPLQPGGLLAIEAVAIGMTSASQVLHEIEANLEVLLLLVFMVAGIYFMKQLLLFGFT
NHAB_SHEB9      LKCYPLQPGGLLAIEAVAIGMTSASQVLHEIEANLEVLLLLVFMVAGIYFMKQLLLFGFT
NHAB_SHEPC      LKCYPLQPGGLLAIEAVAIGMTSANQVLHEIEANLEVLLLLVFMVAGIYFMKQLLLFAFT
NHAB_SHESW      LKCYPLQPGGLLAIEAVAIGMTSANQVLHEIEANLEVLLLLVFMVAGIYFMKQLLLFAFT
NHAB_SHESM      LKCYPLQPGGLLAIQAVAIGMTSASQVLHEIEANLEVLLLLVFMVAGIYFMKQLLLFAFT
NHAB_SHESR      LKCYPLQPGGLLAIQAVAIGMTSASQVLHEIEANLEVLLLLVFMVAGIYFMKQLLLFAFT
NHAB_SHESA      LKCYPLQPGGLLAIEAVAIGMTSASQVLHEIEANLEVLLLLVFMVAGIYFMKQLLLFVFT
NHAB_SHEON      LKCYPLQPGGLLAIEAVAIGMTSASQVLHEIEANLEVLLLLVFMVAGIYFMKQLLLFAFT
NHAB_SHEAM      LKCYPLQPGGLLAIEAVIIGMTSPTQVLHEIQANLEVLLLLVFMVAGIYFMKQLLLYAFT
NHAB_SHEHH      LKCYPLQPGGLLAIEAVAIGMTSPSQVLHEIEANLEVVLLLVFMVAGIYFMKQLLLFVFT
NHAB_SHEPA      LKCYPLQPGGLLAIEAVAIGMTSPSQVLHEIEANLEVVLLLVFMVAGIYFMKQLLLFVFT
NHAB_SHELP      LKCYPLQPGGLLAIEAVIIGMTSPSQVLHEIEANLEVLLLLIFMVAGIYFMKQLLLFVFT
NHAB_SHESH      LKCYPLQPGGLLAIEAVAIGMTSPSQVFHELEANLEVLLLLIFMVAGIYFMKQLLLFVFT
NHAB_SHEFN      LKCYPLQPGGLLAIQAVFIGMTSPSQVLHEIEANLEVLLLLVFMVAGIYFMKQLLLFVFT
NHAB_SHEDO      LKCYPLQPGGLLAIQAVAIGMTSPSQVLHEIQANLEVLLLLIFMVAGIYFMKQLLLFVFT
NHAB_PSEA6      LKCYPLQPGGLLLIEALFIGMTSPEHMKHEIVVNIEVVLLLVFMVAGIYFMKDMLLFMFT
NHAB_PSEAE      LKCYPLQPGGLLVLEALLLGLATPEALYAELQHNFPVLLLLMFMVAGIYFMKDLLLLLFS
NHAB_PSEAB      LKCYPLQPGGLLVLEALLLGLATPEALYAELQHNFPVLLLLMFMVAGIYFMKDLLLLLFS
NHAB_PSEA7      LKCYPLQPGGLLVLEALLLGLASPEALYAELQHNFPVLLLLMFMVAGIYFMKDLLLLLFS
NHAB_PSEP1      LKCYPLMPGGLLLIEALLLQMTTPQALYEELQHNFPVILLLMFMVAGIHFMKELLLFLFS
NHAB_PSEPG      LKCYPLMPGGLLLVEALLLQMTTPQALYEELQHNFPVILLLMFMVAGIHFMKELLLFLFS
NHAB_PSEPK      LKCYPLMPGGLLLIEALLLQMTTPQALYEELQHNFPVILLLMFMVAGIHFMKELLLFLFS
NHAB_PSEE4      LKCYPLMPGGLLLVEALLLRMTTPEALYEELQHNFPVILLLMFMVAGIHFMKELLLFLFS
NHAB_PSEF5      LKCYPLMPGGLLLVQALVLGMTTPQALYDELVHNFPVILLLMFMVAGIYFMKELLLYLFS
NHAB_PSEPF      LKCYPLMPGGLLLIEALLLKMTTPQALYEELQHNFPVILLLMFMVAGIYFMKDLLLFLFS
NHAB_MARHV      LKCYPLLPGGLLAVEALLIGLTSADAVYHEVLTNFPVILLLMFMVAGIYFMKELLLVTFT
NHAB_MARMS      LKCYPLQPGGLIAIQAVLLGLTSSDGVYHEVNKNFDVILLLMFMVAGIYFMKDMLLFIFN
NHAB_SACD2      LKCYPLQPGGLLAIQAVLLGLTSADSVYHEVLANFKVILLLMFMVAGIYFMKDMLLFVFT
NHAB_HAHCH      LKCYPLQPGGLLAIEAVLIGMVSPHTVYEEVSGNLEVILLLVFMVAGIYFMKELLLHLFT
NHAB_ALCBS      LKCYPLQPGGLLAIEAVMIGLTSAETVLHKVVGNIEVMLLLIFMVAGIYFLKDLLLFMFT
                ****** ***:: .::: : :. .  :  ::  .: *::**:******.*:* :**  *.

NHAB_AERHH      KLLIRIHSKTLLSLAFCLVSAFLSAFLDALTVIAVVISVATGFYAIYHKVSSGKEFGNPH
NHAB_AERS4      KLLIRIHSKTLLSLAFCLVSAFLSAFLDALTVIAVVISVATGFYAIYHKVSSGKEFGHQH
NHAB_VIBAL      KILLGIRSKTLLSLAFCFAAAFLSAFLDALTVIAVVISVAIGFYSIYHKVASGN-PIGDH
NHAB_VIBPA      KILLGIRSKTLLSLAFCFAAAFLSAFLDALTVIAVVISVAVGFYSIYHKVASGN-PIGDH
NHAB_VIBCB      KILLGIRSKTLLSLAFCFAAAFLSAFLDALTVIAVVISVAVGFYSIYHKVASGN-PIGDH
NHAB_VIBVU      KILLGIRSKAILSLAFCFAAAFLSAFLDALTVIAVVISVAVGFYSIYHKVASGKGVSSDH
NHAB_VIBVY      KILLGIRSKAILSLAFCFAAAFLSAFLDALTVIAVVISVAVGFYSIYHKVASGKGVSSDH
NHAB_VIBCH      KILLGIRSKVLLSIAFSVTAAFLSAFLDALTVIAVIISVAVGFYSIYHKVASGQSVHSSH
NHAB_VIBC3      KILLGIRSKVLLSIAFSVTAAFLSAFLDALTVIAVIISVAVGFYSIYHKVASGQSVHSSH
NHAB_ALIF1      KILIGIKSKTALSVAFCFTAAFLSAFLDALTVIAVVISVAVGFYAIYHRVASGQGGSQTH
NHAB_PHOPR      KILIGIRSKVLLSLSFCLMAAFLSAFLDALTVIAVVISVTVGFYSIYHKVASGQDPSTSH
NHAB_HAEIN      KLLVKIRSKIALSIAFCFSAAFLSAFLDALTVVAVIISVAMGFYGVYHKVASGNNLIDAV
NHAB_HAEI8      KLLVKIRSKIALSIAFCFSAAFLSAFLDALTVVAVIISVAMGFYGVYHKVASGNNLIDAV
NHAB_ACTP2      KLLIVIHSKKILSLAFCLSATFLSAFLDALTVIAVIISVGTGFYGVYHKVASGNSFEDST
NHAB_ACTPJ      KLLIVIHSKKILSLAFCLSATFLSAFLDALTVIAVIISVGTGFYGVYHKVASGNSFEDST
NHAB_HAEDU      KLLIVIRSKKVLSLSFCLSAAFLSAFLDALTVIAVIISVGTGFYGVYHKVASGSTFEDST
NHAB_MANSM      RLLITVRSKIVLSLSFCLSAAFLSAFLDALTVVAVIISVVMGFYGVYHKVASGNNFDDST
NHAB_PASMU      KLLLSIRSKMVLSLAFCLSAAFLSAFLDALTVVAVIISVGMGFYGVYHKVASGNNFNDST
NHAB_ACTSZ      KLLLRIRSKLTLSLAFCLTAAFLSAFLDALTVIAVIISVAMGFYGVYHKVASGGTFNDPS
NHAB_ECOLI      RLLLSIRSKMLLSLSFCVAAAFLSAFLDALTVVAVVISVAVGFYGIYHRVASSR--TEDT
NHAB_ECO57      RLLLSIRSKMLLSLSFCVAAAFLSAFLDALTVVAVVISVAVGFYGIYHRVASSR--TEDT
NHAB_SHIBS      RLLLSIRSKMLLSLSFCVAAAFLSAFLDALTVVAVVISVAVGFYGIYHRVASSR--TEDT
NHAB_SHIDS      RLLLSIRSKMLLSLSFCVAAAFLSAFLDALTVVAVVISVAVGFYGIYHRVASSR--TEDT
NHAB_ECO24      RLLLSIRSKMLLSLSFCVAAAFLSAFLDALTVVAVVISVAVGFYGIYHRVASSR--TEDT
NHAB_ECOHS      RLLLSIRSKMLLSLSFCVAAAFLSAFLDALTVVAVVISVAVGFYGIYHRVASSR--TEDT
NHAB_SHISS      RLLLSIRSKMLLSLSFCVAAAFLSAFLDALTVVAVVISVAVGFYGIYHRVASSR--TEDT
NHAB_SHIFL      RLLLSIRSKMLLSLSFCVAAAFLSAFLDALTVVAVVISVAVGFYGIYHRVASSR--TEDT
NHAB_SHIF8      RLLLSIRSKMLLSLSFCVAAAFLSAFLDALTVVAVVISVAVGFYGIYHRVASSR--TEDT
NHAB_ECOUT      RLLLSIRSKMLLSLSFCVAAAFLSAFLDALTVVAVVISVAVGFYGIYHRVASSR--TEDT
NHAB_ECOK1      RLLLSIRSKMLLSLSFCVAAAFLSAFLDALTVVAVVISVAVGFYGIYHRVASSR--TEDT
NHAB_ECOL6      RLLLSIRSKMLLSLSFCVAAAFLSAFLDALTVVAVVISVAVGFYGIYHRVASSR--TEDT
NHAB_ECOL5      RLLLSIRSKMLLSLSFCVAAAFLSAFLDALTVVAVVISVAVGFYGIYHRVASSR--AEDT
NHAB_SALPA      RLLLSIRSKMVLSLAFCVAAAFLSAFLDALTVVAVVISVAVGFYGIYHRVASSR--GEEN
NHAB_SALTI      RLLLSIRSKMVLSLAFCVAAAFLSAFLDALTVVAVVISVAVGFYGIYHRVASSR--GEEN
NHAB_SALCH      RLLLSIRSKMVLSLAFCVAAAFLSAFLDALTVVAVVISVAVGFYGIYHRVASSR--GEEN
NHAB_SALPB      RLLLSIRSKMVLSLAFCVAAAFLSAFLDALTVVAVVISVAVGFYGIYHRVASSR--GEEN
NHAB_SALTY      RLLLSIRSKMVLSLAFCVAAAFLSAFLDALTVVAVVISVAVGFYGIYHRVASSR--GEEN
NHAB_SALAR      RLLLSIRSKMVLSLAFCVAAAFLSAFLDALTVVAVVISVAVGFYGIYHRVASSR--GEEN
NHAB_CITK8      RLLLSIRSKMLLSLAFCMAAAFLSAFLDALTVVAVVISVAVGFYGIYHRVASAR--GEEN
NHAB_KLEP7      RLLLGIRSKMLLSLAFCLAAAFLSAFLDALTVVAVVISVAVGFYGIYHRVASAR--PDDS
NHAB_CROS8      RLLLGIRSKTLLSLAFCFAAAFLSAFLDALTVVAVVISVAVGFYGIYHRVASNR--DEGQ
NHAB_ENT38      RLLLSIRSKTVLSLSFCLAAAFLSAFLDALTVVAVVISVAIGFYGIYHRVASSS--SD-N
NHAB_SERP5      KLLLNIRSKMLLSLAFCFAAALLSAFLDALTVVAVVISVATGFYSIYHNVASNR--SDGN
NHAB_YERPE      KLLLNIRSKTILSLAFCLASAFLSAFLDALTVIAVVISVSVGFYTIYHNVTSNH--SDK-
NHAB_YERPA      KLLLNIRSKTILSLAFCLASAFLSAFLDALTVIAVVISVSVGFYTIYHNVTSNH--SDK-
NHAB_YERPN      KLLLNIRSKTILSLAFCLASAFLSAFLDALTVIAVVISVSVGFYTIYHNVTSNH--SDK-
