CLUSTAL format seed alignment for MF_01600

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

Y1037_NOSS1      ---------------------MFWKWCFRLSIVFVGL---------------WLLLDLSS
Y3693_TRIV2      ---------------------MFWKWCFRLSIVFVGL---------------WLLLDLSS
Y938_TRIEI       -----------------MKIHIIYQLKCRLIKAFKRIKSIHILIILFFSFVCWEILGFST
Y1193_THEEB      -------------MPSLSVVPLMPPWLRWLCGLVLAI----------------ALGVGLC
Y1060_SYNY3      -------------MPSAVGESKNFPNGSPLNKGVRAMKGWVKGAIVLA--IALVGLEVIA
Y2310_SYNP6      ----------------------MPRHLSRWGLAIAAI---------------ALGLSLLT
Y1783_SYNE7      ----------------------MPRHLSRWGLAIAAI---------------ALGLSLLT
Y1461_PROM3      -----------------------------MGLAGFARPLQWFKSQWLWLLLSIAAFWLLM
Y755_PROMM       ------------------------MLIESMGLACFARPLQWFKSQWLWLLLSIAAFCLLM
Y1321_SYNS3      -------------------------------MAKIIWTIGRFG------LLLIPLIVIIS
Y1212_SYNPX      ------------------------------------------------------------
Y1151_SYNS9      -------------------------------------------MKRFLWILLPPVLVVVA
Y1323_SYNSC      ---------------------------------------------MRRLLLLLPLVVVAA
Y1810_SYNJA      ------------------------------------------------------------
Y372_SYNJB       ------------------------------------------------------------
Y6445_SOLUE      ------------------------------------------------------------
Y1303_METHJ      ------------------------------------------------------------
Y4385_TRIEI      ------------------------------------------------------------
Y086_CLOTE       ------------------------------------------------------------
Y852_CLONN       ------------------------------------------------------------
Y010_CLOAB       ------------------------------------------------------------
Y011_CLOPE       ------------------------------------------------------------
Y011_CLOP1       ------------------------------------------------------------
Y011_CLOPS       ------------------------------------------------------------
Y1630_DESHY      ------------------------------------------------------------
Y1421_ARCFU      ------------------------------------------------------------
Y2689_PELPD      ------------------------------------------------------------
Y3567_PELPD      ------------------------------------------------------------
Y2333_GEOSL      ------------------------------------------------------------
Y1139_MOOTA      ------------------------------------------------------------
Y1161_SYNWW      ------------------------------------------------------------
Y7333_BRADU      ------------------------------------------------------------
Y1615_CUPNH      ------------------------------------------------------------
Y2225_SALRD      ------------------------------------------------------------
Y961_NITOC       ------------------------------------------------------------
Y2137_SYNFM      ------------------------------------------------------------
Y2716_METCA      ------------------------------------------------------------
Y786_CORGL       ------------------------------------------------------------
Y802_COREF       ------------------------------------------------------------
Y733_CORDI       ------------------------------------------------------------
Y1603_CORJK      ------------------------------------------------------------
Y065_MYCBO       ------------------------------------------------------------
Y095_MYCBP       ------------------------------------------------------------
Y064_MYCTU       ------------------------------------------------------------
Y8670_RHOJR      ------------------------------------------------------------
Y4526_NOCFA      ------------------------------------------------------------
Y6389_RHOJR      ------------------------------------------------------------
Y3215_MYCBO      ------------------------------------------------------------
Y3193_MYCTU      ------------------------------------------------------------
Y3215_MYCBP      ------------------------------------------------------------
Y3291_MYCPA      ------------------------------------------------------------
Y4137_MYCA1      ------------------------------------------------------------
Y2505_MYCUA      ------------------------------------------------------------
Y644_MYCLE       ------------------------------------------------------------
Y1433_MYCSK      ------------------------------------------------------------
Y1415_MYCSS      ------------------------------------------------------------
Y1469_MYCSJ      ------------------------------------------------------------
Y1814_MYCVP      ------------------------------------------------------------
Y1102_SACEN      ------------------------------------------------------------
Y3055_STRAW      -----------------------------------------------------------M
Y5204_STRCO      -----------------------------------------------------------M
Y541_THEFY       -----------------------------------------------------------M
Y1530_NOCSJ      -----------------------------------------------------------M
Y6027_FRAAA      ------------------------------------------------------------
Y3781_FRACC      ------------------------------------------------------------
Y2732_PAEAT      ------------------------------------------------------------
Y2749_ARTS2      ------------------------------------------------------------
Y930_LEIXX       ------------------------------------------------------------
Y644_TROW8       ------------------------------------------------------------
Y641_BIFAA       MSFFDMFGPMFDPEGGSNRAGRQNPRKPSNDDPIILNVETDGGDGPQPSSNV-------P
Y1029_BIFLO      MSFNDPFSILFGNGGDSRRN------NANNDDPIILDVEADG-DGPARNTNAGPSGSSRP
                                                                             

Y1037_NOSS1      RLGAEVFWFREVGYLQVFLLR-------LVSRGVLWVVAAGVTAVYLWGNLALAQRLKYP
Y3693_TRIV2      RLGAEIFWFQEVGYLQVFLLR-------LASRGALWVVAVGVTAVYLWGNLTLAQRLKYP
Y938_TRIEI       NILADFLWFQELNYLPVLINK-------LQTETWLWITTFLISMGFFLVNLRLASFFKYS
Y1193_THEEB      RLIAESLWFHQLGYLEVVWQR-------WSVQALLFLAVAGVSQLFYGC-----------
Y1060_SYNY3      RIYVENLWFQELSFQSVFWKR-------VRWQGSIALITGFISWGFIVFQVKVTNRLIQE
Y2310_SYNP6      RIHIETLWFTALGIPTVFLRR-------LAVQALLFSVVGIAITGLIGGNL---------
Y1783_SYNE7      RIHIETLWFTALGIPTVFLRR-------LAVQALLFSVVGIAITGLIGGNL---------
Y1461_PROM3      RVQVEWLWFGQFDWQGMLLRR-------WLWQLGGLLLALLVVATCQLWQR---------
Y755_PROMM       RVQVEWLWFGQFDWQGMLLRR-------WLWQLGGLLLALLVVATCQLWQR---------