NHAB_YERPP      KLLLNIRSKTILSLAFCLASAFLSAFLDALTVIAVVISVSVGFYTIYHNVTSNH--SDK-
NHAB_YERPS      KLLLNIRSKTILSLAFCLASAFLSAFLDALTVIAVVISVSVGFYTIYHNVTSNH--SDK-
NHAB_YERP3      KLLLNIRSKTILSLAFCLASAFLSAFLDALTVIAVVISVSVGFYTIYHNVTSNH--SDK-
NHAB_YERE8      KLLLSIRSKITLSLAFCVASAFLSAFLDALTVIAVVISVSVGFYTIYHHVASNH--SDK-
NHAB_PHOLL      KLLLSIKSKRMLALAFCLASAFLSAFLDALTVIAVVISVSLGFYSIYNNFITDQ--NDVI
NHAB_PECAS      KLLLRIHSKPLLSLAFCMAAAFLSAFLDALTVIAVIISVAIGFYGIYHRFASQQG-EDEA
NHAB_SHEB5      KIITKVRSKVLVSLMFCLASAFLSAFLDALTVIAVIIAVAVGFYSIYHKVASGKDFGADH
NHAB_SHEB8      KIITKVRSKVLVSLMFCLASAFLSAFLDALTVIAVIIAVAVGFYSIYHKVASGKDFGADH
NHAB_SHEB9      KIITKVRSKVLVSLMFCLASAFLSAFLDALTVIAVIIAVAVGFYSIYHKVASGKDFGADH
NHAB_SHEPC      KIITKVRSKILVSLMFCLTSAFLSAFLDALTVIAVIIAVAVGFYAIYHKVASGKDFSAVH
NHAB_SHESW      KIITKVRSKILVSLMFCLTSAFLSAFLDALTVIAVIIAVAVGFYAIYHKVASGKDFSAVH
NHAB_SHESM      KMITKVRSKILVSLMFCLASAFLSAFLDALTVIAVIITVAVGFYSIYHKVASGKDFSADH
NHAB_SHESR      KMITKVRSKILVSLMFCLASAFLSAFLDALTVIAVIITVAVGFYSIYHKVASGKDFSADH
NHAB_SHESA      KMITKVRSKILVSLLFCLASAFLSAFLDALTVIAVIITVAVGFYSIYHKVASGKDFSADH
NHAB_SHEON      KMITKVRSKILVSLLFCLASAFLSAFLDALTVIAVIITVAVGFYSIYHKVASGKDFSADH
NHAB_SHEAM      KMLTKVRSKIVVSMLFCIASAFLSAFLDALTVIAVIITVAVGFYSIYHKVASGKDFSSDH
NHAB_SHEHH      KMITKVRSKVYVSLLFCVSSAFLSAFLDALTVIAVIITVAVGFYSIYHRVASGKSFADSH
NHAB_SHEPA      KMITKVRSKIYVSLLFCISSAFLSAFLDALTVIAVIITVAVGFYSIYHKVASGKTFGESH
NHAB_SHELP      KMITKIRSKVVVSLMFCIASAFLSAFLDALTVIAVIIAVAVGFYSIYHKVASGKSFTDDH
NHAB_SHESH      KMITKVRSKIVVSLMFCVASAFLSAFLDALTVIAVIIAVAVGFYSIYHKVASGKSFADDH
NHAB_SHEFN      KMITKVRSKIIVSLMFCTASAFLSAFLDALTVIAVIIAVAVGFYSIYHKVASGKSFNDGH
NHAB_SHEDO      KMITKVRSKTYLSLLFCVAAAFLSAFLDALTVIAVIIAVGIGFYSIYHKVASGKDFSSDH
NHAB_PSEA6      KLLLKLKNKIALSMSFVAASAFLSAFLDALTVVAVIIAVGMGFYSIYHKVASGKEFHSDH
NHAB_PSEAE      RLLLGVRSKTLLSLLFCLLAALLSAFLDALTVTAVVISVAVAFFAVYHRVASGQRASE-D
NHAB_PSEAB      RLLLGVRSKALLSLLFCLLAALLSAFLDALTVTAVVISVAVAFFAVYHRVASGQRASE-D
NHAB_PSEA7      RLLLGVRSKTLLSLLFCLLAALLSAFLDALTVTAVVISVAVAFFAVYHRVASGQRASE-D
NHAB_PSEP1      RILLGVRSKAMLSLLFCVLSAFLSAFLDALTVTAVIISAAVGFYAVYHRVASGANPRE-D
NHAB_PSEPG      RILLGVRSKAILSLLFCVLSAFLSAFLDALTVTAVIISAAVGFYAVYHRVASGANPRE-D
NHAB_PSEPK      RILLGVRSKAILALLFCVLSAFLSAFLDALTVTAVIISAAVGFYAVYHRVASGANPRE-D
NHAB_PSEE4      RILLGVRSKAVLSLLFCVLSAFLSAFLDALTVTAVIISAAVGFYAVYHRVASGTNPRE-E
NHAB_PSEF5      RLLLGVRSKALLGLLFCFLSAFLSAFLDALTVTAVIISAAVGFYSVYHRVASGNDPRQ-D
NHAB_PSEPF      RLLLGVRSKALLALMFCFLSAFLSAFLDALTVTAVIISAAVGFYSVYHRVASGNDPRQ-D
NHAB_MARHV      QILVGVRSKSALSLLFCSAAAVLSAFLDALTVTAVIISVAVGFFSVYHKVASGKGYQQKD
NHAB_MARMS      KLLVRVKSKIVISLIFSFSAALLSAFLDALTVTAVLISVGVGFYSVYHKAASGQSSNK-N
NHAB_SACD2      KILLGIRSKLLLSLLFSFVAAVLSAFLDALTVTAVLIAVAVGFYAVYHRFASGSGHGN-D
NHAB_HAHCH      KILLSIRSKAILSLLFSLVAAVLSAFLDALTVTAVIISVAVGFYSVYHKVASGKHFHH-D
NHAB_ALCBS      RILLGVKSKVTLSLLFCAAAALLSAFLDALTVTAVVIAVCTGFYGIYHKVASGKTFQQ-K
                :::  ::.*  :.: *   ::.********** **:*:.  .*: :*:.  :        

NHAB_AERHH      DHTDDD-----AVNELNRQHLDDFRAFLRSLMMHAAIGTALGGVCTLVGEPQNLIIGEQA
NHAB_AERS4      DHTDDH-----SVHELSRQHLDDFRAFLRSLMMHAAIGTALGGVCTLVGEPQNLIIGEQA
NHAB_VIBAL      DHTQDD-----TITELTRDDLENYRAFLRSLLMHAGVGTALGGVTTMVGEPQNLIIADQA
NHAB_VIBPA      DHTQDD-----TITELTRDDLENYRAFLRSLLMHAGVGTALGGVTTMVGEPQNLIIADQA
NHAB_VIBCB      DHTQDD-----TITELTRDDLENYRAFLRSLLMHAGVGTALGGVTTMVGEPQNLIIADQA
NHAB_VIBVU      DHTQDD-----HLAELTREDLENYRAFLRSLLMHAGVGTALGGVTTMVGEPQNLIIADQA
NHAB_VIBVY      DHTQDD-----HLAELTRDDLENYRAFLRSLLMHAGVGTALGGVTTMVGEPQNLIIADQA
NHAB_VIBCH      DHTHDE-----GISELTRDDLENYRAFLRSLLMHAGVGTALGGVTTMVGEPQNLIIADQA
NHAB_VIBC3      DHTHDE-----GISELTRDDLENYRAFLRSLLMHAGVGTALGGVTTMVGEPQNLIIADQA
NHAB_ALIF1      DHTCDS-----DVDELTREDLEDYRAFLRSLLMHAGVGTALGGVMTMVGEPQNLIIADQA
NHAB_PHOPR      DHTTDT-----HVREVSRDDLENYRSFLRSLLMHAGIGTALGGVMTMVGEPQNLIIADQA
NHAB_HAEIN      DISDDR-----KIIEQQHEILEKFRAFLRSLMMHAGVGTALGGVMTVVGEPQNLIIAEQA
NHAB_HAEI8      DISDDR-----KIIEQQHEILEKFRAFLRSLMMHAGVGTALGGVMTVVGEPQNLIIAEQA
NHAB_ACTP2      DISNDE-----KIITNK-EILEQFRAFLRSPLMHAAVGSALGGVMTMVGEPQNLIIAGQA
NHAB_ACTPJ      DISNDE-----KIITNK-EILEQFRAFLRSLLMHAAVGSALGGVMTMVGEPQNLIIAGQA
NHAB_HAEDU      DISNDD-----KIITNK-KILEQFRAFLRSLLMHAAVGSALGGVMTMVGEPQNLIIASQA
NHAB_MANSM      DITNDE-----KIKKDQ-QVLEQFRSFLRSLMMHAGVGTALGGVMTLVGEPQNLIIAEQA
NHAB_PASMU      DITKDD-----KIGENK-DTLEQFRAFLRSLMMHSCVGTALGGVMTMVGEPQNLIIAEQA
NHAB_ACTSZ      DITNDA-----KIKQNM-ETLEQFRAFLRSLMMHAAVGTALGGVMTLVGEPQNLIIAEQA
NHAB_ECOLI      DLQDDS-----HIDKHYKVVLEQFRGFLRSLMMHAGVGTALGGVMTMVGEPQNLIIAKAA
NHAB_ECO57      DLQDDS-----HIDKHYKVVLEQFRGFLRSLMMHAGVGTALGGVMTMVGEPQNLIIAKAA
NHAB_SHIBS      DLQDDS-----HIDKHYKVVLEQFRGFLRSLMMHAGVGTALGGVMTMVGEPQNLIIAKAA
NHAB_SHIDS      DLQDDS-----HIDKHYKVVLEQFRGFLRSLMMHAGVGTALGGVMTMVGEPQNLIIAKAA
NHAB_ECO24      DLQDDS-----HIDKHYKVVLEQFRGFLRSLMMHAGVGTALGGVMTMVGEPQNLIIAKAA
NHAB_ECOHS      DLQDDS-----HIDKHYKVVLEQFRGFLRSLMMHAGVGTALGGVMTMVGEPQNLIIAKAA
NHAB_SHISS      DLQDDS-----HIDKHYKVVLEQFRGFLRSLMMHAGVGTALGGVMTMVGEPQNLIIAKAA
NHAB_SHIFL      DLQDDS-----HIDKHYNVVLEQFRGFLRSLMMHAGVGTALGGVMTMVGEPQNLIIAKAA
NHAB_SHIF8      DLQDDS-----HIDKHYNVVLEQFRGFLRSLMMHAGVGTALGGVMTMVGEPQNLIIAKAA
NHAB_ECOUT      DLQDDS-----HIDKHYKVVLEQFRGFLRSLMMHAGVGTALGGVMTMVGEPQNLIIAKAA
NHAB_ECOK1      DLQDDS-----HIDKHYKVVLEQFRGFLRSLMMHAGVGTALGGVMTMVGEPQNLIIAKAA
NHAB_ECOL6      DLQDDS-----HIDKHYKVVLEQFRGFLRSLMMHAGVGTALGGVMTMVGEPQNLIIAKAA
NHAB_ECOL5      DLQDDS-----HIDKHYKVVLEQFRGFLRSLMMHAGVGTALGGVMTMVGEPQNLIIAKAA
NHAB_SALPA      DMLDDS-----HIDPHYKTVLEQFRGFLRSLMMHAGVGTALGGVMTMVGEPQNLIIAKAA
NHAB_SALTI      DMLDDS-----HIDPHYKTVLEQFRGFLRSLMMHAGVGTALGGVMTMVGEPQNLIIAKAA
NHAB_SALCH      DMLDDS-----HIDPHYKTVLEQFRGFLRSLMMHAGVGTALGGVMTMVGEPQNLIIAKAA
NHAB_SALPB      DMLDDS-----HIDPHYKTVLEQFRGFLRSLMMHAGVGTALGGVMTMVGEPQNLIIAKAA
NHAB_SALTY      DMLDDS-----HIDPHYKTVLEQFRGFLRSLMMHAGVGTALGGVMTMVGEPQNLIIAKAA
NHAB_SALAR      DMLDDS-----HIDQHYKTVLEQFRGFLRSLMMHAGVGTALGGVMTMVGEPQNLIIAKAA
NHAB_CITK8      DLQDDD-----HLDQNSKAVLEQFRGFLRSLMMHAGVGTALGGVMTMVGEPQNLIIAKAA
NHAB_KLEP7      DLLNDS-----HIEQHYREVLEQFRGFLRSLMMHAGVGTALGGVMTMVGEPQNLIIAKAA
NHAB_CROS8      ELVDDA-----QLDDERRATLERFRAFLRSLMMHAGVGTALGGVMTMVGEPQNLIIAHAA
NHAB_ENT38      DLQDDS-----QLDVNKRDVLEQFRAFLRSLMMHAGVGTALGGVMTMVGEPQNLIIAKAA
NHAB_SERP5      DGNIDVGDDSTLVSDDHKQTLEQFRAFLRSLLMHAGVGTALGGVMTMVGEPQNLIIAKSA
NHAB_YERPE      DITDDSG----IDNQDSHETLEQFRAFLRSLMMHAGVGTALGGVMTMVGEPQNLIIAKSA
NHAB_YERPA      DITDDSG----IDNQDSHETLEQFRAFLRSLMMHAGVGTALGGVMTMVGEPQNLIIAKSA
NHAB_YERPN      DITDDSG----IDNQDSHETLEQFRAFLRSLMMHAGVGTALGGVMTMVGEPQNLIIAKSA
NHAB_YERPP      DITDDSG----IDNQDSHETLEQFRAFLRSLMMHAGVGTALGGVMTMVGEPQNLIIAKSA
NHAB_YERPS      DITDDSG----IDNQDSHETLEQFRAFLRSLMMHAGVGTALGGVMTMVGEPQNLIIAKSA
NHAB_YERP3      DITDDSG----IDNQDSHETLEQFRAFLRSLMMHAGVGTALGGVMTMVGEPQNLIIAKSA
NHAB_YERE8      DINDDSW----IDSQENRKTLEQFRAFLRSLMMHAGVGTALGGVMTMVGEPQNLIIAKSA
NHAB_PHOLL      NAKHDNH----IDTAKKKQTLEQFRAFLRSLMMHAGVGTALGGVMTMVGEPQNLIIAKNV
NHAB_PECAS      DISDDSA----LNGEEHHRTLDQFRAFLRSLMMHAGVGTALGGVMTMVGEPQNLIIAKSA
NHAB_SHEB5      DHTSEGKNAA-GEDQLNEEELGAFRGFLRNLLMHAGVGTALGGVCTMVGEPQNLIIAAQA
NHAB_SHEB8      DHTSEGKNAA-GEDQLNEEELGAFRGFLRNLLMHAGVGTALGGVCTMVGEPQNLIIAAQA
NHAB_SHEB9      DHTSEGKNAA-GEDQLNEEELGAFRGFLRNLLMHAGVGTALGGVCTMVGEPQNLIIAAQA
NHAB_SHEPC      DHTSESN------NQLNNSELESFRGFLRNLLMHAGVGTALGGVCTMVGEPQNLIIAAQA
NHAB_SHESW      DHTSESN------TQLNNSELESFRGFLRNLLMHAGVGTALGGVCTMVGEPQNLIIAAQA
NHAB_SHESM      DHTSEGKNED-GENQLNEEELESFRGFLRNLLMHAGVGTALGGVCTMVGEPQNLIIAAQA
NHAB_SHESR      DHTSEGKNED-GENQLNEEELESFRGFLRNLLMHAGVGTALGGVCTMVGEPQNLIIAAQA
NHAB_SHESA      DHTSEGKNDD-GENQLNEDELESFRGFLRNLLMHAGVGTALGGVCTMVGEPQNLIIAAQA
NHAB_SHEON      DHTSENKNEE-GEDQLNEAELESFRGFLRNLLMHAGVGTALGGVCTMVGEPQNLIIAAQA
NHAB_SHEAM      DHTSEAP------EQLNESELESFRGFLRNLLMHAGVGTALGGVCTMVGEPQNLIIAAQA
NHAB_SHEHH      DHTSDGH------PQLCEEELESFRGFLRNLLMHAGVGTALGGVCTMVGEPQNLIIAAQA
NHAB_SHEPA      DHTSDGY------PQLCEEELESFRGFLRNLLMHAGVGTALGGVCTMVGEPQNLIIAAQA
NHAB_SHELP      DHTSDSHGEG---HSLCEDELEAFRGFLRNLLMHAGIGTALGGVCTMVGEPQNLIIAAQA
NHAB_SHESH      DHTSDGH------HQLCQDELSAFRGFLRNLLMHAGIGTALGGVCTMVGEPQNLIIAAQA
NHAB_SHEFN      DHTSETT------EQLNNEELEAFRAFLRNLLMHSGIGTALGGVCTMVGEPQNLIIAAQA
NHAB_SHEDO      DHTSESH------DQLNADDLESFRGFLRNLLMHAGVGTALGGVCTMVGEPQNLIIAAQA
NHAB_PSEA6      DHTSDDHV-----DHPKRQDLEDFRAFLRNLMMHAAVGTALGGVMTMVGEPQNLIIADKA
NHAB_PSEAE      YDPATDR----QVPELHRAHLEEFRAFLRSLLMHAAVGTALGGVCTLVGEPQNLLIGHEA
NHAB_PSEAB      YDPATDR----QVPELHRAHLEEFRAFLRSLLMHAAVGTALGGVCTLVGEPQNLLIGHEA
NHAB_PSEA7      YDPATDR----QVPELHRAHLEEFRAFLRSLLMHAAVGTALGGVCTLVGEPQNLLIGHEA
NHAB_PSEP1      SALDSDQ----QVAQLHRDDLNQFRAFLRSLLMHGAVGTALGGVCTLVGEPQNLLIGHEM
NHAB_PSEPG      SALDSDQ----QVAQLHREDLDQFRAFLRSLLMHGAVGTALGGVCTLVGEPQNLLIGHEM
NHAB_PSEPK      SALESDQ----QVAHLHREDLDQFRAFLRSLLMHGAVGTALGGVCTLVGEPQNLLIGHEM
NHAB_PSEE4      SALDSDH----QVEQLHREDLDQFRAFLRSLLMHGAVGTALGGVCTLVGEPQNLLIGHEM
NHAB_PSEF5      SAFADDQ----QLPALHHDDLEQFRAFLRSLLMHGAVGTALGGVCTLVGEPQNLLIGHEM
NHAB_PSEPF      SEFSDDQ----HLPQLHHEDLEQFRAFLRSLLMHGAVGTALGGVCTLVGEPQNLLIGHEM
NHAB_MARHV      HNTNSDD----EVIELHREDLENFRAFLRSLLMHGAIGTALGGVATMVGEPQNLLIAKVV
NHAB_MARMS      HDHAKDD----SILPINTEDLNEFRSFLRDLLMHGAVGTALGGVSTLVGEPQNLLIAKVA
NHAB_SACD2      HDHSADD----NVHDLHREDLDTFRSFLRSLIMHGAVGTALGGVATLVGEPQNLLIAEIA
NHAB_HAHCH      HDHGDDE----SVHHDHRADLEQFRSFLRSLLMHAAVGTALGGVCTQVGEPQNLLIAQRL
NHAB_ALCBS      HDHGDDT----TVEELHREDLRRFRSFLRSLLMHAAVGTALGGVCTLVGEPQNLLIANKA
                                    *  :*.***. :**. :*:***** * *******:*.   

NHAB_AERHH      GWNFGEFAIRMSPVTVPVFICGLLTCVLVEKCRWFGYGAKLPDAVRRIMEDYNRYEEAGR
NHAB_AERS4      GWSFGEFAIRMAPVTIPVFICGLLTCILVEKCRWFGYGAKLPDAVRHIMEDYNRYEEAGR
NHAB_VIBAL      GWLFGEFLIRMSPVTLPVFFCGLITCALVEKLKVFGYGAKLPNNVRQILVDFDNEERKTR
NHAB_VIBPA      GWLFGEFLIRMSPVTLPVFICGLITCALVEKLKVFGYGAKLPDNVRQILVDFDREERKTR
NHAB_VIBCB      GWFFGEFLIRMAPVTLPVFFCGLITCAIVEKLKICGYGAQLPDNVRQILVDFDREERKTR
NHAB_VIBVU      SWLFGEFLIRMAPVTLPVFVCGLLTCFAVEKLKVFGYGAELPDNVRHILVEFDKEERKAR
NHAB_VIBVY      SWLFGEFLIRMAPVTLPVFVCGLLTCFAVEKLKVFGYGAELPDNVRHILVEFDKEERKAR
NHAB_VIBCH      GWQFGEFLLRMAPVTVPVFIAGMLTCMLVEKFRIFGYGARLPANVRQILLDFDSEERKNR
NHAB_VIBC3      GWQFGEFLLRMAPVTVPVFIAGMLTCMLVEKFRIFGYGARLPANVRQILLDFDSEERKNR
NHAB_ALIF1      GWMFGEFIIRMLPITAPVFICGILTCIAVEKLGICGYGAKLPENVRKILEDYEAEERKNR
NHAB_PHOPR      GWLFGEFIIRMSPVTVPVFMCGLLTCTLVEKFQICGYGTLLPENVRRILVDYDDEERKNR
NHAB_HAEIN      KWNFMEFFLRMAPVTIPVFICGLLTCFLVEKFKLFGYGEKLPDEVWKILSDLDRTNSEKM
NHAB_HAEI8      KWNFMEFFLRMAPVTIPVFICGLLTCFLVEKFKLFGYGEKLPDEVWKVLSDLDRTNSEKM
NHAB_ACTP2      EWGFVEFLLRVLPVSLPVLICGVITCLLLEHFKIFGYGARLPRRVWGVLARYNLLKEQRM
NHAB_ACTPJ      EWGFVEFLLRVLPVSLPVLICGVITCLLLEHFKIFGYGARLPRRVWGVLARYNLLKEQRM
NHAB_HAEDU      EWGFIEFLIRVAPVSLPVLICGIATCLLLEHFKVFGYGERLPRRVWGVLARYNVLQEQHM
NHAB_MANSM      SWGFGEFFIRMAPVTVPVLICGLITCVMIEKMNIFGYGDKLPRKVWGILAKFNRAQQQKM
NHAB_PASMU      KWAFGEFFLRMLPVTLPVLICGLVTCFLVEKFGVFGYGAKLPRKVWGILAKFDRNNQQKM
NHAB_ACTSZ      GWGFKEFFFRMSPVTLLTLISGVVTCITVERLRLCGYGEKLPRKVWGVLAKFDRAHEEQM
NHAB_ECOLI      GWHFGDFFLRMSPVTVPVLICGLLTCLLVEKLRWFGYGETLPEKVREVLQQFDDQSRHQR
NHAB_ECO57      GWHFGDFFLRMSPVTVPVLICGLLTCLLVEKLRWFGYGETLPEKVREVLQQFDDQSRHQR
NHAB_SHIBS      GWHFGDFFLRMSPVTVPVLICGLLTCLLVEKLRWFGYGETLPEKVREVLQQFDDQSRHQR
NHAB_SHIDS      GWHFGDFFLRMSPVTVPVLICGLLTCLLVEKLRWFGYGETLPEKVREVLQQFDDQSRHQR
NHAB_ECO24      GWHFGDFFLRMSPVTVPVLICGLLTCLLVEKLRWFGYGETLPEKVREVLQQFDDQSRHQR
NHAB_ECOHS      GWHFGDFFLRMSPVTVPVLICGLLTCLLVEKLRWFGYGETLPEKVREVLQQFDDQSRHQR
NHAB_SHISS      GWHFGDFFLRMSPVTVPVLICGLLTCLLVEKLRWFGYGETLPEKVREVLQQFDDQSRHQR
NHAB_SHIFL      GWHFGDFFLRMSPVTVPVLICGLLTCLLVEKLRWFGYGETLPEKVREVLQQFDDQSRHQR
NHAB_SHIF8      GWHFGDFFLRMSPVTVPVLICGLLTCLLVEKLRWFGYGETLPEKVREVLQQFDDQSRHQR
NHAB_ECOUT      GWHFGDFFLRMSPVTVPVLICGLLTCLLVEKLRWFGYGETLPEKVREVLQQFDDQSRLQR
NHAB_ECOK1      GWHFGDFFLRMSPVTVPVLICGLLTCLLVEKLRWFGYGETLPEKVREVLQQFDDQSRLQR
NHAB_ECOL6      GWHFGDFFLRMSPVTVPVLICGLLTCLLVEKLRWFGYGETLPEKVREVLQQFDDQSRNQR
NHAB_ECOL5      GWHFGDFFLRMSPVTVPVLICGLLTCLLVEKLRWFGYGETLPEKVREVLQQFDDQSRNQR