Y1321_SYNS3      RLQVEWYWFDQFELGSVYGKR-------LLLQLGGALFAFLFVGSCALWRQ---------
Y1212_SYNPX      -MQVEWSWFQQFQLEGVLLER-------WLLQLASAVVALLPIGLAIRWSR---------
Y1151_SYNS9      RMHVEWVWFAQFNWQSVLFQR-------WMLQLLFAGAGSIPVFLAVLWLR---------
Y1323_SYNSC      RMQIEWLWFNQFNLANVLLER-------WLLQVLLAGVAMLPLLAARAWSR---------
Y1810_SYNJA      ------------------------------------------------------------
Y372_SYNJB       ------------------------------------------------------------
Y6445_SOLUE      -----------MQRHELPPGR-------RSPATRITLLAILLFL----------------
Y1303_METHJ      ---------------MRLRKL-------LIFIPAAVILLFFLLT----DLLS--------
Y4385_TRIEI      ---------------MKIRNY-------IIIAISVILLVVFSLSRTLVHLLT--------
Y086_CLOTE       ----------------MKKKK-------VITFIAIIILLLILFLYRSTSFII--------
Y852_CLONN       ----------------MRKNK-------VLIGLFFCIALTVIFLKKIVNVII--------
Y010_CLOAB       ----------------MKKKV-------TIVTIILFLLVIVGSFGKVTDFII--------
Y011_CLOPE       -----------------MKNK-------ILNTVLISILLLVVVFFVSTNFII--------
Y011_CLOP1       -----------------MKNK-------ILNTVLISILLLVVVFFVSTNFII--------
Y011_CLOPS       -----------------MKNK-------ILNTVLISILLLVVVFFVSTNFII--------
Y1630_DESHY      ------------------MRR-------TARIMLVLLGIGLILFIALSGLFE--------
Y1421_ARCFU      -----MQEPPVYPPPYKPPEM-------KVFYFLAFVFGLVIVISLSIYYYT--------
Y2689_PELPD      ----------------MIKNR-------FILILVIVALTVSLLSFLLAFCT---------
Y3567_PELPD      -------MGTLLLEVTMLKNK-------FFPLLILVSVLLSLISYLLNLYS---------
Y2333_GEOSL      ----------------MAKNR-------FLLIIAAVFVVLPAALSLITFYT---------
Y1139_MOOTA      ----------------MKLNR-------LWFCLLIIIPGFLVAAYLGSHFLT--------
Y1161_SYNWW      ----------------MQKTS-------STTKLVIFLVVLGLISYLASLYV---------
Y7333_BRADU      --MTIGITGPERKAPRQSAVV-------GLIIAALVIAIVLTLLALASDFLV--------
Y1615_CUPNH      ------MRSPARDATRLGRLA-------TWVVAVIVALIAVSRV---TGLVV--------
Y2225_SALRD      -----------MSILRSSRLL-------QILLGIIGVVFTVLLVT--PGLVV--------
Y961_NITOC       -----------MSRWKRRFLI-------LGLSIVVLAVFLLIAGFEGIPFLV--------
Y2137_SYNFM      -----------MNRWARWPLI-------ILIGILGISAVVILSSLASVDYLI--------
Y2716_METCA      -----------MGNWKRLLTS-------AAVVMVVLAGLLLAIVLAATHFLV--------
Y786_CORGL       ----MSTGLTPPPQPIKRPP----------KAVTWIFAIIALVILIAPMSVG--------
Y802_COREF       ----MATGLTPPPQPIKRPP----------KAVTWIIGIIALLVLVTPLTVG--------
Y733_CORDI       ----MATGFTRPAAAPKRPQ----------RRLTWLIPLLMILGALVPTVVD--------
Y1603_CORJK      ----MSTPTPPSSGRPKQPFPSSPGSSRRSKILGILVAIIAIAIFIVPVVVS--------
Y065_MYCBO       ------METGSPGKRPVLPK--------RARLLVTAGMGMLALLLFGPRLVD--------
Y095_MYCBP       ------METGSPGKRPVLPK--------RARLLVTAGMGMLALLLFGPRLVD--------
Y064_MYCTU       ------METGSPGKRPVLPK--------RARLLVTAGMGMLALLLFGPRLVD--------
Y8670_RHOJR      ------MQPSD--RMRALPR--------RARVMIMVTVALIALLVIGPRLVV--------
Y4526_NOCFA      ------MGMRPPSGLPSLSR--------RSRVLLVAAVVLAALLLLGPRFTD--------
Y6389_RHOJR      ------MGMRPPAGLPSLSK--------RSRVLLVLALVVAALLLVGPRLIS--------
Y3215_MYCBO      ------MGMRSAARMPKLTR--------RSRILIMIALGVIVLLLAGPRLID--------
Y3193_MYCTU      ------MGMRSAARMPKLTR--------RSRILIMIALGVIVLLLAGPRLID--------
Y3215_MYCBP      ------MGMRSAARMPKLTR--------RSRILIMIALGVIVLLLAGPRLID--------