NHAB_SALPA      GWHFGDFFLRMSPVTVPVLVCGLLTCMLVEKMRWFGYGETLPEKVRDVLQQFDDQSRKKR
NHAB_SALTI      GWHFGDFFLRMSPVTVPVLVCGLLTCMLVEKMRWFGYGETLPEKVRDVLQQFDDQSRKKR
NHAB_SALCH      GWHFGDFFLRMSPVTVPVLVCGLLTCMLVEKMRWFGYGETLPEKVRDVLQQFDDQSRKKR
NHAB_SALPB      GWHFGDFFLRMSPVTVPVLVCGLLTCMLVEKMRWFGYGETLPEKVRDVLQQFDDQSRKKR
NHAB_SALTY      GWHFGDFFLRMSPVTVPVLVCGLLTCMLVEKMRWFGYGETLPEKVRDVLQQFDDQSRKKR
NHAB_SALAR      GWHFGDFFLRMSPVTVPVLVCGLLTCMLVEKMRWFGYGETLPEKVRNVLQQFDDQSRKQR
NHAB_CITK8      GWHFGDFFLRMSPVTVPVLICGLFTCVLVEKLRWFGYGETLPEKVRHILQEFDDQSRQRR
NHAB_KLEP7      GWHFGEFFLRMAPVTLPVMVCGLLTCLLVEKYRLFGYGEPLPPTVRKVLQEFDDRSRAQR
NHAB_CROS8      GWSFGDFLLRVAPVSVPVFICGIVTCILVEKTKSFGYGEPLPEPVRKILREYDDKSRQKR
NHAB_ENT38      GWNFTEFFLRVAPVSVPVFICGMLTCFLLERTKTFGYGVQLPGAVRDVLHEFDLKSRSQR
NHAB_SERP5      GWGFVDFFLRMAPVTLPVFACGLLVCLLLERFGVFGYGAKLPERVREVLTEFDRQATAGR
NHAB_YERPE      GWNFADFFIRMLPVTLPVFIFGLLVCLLVEKFKLFGYGAQLPERVRQVLTEYDQQANAKR
NHAB_YERPA      GWNFADFFIRMLPVTLPVFIFGLLVCLLVEKFKLFGYGAQLPERVRQVLTEYDQQANAKR
NHAB_YERPN      GWNFADFFIRMLPVTLPVFIFGLLVCLLVEKFKLFGYGAQLPERVRQVLTEYDQQANAKR
NHAB_YERPP      GWNFADFFIRMLPVTLPVFIFGLLVCLLVEKFKLFGYGAQLPERVRQVLTEYDQQANAKR
NHAB_YERPS      GWNFADFFIRMLPVTLPVFIFGLLVCLLVEKFKLFGYGAQLPERVRQVLTEYDQQASAKR
NHAB_YERP3      GWNFADFFIRMLPVTLPVFIFGLLVCLLVEKFKLFGYGAQLPERVRQVLTEYDQQASAKR
NHAB_YERE8      GWHFGDFFMRMLPVTLPVLCCGLLVCILLERFKLFGYGAVLPERVRQVLTDYDKQASAKR
NHAB_PHOLL      NWDFVTFFIRMAPITLPVFICGLLVCFLVEHFKLFGYGTELPERVRQVLEDYDKKTSAKR
NHAB_PECAS      GWDFVDFFLRMSPVTVPVFICGILTCVLVERFKLFGYGVNLPDNVRRVLEDYDRDMTEKR
NHAB_SHEB5      NWQFGEFAVRMSPVTVPVLISGILTCYLVEKFGIFGYGAKLPTAVHRILCEYAAHEDARR
NHAB_SHEB8      NWQFGEFAVRMSPVTVPVLISGILTCYLVEKFGIFGYGAKLPTAVHRILCEYAAHEDARR
NHAB_SHEB9      NWQFGEFAVRMSPVTVPVLISGILTCYLVEKFGIFGYGAKLPTAVHRILCEYAAHEDARR
NHAB_SHEPC      NWQFGEFVIRMSPVTVPVLIAGILTCLLVEKFRIFGYGAKLPDAVHKILCDYAAHEDAHR
NHAB_SHESW      NWQFGEFVVRMSPVTVPVLIAGILTCLLVEKFRIFGYGAKLPDAVHKILCDYAAHEDAHR
NHAB_SHESM      NWQFGEFAIRMSPVTVPVLFAGILTCFLVEKLRWFGYGAQLPEAVHKILCDYAAYEDARR
NHAB_SHESR      NWQFGEFAIRMSPVTVPVLFAGILTCFLVEKLRWFGYGAQLPEAVHKILCDYAAYEDARR
NHAB_SHESA      NWQFGEFAIRMSPVTVPVLFAGILTCFIVEKFRWFGYGAQLPDAVHKILCDYAAYEDARR
NHAB_SHEON      NWQFGEFAIRMSPVTVPVFIAGILTCYIVEKFRIFGYGAQLPDAVHKILCDYDAHEDARR
NHAB_SHEAM      NWQFGEFAIRMSPVTVPVFFAGILTCFIVEKFKWFGYGAKLPEAVHKILSEYDAYEDARR
NHAB_SHEHH      NWQFAEFAIRMSPVTVPVFFAGVTTCFLVEKFKVFGYGQQLPEAVHKILSDYDAHEDANR
NHAB_SHEPA      NWQFAEFAIRMSPVTVPVFFAGITTCFLVEKFKVFGYGQQLPDAVHKILSDYDAHEDANR
NHAB_SHELP      NWQFGEFALRMGPVTVPVFISGIATCFLVEKFKWFGYGQQLPEAVHKILSDYASYEDAHR
NHAB_SHESH      NWQFVEFAMRMSPVTVPVFFAGIITCFLVEKFKVFGYGQQLPEAVHTILSEFAAHEDAHR
NHAB_SHEFN      HWQFGEFFLRMSPVTMPVLVAGIFTCFLVEKFKVFGYGAQLPGAVHKILTDYANHEDSHR
NHAB_SHEDO      HWQFGEFFIRMSPVTIPVLLSGLLTCVVVEKLKWFTYGVQLPENVHKILSDYDAYEDTHR
NHAB_PSEA6      SWNFGEFFVRMSPVTIPVFFAGIATTFALEKFKIFSYGAQLPQVVRDILTAHSHQQEATR
NHAB_PSEAE      GWHFVEFFRQVAPVSMPVLAAGLLTCVLLEKSRRFGYGAQLPAAVRQVLAEYAASESRKR
NHAB_PSEAB      GWHFVEFFRQVAPVSMPVLAAGLLTCVLLEKSRRFGYGAQLPAAVRQVLAEYAASESRKR
NHAB_PSEA7      GWHFVEFFRQVAPVSMPVLAAGLLTCVALEKSRRFGYGAQLPAAVRQVLAEYAAGESRKR
NHAB_PSEP1      GWHFADFLLKVAPVSIPVLGAGLLTCVLLEKLRLFGYGTLMPETVRQVLAAYAAEDDAAR
NHAB_PSEPG      GWHFADFFFKVAPVSLPVLGAGLLTCVLLEKLRLFGYGTLMPEPVRQVLAAYAAEDDAAR
NHAB_PSEPK      GWHFVDFFLKVAPVSLPVLGAGLVTCVLLEKVRLFGYGTLMPEPVRRVLTAYAAEDDAAR
NHAB_PSEE4      GWHFADFFLKVAPVSMPVLAAGLVTCVLLEKLRLFGYGTLMPERVRQVLAAYAAEDDAAR
NHAB_PSEF5      GWHFADFFSKVAPVSMPVLAAGLVTCVLLEKLRWFGYGTLLPDNVRQVLANYAAEDDAQR
NHAB_PSEPF      GWHFAEFFLKVAPVSLPVLVAGLVTCLLLEKLRWFGYGTLLPDNVRAVLANYAAEDNAER
NHAB_MARHV      GWDFAGFFLHMAPVSIPVLFAGLATCWALEKLRWFGYGGRLPKPVRRVLEEFADNEKARR
NHAB_MARMS      GWDFIDFFLYVAPVSMPVLACGLLTVVILEKTAWFDYGAQLPDTVRDILNNFEKEESQKQ
NHAB_SACD2      GWNFIEFYLVMAPISVPALIGGLLTCAILEKTGICGYGAKLPDSVRQILVDFDKKETAKR
NHAB_HAHCH      GWDFIEFFVRMAPISIPVLIAGLITCVILEKTRWFGYGDDIPASVRKILEDFNEAEKKKM
NHAB_ALCBS      GWEFGEFFLRMAPITLPVLVMGFFTCAFLEFSGSFGYGEDIPEKVRGIMRQYALEQDRKR
                 * *  *   : *::  .:  *. .   :*      **  :*  *  ::           

NHAB_AERHH      TAQDKAKLIVQAAIALWLILGLAMHLAAVGLIGLSVIVLATSLTGITEEHSLGKAFQEAL
NHAB_AERS4      SPQDKAKLIVQAVIAIWLILGLAMHLAAVGLIGLSVIVLATSLTGINDEHSLGKAFQEAL
NHAB_VIBAL      TNQDVAKLWVQGLIAVWLIVALALHLAAVGLIGLSVIILATAFTGVIEEHSMGKAFEEAL
NHAB_VIBPA      TNQDVAKLWVQGIIAVWLIVALALHLAAVGLIGLSVIILATSFTGVIEEHSMGKAFEEAL
NHAB_VIBCB      TNQDVAKLWIQGLIAVWLIAALALHLAAVGLIGLSVIILATSFTGVIEEHSMGKAFEEAL
NHAB_VIBVU      TNQDVAKLWIQGLIAVWLIVGLALHLAAVGLIGLSVIILATAFTGVIEEHSLGKAFEEAL
NHAB_VIBVY      TNQDVAKLWIQGLIAVWLIVGLALHLAAVGLIGLSVIILATAFTGVIEEHSLGKAFEEAL
NHAB_VIBCH      TNQDVAKLWVQGAIAVWLIVGLALHLAAVGLIGLSVIILATAFTGVIEEHSLGKAFEEAL
NHAB_VIBC3      TNQDVAKLWVQGAIAVWLIVGLALHLAAVGLIGLSVIILATAFTGVIEEHSLGKAFEEAL
NHAB_ALIF1      TNIDNAKLIIQGLIAVWLIVGLALHLAAVGLIGLSVIILATAFTGVIEEHSMGKAFEEAL
NHAB_PHOPR      TNIDYAKLTAQALIAVWLIVGLAMHLAAVGLIGLTVIIFATSFTGVTEEHALGKAFEEAL
NHAB_HAEIN      SKQDKIKLGMQALIAIWLIVGLAFHLAAVGLIGLSIIIFATSFTGVTDEHTIGKAFQESL
NHAB_HAEI8      SKQDKIKLGMQALIAIWLILGLAFHLAAVGLIGLSIIIFATSFTGVTDEHTIGKAFQESL
NHAB_ACTP2      TQQDRVKMGIQALAGIWLVVGLALHLADVGIIGLTIIIICTAFCGITDEHAIGRSFQEPM
NHAB_ACTPJ      TQQDRVKMGIQALAGIWLVVGLALHLADVGIIGLTIIIICTAFCGITDEHAIGRSFQEPM
NHAB_HAEDU      TKQDRVKMAIQALAGIWLIVGLALHLADVGIIGLTIIIICTAFCGITDEHAIGRSFQEPM
NHAB_MANSM      NRQERQKLIIQGIIGIWLVCGLAFHLAAVGLIGLSVIVLTTAFCGITSESTIGKSFQESL
NHAB_PASMU      SQQDRLKLFVQALIGIWLVVGLAFHLAAVGIIGLTVIILATSFCGVTSEHAIGKAFQESL
NHAB_ACTSZ      TTQDRVKLGVQVFVGIWLIIGLAFHLASVGLIGLTVIILTTAYCGITDEHAIGRAFQESL
NHAB_ECOLI      TRQDKIRLIVQAIIGVWLVTALALHLAEVGLIGLSVIILATSLTGVTDEHAIGKAFTESL
NHAB_ECO57      TRQDKIRLIVQAIIGVWLVTALALHLAEVGLIGLSVIILATSLTGVTDEHAIGKAFTESL
NHAB_SHIBS      TRQDKIRLIVQAIIGVWLVTALALHLAEVGLIGLSVIILATSLTGVTDEHAIGKAFTESL
NHAB_SHIDS      TRQDKIRLIVQAIIGVWLVTALALHLAEVGLIGLSVIILATSLTGVTDEHAIGKAFTESL
NHAB_ECO24      TRQDKIRLIVQAIIGVWLVTALALHLAEVGLIGLSVIILATSLTGVTDEHAIGKAFTESL
NHAB_ECOHS      TRQDKIRLIVQAIIGVWLVTALALHLAEVGLIGLSVIILATSLTGVTDEHAIGKAFTESL
NHAB_SHISS      TRQDKIRLIVQAIIGVWLVTALALHLAEVGLIGLSVIILATSLIGVTDEHAIGKAFTESL
NHAB_SHIFL      TRQDKIRLIVQAIIGVWLVTALALHLAEVGLIGLSVIILATSLTGVTDEHAIGKAFTESL
NHAB_SHIF8      TRQDKIRLIVQAIIGVWLVTALALHLAEVGLIGLSVIILATSLTGVTDEHAIGKAFTESL
NHAB_ECOUT      TRQDKIRLIVQAIIGVWLVTALALHLAEVGLIGLSVIILATSLTGVTDEHAIGKAFTESL
NHAB_ECOK1      TRQDKIRLIVQAIIGVWLVTALALHLAEVGLIGLSVIILATSLTGVTDEHAIGKAFTESL
NHAB_ECOL6      TRQDKIRLIVQAIIGVWLVTALALHLAEVGLIGLSVIILATSLTGVTDEHAIGKAFTESL
NHAB_ECOL5      TRQDKIRLIVQAIIGVWLVTALALHLAEVGLIGLSVIILATSLTGVTDEHAIGKAFTESL
NHAB_SALPA      TRQDKIKLIVQAVIGVWLVTALALHLAEVGLIGLSVIILATALTGVTDEHAIGKAFTESL
NHAB_SALTI      TRQDKIKLIVQAVIGVWLVTALALHLAEVGLIGLSVIILATALTGVTDEHAIGKAFTESL
NHAB_SALCH      TRQDKIKLIVQAVIGVWLVTALALHLAEVGLIGLSVIILATALTGVTDEHAIGKAFTESL
NHAB_SALPB      TRQDKIKLIVQAIIGVWLVTALALHLAEVGLIGLSVIILATALTGVTDEHAIGKAFTESL
NHAB_SALTY      TRQDKIKLIVQAIIGVWLVTALALHLAEVGLIGLSVIILATALTGVTDEHAIGKAFTESL
NHAB_SALAR      TRQDKIKLIVQAIIGVWLVTALALHLAEVGLIGLSVIILATALTGVTDEHAIGKAFTESL
NHAB_CITK8      TRQDKLNLFVQAIIGVWLVTALALHLAEVGLIGLSVIILATSLTGVTDEHAIGKAFTESL
NHAB_KLEP7      SRQERLRLIAQALIGVWLIVALAFHLAEVGLIGLSVIILATTFTGVTDEHAIGKAFTEAL
NHAB_CROS8      TRQDTMKLIIQGLIGVWLITALALHLAEVGLIGLSVIILASSLCGVTDEHAIGKAFTEAL
NHAB_ENT38      TRQEKLALIAQGIIGAWLIFALAFHLAEVGLIGLSVIILATSFTGVTDEHAIGKAFTEAL
NHAB_SERP5      SKQEQVRLVVQALIGIWLVVALAFHLAEVGLIGLSVIILATSLCGVTDEHAIGKAFQEAL
NHAB_YERPE      TKQEKMKLIVQAIIGVWLVLALALHLAEVGLVGLSVIILATSFCGITNEHSLGKAFQEAL
NHAB_YERPA      TKQEKMKLIVQAIIGVWLVLALALHLAEVGLVGLSVIILATSFCGITNEHSLGKAFQEAL
NHAB_YERPN      TKQEKMKLIVQAIIGVWLVLALALHLAEVGLVGLSVIILATSFCGITNEHSLGKAFQEAL
NHAB_YERPP      TKQEKMKLIVQAIIGVWLVLALALHLAEVGLVGLSVIILATSFCGITNEHSLGKAFQEAL
NHAB_YERPS      TKQEKMKLIVQAIIGVWLVLALALHLAEVGLVGLSVIILATSFCGITNEHSLGKAFQEAL
NHAB_YERP3      TKQEKMKLIVQAIIGVWLVLALALHLAEVGLVGLSVIILATSFCGITNEHSLGKAFQEAL
NHAB_YERE8      NRQEKVKLLVQALIGVWLVIALALHLAEVGLVGLSVIILATSFCGITNEHALGKAFQEAL
NHAB_PHOLL      THKEKAQLIAQALIGIWLIVALAFHLAEVGLIGLSVIILTTSFCGITEEHALGKAFEEAL
NHAB_PECAS      TQQDKVRLLVQAVIGVWLIIALAFHLAEVGLIGLSVIIMATTFCGVTEEHAIGKAFQDAM
NHAB_SHEB5      TNKDNMKLIVQALVGVWLIAGLALHLASVGLIGLSVIILTTAFNGVTDEHALGKAFEEAL
NHAB_SHEB8      TNKDNMKLIVQALVGVWLIAGLALHLASVGLIGLSVIILTTAFNGVTDEHALGKAFEEAL
NHAB_SHEB9      TNKDNMKLIVQALVGVWLIAGLALHLASVGLIGLSVIILTTAFNGVTDEHALGKAFEEAL
NHAB_SHEPC      TNKDKMKLVIQVLVGVWLIAGLALHLASVGLVGLSVIILTTAFNGITDEHALGKAFEEAL
NHAB_SHESW      TNKDKMKLVIQVLVGVWLIAGLALHLASVGLVGLSVIILTTAFNGITDEHALGKAFEEAL
NHAB_SHESM      TNKDKMKLVIQAFVGVWLIAGLALHLASVGLIGLSVIILTTAFNGITDEHALGKAFEEAL
NHAB_SHESR      TNKDKMKLVIQAFVGVWLIAGLALHLASVGLIGLSVIILTTAFNGITDEHALGKAFEEAL
NHAB_SHESA      TNKDKMKLVIQAFVGVWLIAGLALHLASVGLIGLSVIILTTAFNGITDEHALGKAFEEAL
NHAB_SHEON      TNKDKMKLIVQAFIGVWLIAGLALHLASVGLIGLSVIILATAFNGITDEHALGKAFEEAL
NHAB_SHEAM      TPKDKVKLIVQALVGVWLIVGLAFHLASVGLIGLSVIILNTAFNGITDEHALGKAFEEAL
NHAB_SHEHH      TKHDKVKLLVQAFIGVWLIAGLALHLASVGLIGLSVIILATAFNGITNEHALGKAFEEAL
NHAB_SHEPA      TKHDKVKLLIQAVIGVWLIAGLALHLASVGLIGLSVIILATAFNGITNEHALGKAFEEAL
NHAB_SHELP      TKHDKIKLVIQAFVGVWLIVGLAFHLASVGLIGLSVIILTTAFNGVTNEHALGKAFEEAL
NHAB_SHESH      TKHDKVKLGIQALIGLWLVVGLAFHLASVGLIGLSVIIMATAFNGITNEHAIGKAFEEAL
NHAB_SHEFN      TNQDKMKLVVQALIGVWLIAGLALHLASVGLIGLSVIILATAFNGITDEHSLGKAFEEAL
NHAB_SHEDO      SDRDKVKLIIQALVGVWLVAGLALHLASVGLIGLSVIILTTAFNGITDEHSLGKAFEEAL
NHAB_PSEA6      TKQDSAKLWIQGFIGIWLVIGLAGHFAAVGLIGLSIIVLATSMNGIIDEHSIGKAFEEAL
NHAB_PSEAE      GAQQKAALLVQALAALVLIVGLALHVAEVGLIGLLVIVLITAFTGVTDEHQIGRAFQEAL
NHAB_PSEAB      GAQQKAALLVQALAALVLIVGLALHVAEVGLIGLLVIVLITAFTGVTDEHQIGRAFQEAL
NHAB_PSEA7      GPQQKAALLVQALAALVLMIGLALHVAEVGLIGLLVIVLITAFTGITDEHQIGRAFQEAL
NHAB_PSEP1      TQAQRIALWVQGLAALILIICLGLHVAEVGLIGLMVIVLITAFTGITDEHRLGRAFQDAM
NHAB_PSEPG      TQAQRIALWVQGLAALILIICLGLHVAEVGLIGLMVIVLITAFTGITDEHRLGRAFQDAM
NHAB_PSEPK      TQAQRIALWVQGLAALILIICLGLHVAEVGLIGLMVIVLITAFTGITDEHRLGRAFQDAM
NHAB_PSEE4      TQAQRIALVVQGLAALILIVCLGLHIAEVGLIGLMVIVLITAFTGITDEHRLGRAFQDAM
NHAB_PSEF5      TSRQRAALLVQGLAALILIVALALHVAEVGLIGLLVIVLITAFTGITDEHRLGNAFKDAM
NHAB_PSEPF      TPRQRAALLVQGCAALILIAGLAFHIAEVGLIGLMVIVLITAFTGITDEHRLGSAFKDAM
NHAB_MARHV      TKSDQAALWIQAVAAVILVFGLAFHIAEVGLIGLLVIILITSFTGVTDEHQIGKAFQESL
NHAB_MARMS      TNKHKAKLIIQGIVAIILILSLAFHIAEVGLVGLMVIVLLTAFNGITDEHQIGHAFEEAL
NHAB_SACD2      GFGDKAQLLVQAVVAVVLVFALALHLAEVGLIGLLIIVLLTAFNGITDEHRIGHAFEEAL
NHAB_HAHCH      TLQHESKLITQAIVALILVVALALHLAEVGLIGLTVIILATAFCGVIEEHQIGKAFEEAL
NHAB_ALCBS      TPQNRAALVIQAITAVWLVIGLATHAASVGLVGLTVIILATSFTGIIEEHRLGAAFEEAL
                   .   :  *   .  *:  *. * * **::** :*:: ::  *: .*  :* :* :.:

NHAB_AERHH      PFTALLAVFFSVVAVIIDQQLFKPVIQWVLAAEPD-AQLALFYLANGLLSMVSDNVFVGT
NHAB_AERS4      PFTALLAVFFSVVAVIIDQQLFRPVIQWVLAAEPD-DQLALFYLANGLLSMVSDNVFVGT
NHAB_VIBAL      PFTALLAVFFSIVAVIIDQELFKPVIDAVLAVEDKGTQLALFYVANGLLSMVSDNVFVGT
NHAB_VIBPA      PFTALLAVFFSIVAVIIDQELFKPVIDAVLAVEDKGTQLALFYVANGLLSMVSDNVFVGT
NHAB_VIBCB      PFTALLAVFFAVVAVIIDQELFKPVIDAVLAVEDKSTQLALFYVANGLLSMVSDNVFVGT
NHAB_VIBVU      PFTALLAVFFSIVAVIIDQELFKPVIDAVLAVEDKGTQLAMFYVANGLLSMVSDNVFVGT
NHAB_VIBVY      PFTALLAVFFSIVAVIIDQELFKPVIDAVLAVEDKGTQLAMFYVANGLLSMVSDNVFVGT
NHAB_VIBCH      PFTALLAVFFSIVAVIIDQELFKPVIDAVLNVEDHGTQLALFYVANGLLSMVSDNVFVGT
NHAB_VIBC3      PFTALLAVFFSIVAVIIDQELFKPVIDAVLNVEDHGTQLALFYVANGLLSMVSDNVFVGT
NHAB_ALIF1      PFTALLAVFFAVVAVIIDQELFKPIIDAVLAVEDKGAQLALFYVANGLLSMVSDNVFVGT
NHAB_PHOPR      PFTALLAVFFSIVAVIIDQHLFTPIISWVLTLNGN-AQMTMFYIANGLLSMVSDNVFVGT
NHAB_HAEIN      PFTALLVVFFSVVAVIIDQKLFSPIIHFVLSAEEN-TQLALFYLFNGLLSSISDNVFVAT
NHAB_HAEI8      PFTALLVVFFSVVAVIIDQKLFSPIIHFVLSAEEN-TQLALFYLFNGLLSSISDNVFVAT
NHAB_ACTP2      PFTALIVVFFTVVAVIVDLKLFEPIISYVLSADPH-SQLALFYVFNGLLSMISDNVFVGT
NHAB_ACTPJ      PFTALIVVFFTVVAVIVDLKLFEPIISYVLSADPH-SQLALFYVFNGLLSMISDNVFVGT
NHAB_HAEDU      PFTALIVVFFTIVAVIVDLKLFEPIINFVLSADPH-SQLALFYVFNGLLSMISDNVFVGT
NHAB_MANSM      PFCALLVVFFSVVAVIIDQHLFGPIINYVLSASES-TQLLLFYGFNGLLSAISDNVFVAT
NHAB_PASMU      PFTALLVVFFSVVAVIIDQHLFAPIIQFVLAASEH-TQLALFYIFNGLLSAISDNVFVAT