Y3291_MYCPA      ------MGMRPTARMPKLTR--------RSRILILIALGVIALLLAGPRLID--------
Y4137_MYCA1      ------MGMRPTARMPKLTR--------RSRILILIALGVIALLLAGPRLID--------
Y2505_MYCUA      ------MGMRPTARMPKLTR--------RSRVLILIALGVIALLLAGPRLID--------
Y644_MYCLE       ------MGMRPAARMPKLTR--------RSRTLIMVALGVIVLLLAGPRLVD--------
Y1433_MYCSK      ------MGMRPPARMPKLTR--------RSRVLIGVALAAVVLLLIGPRFID--------
Y1415_MYCSS      ------MGMRPPARMPKLTR--------RSRVLIGVALAAVVLLLIGPRFID--------
Y1469_MYCSJ      --------MRPPARMPKLTR--------RSRVLIGVALAAVVLLLIGPRFID--------
Y1814_MYCVP      --------MRPAARMPNLTR--------RSRVMIAVALAVVVLLLLGPRLVD--------
Y1102_SACEN      --------------MPKLSR--------RSRILLILGGVVLIALIAGSRLLG--------
Y3055_STRAW      PDRGGGP-TGPRIRVGRPSRR-------VRTLLMTLGVLAVLGMAFVMFAG---------
Y5204_STRCO      PDRGGGPPTGPRIRVGRPSRR-------VRTLLLTLGVLAVLAMAFTMFAG---------
Y541_THEFY       SFRSPGA---PTARMPRRSR-----------LLAPVGAAVVVIIAGIMFAAN--------
Y1530_NOCSJ      SELFDEAPRDPGPPARSGSRR-------SRALIVTAVVLVIGFLGLSTFAG---------
Y6027_FRAAA      ----------MATTSRRPVLT-------RAKVIVPVLLAVALVIAFVAIFTR--------
Y3781_FRACC      ----------MATTSRRPVLT-------RTKVLVPVLLVIVLAITIIAIFTR--------
Y2732_PAEAT      ------MSRPASSNPPGRSPL------RRGALTPTLIVVAVAVVGFIF-FAN--------
Y2749_ARTS2      ------MSRPASSTPPGRPQP------RRGALTPTLIVVALVVVGFIF-FAN--------
Y930_LEIXX       ------MTSAAAVRSPGR---------RRAAVWTTLGVIVALVILFFI-FAG--------
Y644_TROW8       --------MNIKLRFPRSS--------LAIAILSVVAFLVLIALTAFF-LVH--------
Y641_BIFAA       PKRPSGPRITSKPNRPRKP-S------NGSKIFIGVVLALAIVIGLFFALAQ--------
Y1029_BIFLO      PRGPANPRITRKPASGGSGGS------RGSKILIGVVLALAIIVGLFFGLSR--------
                                                                             

Y1037_NOSS1      RSLKIAEVRREEAELSVGLKNFLSPQYSRLNAPKINDAGHLKPFRLRWLLPLAFVFSLLA
Y3693_TRIV2      RSLKIAEVRREEAELSVGLKNFLSPQYSLLNAPKIHDAGHLKPFRLRWLLPLTVVFSLLA
Y938_TRIEI       KK----QVRITERSEEIMLIPPVTIPSSKLRIEP--------SLSLSWLLCCIFGLILLV
Y1193_THEEB      ------QQQWLLRQRTVTLDPALRAQST------------YRGLGLWQLLLCAGSLNWLL
Y1060_SYNY3      EAQ--LKGLAVAQAVYAPVPVAIGSRYLPMPAPPVGPKAHSRPLQLPVLLPLIIVLQLIL
Y2310_SYNP6      --------RWAARHQTDQPD---------------------RPAPRLQLGGLLTVLTLLW
Y1783_SYNE7      --------RWAARHQTDQPD---------------------RPAPRLQLGGLLTVLTLLW
Y1461_PROM3      -----NWIKLEGASNLA--------------------------EPALPLHGWRYGLGLLG
Y755_PROMM       -----NWIKLEVASNLG--------------------------ESSLSLHGWRYGLGLLG
Y1321_SYNS3      -----SWLR-PSESEKN--------------------------ERSPVLTGYRYGFCLLA
Y1212_SYNPX      -----SLDPS--PETAS--------------------------TVR--LEGWRYSLTLLL
Y1151_SYNS9      -----AFDRIDDPPRQQ--------------------------KRP--IDGMRFSLVLMV
Y1323_SYNSC      -----QFRQQR-LTSSQ--------------------------GIS--LRGWPYGIALLI
Y1810_SYNJA      ------------------------------------------------MQRLQRGLVLLL
Y372_SYNJB       ------------------------------------------------MQRLRRGLFLLL
Y6445_SOLUE      ----------------------------------------------------LFGLRSFA
Y1303_METHJ      ----------------------------------------------DLFWYASVGYSPVF
Y4385_TRIEI      ----------------------------------------------EAWWFNTVDFANIF
Y086_CLOTE       ----------------------------------------------DFQWFQELSYTSVF