NHAB_ACTSZ      PFLSLLVVFFSVVAVIIDQHLFAPVIELVLNASES-VQLLLFYIFNGVLSAISDNVFVAT
NHAB_ECOLI      PFTALLTVFFSVVAVIIDQQLFSPIIQFVLQASEH-AQLSLFYIFNGLLSSISDNVFVGT
NHAB_ECO57      PFTALLTVFFSVVAVIIDQQLFSPIIQFVLQASEH-AQLSLFYIFNGLLSSISDNVFVGT
NHAB_SHIBS      PFTALLTVFFSVVAVIIDQQLFSPIIQFVLQASEH-AQLSLFYIFNGLLSSISDNVFVGT
NHAB_SHIDS      PFTALLTVFFSVVAVIIDQQLFSPIIQFVLQASEH-AQLSLFYIFNGLLSSISDNVFVGT
NHAB_ECO24      PFTALLTVFFSVVAVIIDQQLFSPIIQFVLQASEH-AQLSLFYIFNGLLSSISDNVFVGT
NHAB_ECOHS      PFTALLTVFFSVVAVIIDQQLFSPIIQFVLQASEH-AQLSLFYIFNGLLSSISDNVFVGT
NHAB_SHISS      PFTALLTVFFSVVAVIIDQQLFSPIIQFVLQASEH-AQLSLFYIFNGLLSSISDNVFVGT
NHAB_SHIFL      PFTALLTVFFSVVAVIIDQQLFSPIIQFVLQASEH-AQLSLFYIFNGLLSSISDNVFVGT
NHAB_SHIF8      PFTALLTVFFSVVAVIIDQQLFSPIIQFVLQASEH-AQLSLFYIFNGLLSSISDNVFVGT
NHAB_ECOUT      PFTALLTVFFSVVAVIIDQQLFSPIIQFVLQASEH-AQLSLFYIFNGLLSSISDNVFVGT
NHAB_ECOK1      PFTALLTVFFSVVAVIIDQQLFSPIIQFVLQASEH-AQLSLFYIFNGLLSSISDNVFVGT
NHAB_ECOL6      PFTALLTVFFSVVAVIIDQQLFSPIIQFVLQASEH-AQLSLFYIFNGLLSSISDNVFVGT
NHAB_ECOL5      PFTALLTVFFSVVAVIIDQQLFSPIIQFVLQASEH-AQLSLFYIFNGLLSSISDNVFVGT
NHAB_SALPA      PFTALLTVFFSIVAVIIDQHLFAPIIQFVLQASEH-AQLTLFYLFNGLLSSISDNVFVGT
NHAB_SALTI      PFTALLTVFFSIVAVIIDQHLFAPIIQFVLQASEH-AQLTLFYLFNGLLSSISDNVFVGT
NHAB_SALCH      PFTALLTVFFSIVAVIIDQHLFAPIIQFVLQASEH-AQLTLFYLFNGLLSSISDNVFVGT
NHAB_SALPB      PFTALLTVFFSIVAVIIDQHLFAPIIQFVLQASEH-AQLTLFYLFNGLLSSISDNVFVGT
NHAB_SALTY      PFTALLTVFFSIVAVIIDQHLFAPIIQFVLQASEH-AQLTLFYLFNGLLSSISDNVFVGT
NHAB_SALAR      PFTALLTVFFSIVAVIIDQHLFAPIIQFVLQASEH-AQLTLFYLFNGLLSSISDNVFVGT
NHAB_CITK8      PFTALLTVFFSIVAVIIDQHLFAPIIQFVLQASEH-AQLTLFYLFNGLLSSISDNVFVGT
NHAB_KLEP7      PFTALLTVFFSIVAVIIDQQLFTPVIEFVLQASPH-AQLSLFYLFNGLLSSISDNVFVGT
NHAB_CROS8      PFTALLTVFFAVVAVIIDQHLFAPIIAYVLEASPH-NQLSLFYLFNGLLSSISDNVFVGT
NHAB_ENT38      PFTALLAVFFAIVAVIIDQQLFTPIIHFVLQASPD-SQLSLFYLFNGLLSSISDNVFVGS
NHAB_SERP5      PFTALLTVFFTVVAVIIEQHLFTPIIHFVLQAQPS-SQLALFYLFNGLLSSVSDNVFVGT
NHAB_YERPE      PFTALLTVFFAVVAVIIEQSLFTPIIQFVLQASPS-AQLSLFYLFNGLLSSVSDNVFVGT
NHAB_YERPA      PFTALLTVFFAVVAVIIEQSLFTPIIQFVLQASPS-AQLSLFYLFNGLLSSVSDNVFVGT
NHAB_YERPN      PFTALLTVFFAVVAVIIEQSLFTPIIQFVLQASPS-AQLSLFYLFNGLLSSVSDNVFVGT
NHAB_YERPP      PFTALLTVFFAVVAVIIEQSLFTPIIQFVLQASPS-AQLSLFYLFNGLLSSVSDNVFVGT
NHAB_YERPS      PFTALLTVFFAVVAVIIEQSLFTPIIQFVLQASPS-AQLSLFYLFNGLLSSVSDNVFVGT
NHAB_YERP3      PFTALLTVFFAVVAVIIEQSLFTPIIQFVLQASPS-AQLSLFYLFNGLLSSVSDNVFVGT
NHAB_YERE8      PFTALLTVFFAVVAVIIEQSLFTPIIQFVLQSSPS-AQLSLFYLFNGLLSSVSDNVFVGT
NHAB_PHOLL      PFTALLTVFFSIVAVIVDQQLFTPFIQFVLQVSET-SQLSLFYLFNGLLSSVSDNVFVGT
NHAB_PECAS      PFTALLTVFFAIVAVIIDQQLFSPIIHYVLQSSDS-AQLTQFYLFNGLLSSISDNVFVGS
NHAB_SHEB5      PFTALLAVFFAVVGVIIDQHLFAPVIQWALGYEGN-TQLVIFYIANGLLSMVSDNVFVGT
NHAB_SHEB8      PFTALLAVFFAVVGVIIDQHLFAPVIQWALGYEGN-TQLVIFYIANGLLSMVSDNVFVGT
NHAB_SHEB9      PFTALLAVFFAVVGVIIDQHLFAPVIQWALGYEGN-TQLVIFYIANGLLSMVSDNVFVGT
NHAB_SHEPC      PFTALLAVFFAVVAVIIDQHLFAPVIQWALSYEGN-TQLVIFYIANGLLSMVSDNVFVGT
NHAB_SHESW      PFTALLAVFFAVVAVIIDQHLFAPVIQWALSYEGN-TQLVIFYIANGLLSMVSDNVFVGT
NHAB_SHESM      PFTALLAVFFAVVAVIIDQQLFGPVIQWALNHEGN-TQLVIFYIANGLLSMVSDNVFVGT
NHAB_SHESR      PFTALLAVFFAVVAVIIDQQLFGPVIQWALNHEGN-TQLVIFYIANGLLSMVSDNVFVGT
NHAB_SHESA      PFTALLAVFFAVVAVIIDQQLFGPVIQWALNHEGN-TQLVIFYIANGLLSMVSDNVFVGT
NHAB_SHEON      PFTALLAVFFSVVAVIIDQQLFAPVIQWALNHEGN-TQLVIFYIANGLLSMVSDNVFVGT
NHAB_SHEAM      PFTALLAVFFAVVGVIIDQQLFAPVIQWALSYEGN-VQLVIFYIANGLLSMVSDNVFVGT
NHAB_SHEHH      PFTALLAVFFAIVAVIIDLQLFAPVIQWALSYEGN-TQLVVFYIANGLLSMVSDNVFVGT
NHAB_SHEPA      PFTALLAVFFAIVAVIIDQQLFAPVIQWALSYEGN-TQLVIFYIANGLLSMVSDNVFVGT
NHAB_SHELP      PFTALLAVFFAIVGVIIDQQLFAPVIQWALSYEGN-TQLVIFYIANGLLSMVSDNVFVGT
NHAB_SHESH      PFTALLAVFFAIVAVIIDQQLFAPVIQWALSYEGN-TQLVIFYIANGLLSMVSDNVFVGT
NHAB_SHEFN      PFTALLAVFFAIVGVIIDQELFAPVIQWALGYEGN-MQLVIFYIANGLLSMVSDNVFVGT
NHAB_SHEDO      PFTALLAVFFAIVGVIIDQRLFAPVIQWALTFEGN-AQLVVFFIANGVLSMVSDNVFVGT
NHAB_PSEA6      PFTALLCVFFGVVAVIIDQGLFTPVIDWVLTFEGR-SQLVMFYLANGALSMVSDNVFVGS
NHAB_PSEAE      PFTALLVVFFAVVAVIHQQHLFTPIIQAVLALPAE-RQPGMLFIANGLLSAISDNVFVAT
NHAB_PSEAB      PFTALLVVFFAVVAVIHQQHLFTPIIQAVLALPAE-RQPGMLFIANGLLSAISDNVFVAT
NHAB_PSEA7      PFTALLVAFFAVVAVIHQQHLFTPIIQAVLALPAE-RQPGMLFIANGLLSAISDNVFVAT
NHAB_PSEP1      PFTSLLVVFFAVVAVIHQQQLFSPLISWVLTLPAE-QQPGMLYLANGLLSAISDNVFVAT
NHAB_PSEPG      PFTSLLVVFFAVVAVIHQQQLFSPLISWVLTLPTE-QQPGMLYLANGLLSAISDNVFVAT
NHAB_PSEPK      PFTSLLVVFFAVVAVIHQQQLFSPLINWVLALPAE-QQPGMLYLANGLLSAISDNVFVAT
NHAB_PSEE4      PFTALLVVFFAVVAVIHQQQLFSPLIAWVLALPSE-QQPGMLYLANGLLSAISDNVFVAT
NHAB_PSEF5      PFTALLVVFFAVVAVIHQQQLFTPLIQWVLALPAD-QQPGMLFIANGLLSAISDNVFVAT
NHAB_PSEPF      PFTALLVVFFAVVAVIHDQQLFAPLIQWVLALPAD-QQPGMLFIANGLLSAISDNVFVAT
NHAB_MARHV      PFTSLLVVFFAVVAVIHEQHLFKPIIDYVLALPEG-QQPGMFFIANGLLSMISDNVFVAT
NHAB_MARMS      PFTALLVVFFTIVSVIHEQHLFQPIIDIVLHMPTD-SQPIMFFIANGILSAISDNVFVAT
NHAB_SACD2      PFTALLVVFFAVVAVIHDQHLFTPVIDYVLAMEQG-AQAPMFFVANGVLSMISDNVFVAT
NHAB_HAHCH      PFTSLLVVFFAVVGVIHEQHLFTGIINYVLGLEKS-VQPGMFFIANGVLSMISDNVFVAT
NHAB_ALCBS      PFTALLTVFFAVVAVIADQQLFAPVIEYVLSLEKQ-VQGPAFYMANGILSAVSDNVFVAT
                ** :*: .** :*.** :  **  .*  .*       *   ::  ** ** :******.:

NHAB_AERHH      VYINEVKTALLNNAISREQFELLAVAINTGTNLPSVATPNGQAAFLFMLTSALAPLLRLS
NHAB_AERS4      VYINEVKTALLNNAINREQFDLLAVAINTGTNLPSVATPNGQAAFLFMLTSALAPLLRLS
NHAB_VIBAL      VYINEVKTALIEGLITREQFDLLAVAINTGTNLPSVATPNGQAAFLFLLTSALAPLIRLS
NHAB_VIBPA      VYINEVKSALMEGLITREQFDLLAVAINTGTNLPSVATPNGQAAFLFLLTSALAPLIRLS
NHAB_VIBCB      VYINEVKAALIDGQITREQFDLLAVAINTGTNLPSVATPNGQAAFLFLLTSALAPLIRLS
NHAB_VIBVU      VYINEVKTALVEGIITRDQFDLLAVAINTGTNLPSVATPNGQAAFLFLLTSALAPLIRLS
NHAB_VIBVY      VYINEVKTALVEGIITRDQFDLLAVAINTGTNLPSVATPNGQAAFLFLLTSALAPLIRLS
NHAB_VIBCH      VYITEVKTALMEGMISRDQFDLLAVAINTGTNLPSVATPNGQAAFLFLLTSALAPLIRLS
NHAB_VIBC3      VYITEVKTALMEGMISRDQFDLLAVAINTGTNLPSVATPNGQAAFLFLLTSALAPLIRLS
NHAB_ALIF1      VYINEVKAALMDGVITRDQFDLLAVAINTGTNLPSVATPNGQAAFLFLLTSALAPLIQLS
NHAB_PHOPR      VYINEVKAALVNGVITRDQFDMLAVAINTGTNLPSVATPNGQAAFLFVLTSALAPLIRLS
NHAB_HAEIN      VYINEAKAALTNGVIAPHQFELLSVAINTGTNLPSVATPNGQAAFLFLLTSSISPLIRLS
NHAB_HAEI8      VYINEAKAALTNGVIAPHQFELLSVAINTGTNLPSVATPNGQAAFLFLLTSSISPLIRLS
NHAB_ACTP2      VYINEAKTALESAIISREQFDLIAVAINTGTNLPSVATPNGQAAFLFLLTSPFAPLIRLS
NHAB_ACTPJ      VYINEAKTALESAIISREQFDLIAVAINTGTNLPSVATPNGQAAFLFLLTSPFAPLIRLS
NHAB_HAEDU      VYMNETKAALTSGFISREQFDLIAVAINTGTNLPSVATPNGQAAFLFLLTSPFAPLIRLS
NHAB_MANSM      VYINEAKNALHAGIISLEQFELLAVAINTGTNLPSVATPNGQAAFLFLLTSSLAPLIRLS
NHAB_PASMU      VYINETKAALEAGLIAQPQYELLAVAINTGTNLPSVATPNGQAAFLFLLTSSLAPLIRLS
NHAB_ACTSZ      VYINEAKNALTAGAISPYQFEMISVAINTGTNLPSVATPNGQAAFLFLLTSSISPLIRLS
NHAB_ECOLI      IYINEAKAAMESGAITLKQYELLAVAINTGTNLPSVATPNGQAAFLFLLTSALAPLIRLS
NHAB_ECO57      IYINEAKAAMESGAITLKQYELLAVAINTGTNLPSVATPNGQAAFLFLLTSALAPLIRLS
NHAB_SHIBS      IYINEAKAAMESGAITLKQYELLAVAINTGTNLPSVATPNGQAAFLFLLTSALAPLIRLS
NHAB_SHIDS      IYINEAKAAMESGAITLKQYELLAVAINTGTNLPSVATPNGQAAFLFLLTSALAPLIRLS
NHAB_ECO24      IYINEAKAAMESGAITLKQYELLAVAINTGTNLPSVATPNGQAAFLFLLTSALAPLIRLS
NHAB_ECOHS      IYINEAKAAMESGAITLKQYELLAVAINTGTNLPSVATPNGQAAFLFLLTSALAPLIRLS
NHAB_SHISS      IYINEAKAAMESGAITLKQYELLAVAINTGTNLPSVATPNGQAAFLFLLTSALAPLIRLS
NHAB_SHIFL      IYINEAKAAMESGAITLKQYELLAVAINTGTNLPSVATPNGQAAFLFLLTSALAPLIRLS
NHAB_SHIF8      IYINEAKAAMESGAITLKQYELLAVAINTGTNLPSVATPNGQAAFLFLLTSALAPLIRLS
NHAB_ECOUT      IYINEAKAAMKSGAITLKQYELLAVAINTGTNLPSVATPNGQAAFLFLLTSALAPLIRLS
NHAB_ECOK1      IYINEAKAAMKSGAITLKQYELLAVAINTGTNLPSVATPNGQAAFLFLLTSALAPLIRLS
NHAB_ECOL6      IYINEAKAAMESGAITLKQYELLAVAINTGTNLPSVATPNGQAAFLFLLTSALAPLIRLS
NHAB_ECOL5      IYINEAKAAMESGAITLKQYELLAVAINTGTNLPSVATPNGQAAFLFLLTSALAPLIRLS
NHAB_SALPA      IYINEAKAAMENGAISLKQFELLAVAINTGTNLPSVATPNGQAAFLFLLTSALAPLIRLS
NHAB_SALTI      IYINEAKAAMENGAISLKQFELLAVAINTGTNLPSVATPNGQAAFLFLLTSALAPLIRLS
NHAB_SALCH      IYINEAKAAMENGAISLKQFELLAVAINTGTNLPSVATPNGQAAFLFLLTSALAPLIRLS
NHAB_SALPB      IYINEAKAAMENGAISLKQFELLAVAINTGTNLPSVATPNGQAAFLFLLTSALAPLIRLS
NHAB_SALTY      IYINEAKAAMENGAISLKQFELLAVAINTGTNLPSVATPNGQAAFLFLLTSALAPLIRLS
NHAB_SALAR      IYINEAKAAMENGAISLKQFELLAVAINTGTNLPSVATPNGQAAFLFLLTSALAPLIRLS
NHAB_CITK8      IYINEAKAAMESGAISMKQYELLAVAINTGTNLPSVATPNGQAAFLFLLTSALAPLIRLS
NHAB_KLEP7      VYINEAKAALEHGAISLPQFEMLAVAINTGTNLPSVATPNGQAAFLFLLTSALAPLIRLS
NHAB_CROS8      VYINEAKSALQQGVIDAKQFEMLAVAINTGTNLPSVATPNGQAAFLFLLTSALAPLIRLS
NHAB_ENT38      VYINEAKTALESGAIGINQFELLAVAINTGTNLPSVATPNGQAAFLFLLTSALAPLIRLS
NHAB_SERP5      VYINEARAAFENGVISLKQFEMLAVAINTGTNLPSVATPNGQAAFLFLLTSALAPLVRLS
NHAB_YERPE      VYINEARSAFEHGIVSLQQFELLAVAINTGTNLPSVATPNGQAAFLFLLTSALAPLIRLS
NHAB_YERPA      VYINEARSAFEHGIVSLQQFELLAVAINTGTNLPSVATPNGQAAFLFLLTSALAPLIRLS
NHAB_YERPN      VYINEARSAFEHGIVSLQQFELLAVAINTGTNLPSVATPNGQAAFLFLLTSALAPLIRLS
NHAB_YERPP      VYINEARSAFEHGIVSLQQFELLAVAINTGTNLPSVATPNGQAAFLFLLTSALAPLIRLS
NHAB_YERPS      VYINEARSAFEHGIVSLQQFELLAVAINTGTNLPSVATPNGQAAFLFLLTSALAPLIRLS
NHAB_YERP3      VYINEARSAFEHGIVSLQQFELLAVAINTGTNLPSVATPNGQAAFLFLLTSALAPLIRLS
NHAB_YERE8      VYINEARKAFELGVISLQQFELLAVAINTGTNLPSVATPNGQAAFLFLLTSALAPLIRLS
NHAB_PHOLL      VYINEARTAMQEGLISHKQFEYLAVAINTGTNLPSVATPNGQAAFLFLLTSTLSPLIRLS
NHAB_PECAS      VYINEARNAFESGKISLPQFELLAVAINTGTNLPSVATPNGQAAFLFLLTSSLAPLIRLS
NHAB_SHEB5      VYINEVKAALINGQITRDQFDLLAVAINTGTNLPSVATPNGQAAFLFLLTSALAPLIRLS
NHAB_SHEB8      VYINEVKAALINGQITRDQFDLLAVAINTGTNLPSVATPNGQAAFLFLLTSALAPLIRLS
NHAB_SHEB9      VYINEVKAALINGQITRDQFDLLAVAINTGTNLPSVATPNGQAAFLFLLTSALAPLIRLS
NHAB_SHEPC      VYINEVKAALIDGQITRDQFDLLAVAINTGTNLPSVATPNGQAAFLFLLTSALAPLIRLS
NHAB_SHESW      VYINEVKAALIDGQITRDQFDLLAVAINTGTNLPSVATPNGQAAFLFLLTSALAPLIRLS
NHAB_SHESM      VYINEVKAALINGQITRDQFDLLAVAINTGTNLPSVATPNGQAAFLFLLTSALAPLIRLS
NHAB_SHESR      VYINEVKAALINGQITRDQFDLLAVAINTGTNLPSVATPNGQAAFLFLLTSALAPLIRLS
NHAB_SHESA      VYINEVKAALINGQITRDQFDLLAVAINTGTNLPSVATPNGQAAFLFLLTSALAPLIRLS
NHAB_SHEON      VYINEVKAALLNGQITRDQFDLLAVAINTGTNLPSVATPNGQAAFLFLLTSALAPLIRLS
NHAB_SHEAM      VYINEVKAALLNGQITRDQFDLLAVAINTGTNLPSVATPNGQAAFLFLLTSALAPLIRLS
NHAB_SHEHH      VYINEVKAALLNGQITRDQFDLLAVAINTGTNLPSVATPNGQAAFLFLLTSAIAPLIRLS
NHAB_SHEPA      VYINEVKSALLNGQITRDQFDLLAVAINTGTNLPSVATPNGQAAFLFLLTSAIAPLIRLS
NHAB_SHELP      VYINEVKAALLDGQITRDQFDLLAVAINTGTNLPSVATPNGQAAFLFLLTSAIAPLIRLS
NHAB_SHESH      VYINEVKAALLSGQITRDQFDLLAVAINTGTNLPSVATPNGQAAFLFLLTSAIAPLIRLS
NHAB_SHEFN      VYINEVKAALMSGQITRDQFDLLAVAINTGTNLPSVATPNGQAAFLFLLTSAIAPLIRLS
NHAB_SHEDO      VYINEVKSALLSGQITRDQFDLLAVAINTGTNLPSVATPNGQAAFLFLLTSALAPLIRLS
NHAB_PSEA6      VYITEVAAALEHGHITRDEFDMLAVAINTGTNLPSVATPNGQAAFLFLLTSAIAPLLRLS
NHAB_PSEAE      IYITEVKQALDAGHMSREHFDTLAVAINTGTNLPSVATPNGQAAFLFLLTSSIAPLVRLS
NHAB_PSEAB      IYITEVKQALDAGHMSREHFDTLAVAINTGTNLPSVATPNGQAAFLFLLTSSIAPLVRLS
NHAB_PSEA7      IYITEVKQALDAGHMTREHFDTLAVAINTGTNLPSVATPNGQAAFLFLLTSSIAPLVRLS
NHAB_PSEP1      IYITEVKQAFLNGSMSREHFETLAVAINTGTNLPSVATPNGQAAFLFLLTSAIAPLIRLS
NHAB_PSEPG      IYITEVKQAFLNGGMSREHFETLAVAINTGTNLPSVATPNGQAAFLFLLTSAIAPLIRLS
NHAB_PSEPK      IYITEVKQAFLDGSMSREHFETLAVAINTGTNLPSVATPNGQAAFLFLLTSAIAPLIRLS
NHAB_PSEE4      IYITEVKQAFVNGAMSREHFETLAVAINTGTNLPSVATPNGQAAFLFLLTSAIAPLIRLS
NHAB_PSEF5      IYITEVKQAFISGQMSREHFETLAIAINTGTNLPSVATPNGQAAFLFLLTSAIAPLVRLS
NHAB_PSEPF      IYITEVKQAFLSGHMSREHFETLAIAINTGTNLPSVATPNGQAAFLFLLTSAIAPLVRLS
NHAB_MARHV      VYISEVKQALDAGSISYEHFQTLAVAINTGTNLPSVATPNGQAAFLFLLTSAIAPLVRLS
NHAB_MARMS      VYISEVKAALDAGTITREHFNTLAVAINTGTNLPSVATPNGQAAFLFLLTSAIAPLLRLS
NHAB_SACD2      VYINEVKAAFDAGTISREHFDVLAVAINAGTNLPSVATPNGQAAFLFLLTSALAPLIRLS
NHAB_HAHCH      VYIDEVRTAFNDGLIDRAHYEALAVAINTGTNLPSVATPNGQAAFLFLLTSAIAPLIRLS
NHAB_ALCBS      VYVDEVGQALLKNEIDRDTFDLLAVAINTGTNIPSVATPNGQAAFLFLLTSALAPLVRLS
                :*: *.  *:    :    :: :::***:***:**************:***.::**::**

NHAB_AERHH      YGRMVWMALPYTLVLGLVGFFSVEML-LGPLTDWFYQAGWLVLDNV---APAALPVLH
NHAB_AERS4      YGRMVWMALPYTLVLGLVGFFSVELL-LGPATEWFYQAGWLLPHSG---APAVLPALH
NHAB_VIBAL      YGRMVIMALPYTIVLAIVGLMGIMFF-LEPATASFYDAGWILPHSG--DLTPVVSGGH
NHAB_VIBPA      YGRMVVMALPYTVVLAIVGLMGIMFF-LEPATASFYDAGWIAPHTG--DLTPVVSGGH
NHAB_VIBCB      YGRMVIMALPYTIVLAIVGLMGIMFF-LEPATAFFYDAGWISPSSG--DLAPVVSGGH
NHAB_VIBVU      YGKMVIMALPYTIVLALVGLFGIVFL-LEPMTAWFYDAGWIAHHVG--EATHAVSGGH
NHAB_VIBVY      YGKMVIMALPYTIVLALVGLFGIVFL-LEPMTTWFYDAGWIAHHVG--EATHAVSGGH
NHAB_VIBCH      YGRMVIMAFPYTLALSLVGFIGIMFL-LEPMTEVFYSLGWISHHVAP-AADALLQSGH
NHAB_VIBC3      YGRMVIMAFPYTLALSLVGFIGIMFL-LEPMTEVFYSLGWISHHVAP-AADALLQSGH
NHAB_ALIF1      YGRMVWMALPYTIVLALVGMFGIIFF-LEPMTAMFYDLGWIAPGTIE-SATSAISSGH
NHAB_PHOPR      YGRMVYMALPYTIVLALVGLAGIEFM-LLPMTEWFYDMGWLVHNTSEVMSTIAPAAGH
NHAB_HAEIN      YGRMVYMALPYTIVLSIIGLLAIEFI-LPAATIWLASLGLILPI--------------
NHAB_HAEI8      YGRMVYMALPYTIVLSIIGLLAIEFI-LPAATIWLASLGLILPI--------------
NHAB_ACTP2      YGKMLYMALPYTIVLSIIGFLSLEFL-LPPLTELMSNWGWIITR--------------
NHAB_ACTPJ      YGKMLYMALPYTIVLSIIGFLSLEFL-LPPLTELMSNWGWIITR--------------
NHAB_HAEDU      YSRMIYMALPYTIVLSIVGFFALEYL-LPPLTELMTNWGWLIAR--------------
NHAB_MANSM      YGKMVYMALPYTIVLTVVGLLAVEYI-LPGATKYFSSLGWITALPV------------
NHAB_PASMU      YGRMVYMALPYTIVLSCIGLLAVEYI-LPGATNVLIQIGLLKPM--------------
NHAB_ACTSZ      YGRMVYMALPYTIVLSIVGLLAVEYV-LPGMTQWLAQVGLIESPHIPMTSVFGH----
NHAB_ECOLI      YGRMVWMALPYTLVLTLVGLLCVEFT-LAPVTEWFMQMGWIATL--------------
NHAB_ECO57      YGRMVWMALPYTLVLTLVGLLCVEFT-LAPVTEWFMQMGWIATL--------------
NHAB_SHIBS      YGRMVWMALPYTLVLTLVGLLCVEFT-LAPVTEWFMQMGWIATL--------------
NHAB_SHIDS      YGRMVWMALPYTLVLTLVGLLCVEFT-LAPVTEWFMQMGWIATL--------------
NHAB_ECO24      YGRMVWMALPYTLVLTLVGLLCVEFT-LAPVTEWFMQMGWIATL--------------
NHAB_ECOHS      YGRMVWMALPYTLVLTLVGLLCVEFT-LAPVTEWFMQMGWIATL--------------
NHAB_SHISS      YGRMVWMALPYTLVLTLVGLLCVEFT-LAPVTEWFMQMGWIATL--------------
NHAB_SHIFL      YGRMVWMALPYTLVLTLVGLLCVEFT-LAPVTEWFMQMGWIATL--------------
NHAB_SHIF8      YGRMVWMALPYTLVLTLVGLLCVEFT-LAPVTEWFMQMGWIATL--------------
NHAB_ECOUT      YGRMVWMALPYTLVLTLVGLLCVEFT-LAPVTEWFMQMGWIATL--------------
NHAB_ECOK1      YGRMVWMALPYTLVLTLVGLLCVEFT-LAPVTEWFMQMGWIATL--------------
NHAB_ECOL6      YGRMVWMALPYTLVLTLVGLLCVEFT-LAPVTEWFMQMGWIATL--------------
NHAB_ECOL5      YGRMVWMALPYTLVLTLVGLLCVEFT-LAPVTEWFMQMGWIATL--------------
NHAB_SALPA      YGRMVWMALPYTIVLTLIGLLCVEFA-LAPATEWMTQAGWLATLS-------------
NHAB_SALTI      YGRMVWMALPYTIVLTLIGLLCVEFT-LAPATEWMTQAGWLATLS-------------
NHAB_SALCH      YGRMVWMALPYTIVLTLIGLLCVEFT-LAPATEWMTQAGWLATLS-------------
NHAB_SALPB      YGRMVWMALPYTIVLTLIGLLCVEFT-LAPATEWMTQAGWLATLS-------------
NHAB_SALTY      YGRMVWMALPYTIVLTLIGLLCVEFT-LAPATEWMTQAGWLATLS-------------
NHAB_SALAR      YGRMVWMALPYTIILTLVGLLCVEFT-LAPVNEWMTQAGWLATLS-------------
NHAB_CITK8      YGRMVWMALPYTLVLTLVGLLCVEFT-LTPITEWMTQSGWLATFS-------------
NHAB_KLEP7      YGRMVWMALPYTIVLTLVGLLCVEFT-LMPVTDWLLAHGWLVTPTLP-----------
NHAB_CROS8      YGRMVWMALPYTIVLTLVGLACVQFT-LVPFTDWLLQSGWVSTPATTALLH-------
NHAB_ENT38      YGRMVWMALPYTVVLTLVGLLCVKFT-LIPYTQWLMQIGILAAH--------------
NHAB_SERP5      YGRMVWMALPYTVVLTLVGLLCVQFT-LAPATELLTQWHWLTLPSIEAATH-------
NHAB_YERPE      YGRMVYMALPYTLVMTIVGLLGVEFL-LVPMTEWLTQAGWISLPHITNGVAIPH----
NHAB_YERPA      YGRMVYMALPYTLVMTIVGLLGVEFL-LVPMTEWLTQAGWISLPHITNGVAIPH----
NHAB_YERPN      YGRMVYMALPYTLVMTIVGLLGVEFL-LVPMTEWLTQAGWISLPHITNGVAIPH----
NHAB_YERPP      YGRMVYMALPYTLVMTIVGLLGVEFL-LVPMTEWLTQAGWISLPHITNGVAIPH----
NHAB_YERPS      YGRMVYMALPYTLVMTIVGLLGVEFL-LVPMTEWLTQAGWISLPHITNGVAIPH----
NHAB_YERP3      YGRMVYMALPYTLVMTIVGLLGVEFL-LVPMTEWLTQAGWISLPHITNGVAIPH----
NHAB_YERE8      YGRMVYMALPYTIVMTGVGLLGVEYL-LVPVTEWMIQSGWISLPHIAAGVSITH----
NHAB_PHOLL      YGRMVIMALPYTIVMTLVGLLCVEFL-LIPVTDMMVHWGLIALP--------------
NHAB_PECAS      YGRMVIMALPYTIVMTLVGLLCVEFT-LVPFTDFLMNNHWISLPNLTISGSHA-----
NHAB_SHEB5      YGRMVWMALPYTIVLSIVGVMAIQTGFLEQATQYFYDSHTIIHHSAKEVLGTVSGH--
NHAB_SHEB8      YGRMVWMALPYTIVLSIVGVMAIQTGFLEQATQYFYDSHTIIHHSAKEVLGTVSGH--
NHAB_SHEB9      YGRMVWMALPYTIVLSIVGVMAIQTGFLEQATQYFYDSHTIIHHSAKEVLGTVSGH--
NHAB_SHEPC      YGRMVWMALPYTIVLSVVGVLAIETGFLEQATQYFYDSHMIIHHSAKDVIAPLTSH--
NHAB_SHESW      YGRMVWMALPYTIVLSVVGVLAIETGFLEQATQYFYDSHMIIHHSAKDVIAPLTSH--
NHAB_SHESM      YGRMVWMALPYTIVLSIVGVMAIESGFLEQMTQYFYDSHAIIHHSVKEALAPAAAH--
NHAB_SHESR      YGRMVWMALPYTIVLSIVGVMAIESGFLEQMTQYFYDSHAIIHHSVKEALAPAAAH--
NHAB_SHESA      YGRMVWMALPYTIVLSIVGVMAIQSGFLEQMTQYFYDSHAILHHSVKEALAPAAAH--
NHAB_SHEON      YGRMVWMALPYTIVLSIVGVMAIQIGFLEQMTQYFYDSHAILHHSVKEALAPATGH--
NHAB_SHEAM      YGRMVMMALPYTIVLSIVGILAIESGFLTDMTQYFYDSHLINHHTAAEAAGKALGGH-
NHAB_SHEHH      YGRMVWMALPYTIVLSIVGVLAIQLGALEQMTQYFYDTQLLIHHSAQAVTDSVVSGH-
NHAB_SHEPA      YGRMVWMALPYTIVLSIVGVLAIQLGALEQMTQYFYDSQMLIHHSAQAAADGVVSSH-
NHAB_SHELP      YGRMVWMALPYTIVLSIVGILAIETGFLGEMTQYFYDSHMLIHHSVAEAAKGAVTGH-
NHAB_SHESH      YGRMVWMALPYTIVLSIVGVLAIHLGALEQMTQYFYDTQMLLHHSVKDAA-GAVSGH-
NHAB_SHEFN      YGRMVWMALPYTIVLSIVGVMAIESGFLVDMTDVLYETQLIIHHSAKDISGAVMGH--
NHAB_SHEDO      YGRMVIMALPYTLVLSIVGIVTIESGFLVEMTQYFYDNNIIMHHSAKELTESVVGH--
NHAB_PSEA6      YGTMVYMALPYTIVLTIVGLAATYFG-LGDLTNWLYDMHLIEHHSATLGAEAAAH---
NHAB_PSEAE      YGRMVWMALPYTLVMGGLGWWAVSHW-L------------------------------
NHAB_PSEAB      YGRMVWMALPYTLVMGGLGWWAVSHW-L------------------------------
NHAB_PSEA7      YGRMVWMALPYTLVMGGLGWWAVSHW-L------------------------------
NHAB_PSEP1      YGRMVWMALPYTVVMGGLGWWAVTYW-L------------------------------
NHAB_PSEPG      YGRMVWMALPYTVVMGGLGWWAVTYW-L------------------------------
NHAB_PSEPK      YGRMVWMALPYTVVMGGLGWWAVTYW-L------------------------------
NHAB_PSEE4      YGRMVWMALPYTVVMGGLGWWAVTYW-L------------------------------
NHAB_PSEF5      YGRMVWMALPYTVVMGLLGWYAVSYW-L------------------------------
NHAB_PSEPF      YGRMVWMALPYTVVMGLLGWYAVSYW-L------------------------------
NHAB_MARHV      YGRMVIMALPYTIVMGGVGLYMVTHA-F------------------------------
NHAB_MARMS      YGKMVWMALPYTVVLSVVGGLCVTYF-L------------------------------
NHAB_SACD2      YGKMVIMALPYTIVLGAVGLGSVILF-Y------------------------------
NHAB_HAHCH      YGKMVWMALPYTLVMGGLGYVMIVIT-I------------------------------
NHAB_ALCBS      YGRMVIMALPYTIVMSITGLVMTATV-LEPATDYLYENGWIQHHQVEDLQETPLIPGH
                *. *: **:***: :   *