Y852_CLONN       ----------------------------------------------NIKWFREVGYLSVY
Y010_CLOAB       ----------------------------------------------NLEWFKEIGYTSVY
Y011_CLOPE       ----------------------------------------------NVQWFKEVGYLNVF
Y011_CLOP1       ----------------------------------------------NVQWFKEVGYLNVF
Y011_CLOPS       ----------------------------------------------NVQWFKEVGYLNVF
Y1630_DESHY      ----------------------------------------------DYLWYSDLGYSQLF
Y1421_ARCFU      ----------------------------------------------EMLWFESVGYENVF
Y2689_PELPD      ----------------------------------------------DWLFFVETGFTSVF
Y3567_PELPD      ----------------------------------------------DWLFFDETGFSSVF
Y2333_GEOSL      ----------------------------------------------DWLFFRETGYTQVF
Y1139_MOOTA      ----------------------------------------------DWYWFAEVGYRQVF
Y1161_SYNWW      ----------------------------------------------DWLWFKSVNFPSVF
Y7333_BRADU      ----------------------------------------------DWLWFSVIGYREVF
Y1615_CUPNH      ----------------------------------------------DWMWFASVGYAGVF
Y2225_SALRD      ----------------------------------------------EYFWLSELDYSSVF
Y961_NITOC       ----------------------------------------------DLWWFSAQDYGFYF
Y2137_SYNFM      ----------------------------------------------NIWWFDSLGYGLYY
Y2716_METCA      ----------------------------------------------EWWWFKSLDLGAYF
Y786_CORGL       -------------------------------------------FYTDWLWFGEVDFRGVF
Y802_COREF       -------------------------------------------FYTDWLWFGEVDYRGVF
Y733_CORDI       -------------------------------------------LYTDWLWFGEVDFRGVF
Y1603_CORJK      -------------------------------------------TYTDFAWFRSVDYQGVF
Y065_MYCBO       -------------------------------------------IYVDWLWFGEVGFRSVW
Y095_MYCBP       -------------------------------------------IYVDWLWFGEVGFRSVW
Y064_MYCTU       -------------------------------------------IYVDWLWFGEVGFRSVW
Y8670_RHOJR      -------------------------------------------GYTDWLWFGEVGYRRVW
Y4526_NOCFA      -------------------------------------------AYTNWLWFGEVGFREVF
Y6389_RHOJR      -------------------------------------------TYTDWLWFGEVGFRGVF
Y3215_MYCBO      -------------------------------------------AYVDWLWFGELGYRSVF
Y3193_MYCTU      -------------------------------------------AYVDWLWFGELGYRSVF
Y3215_MYCBP      -------------------------------------------AYVDWLWFGELGYRSVF
Y3291_MYCPA      -------------------------------------------AYVDWLWFGELGYRSVF
Y4137_MYCA1      -------------------------------------------AYVDWLWFGELGYRSVF
Y2505_MYCUA      -------------------------------------------AYVDWLWFGELGYLSVF
Y644_MYCLE       -------------------------------------------AYVEWLWFGELGYRSVF
Y1433_MYCSK      -------------------------------------------TYVNWLWFGELGYRSVF
Y1415_MYCSS      -------------------------------------------TYVNWLWFGELGYRSVF
Y1469_MYCSJ      -------------------------------------------TYVNWLWFGELGYRSVF
Y1814_MYCVP      -------------------------------------------TYVNWLWFGELGYRSVF
Y1102_SACEN      -------------------------------------------TYVDWLWFGEVGRRQVF
Y3055_STRAW      -------------------------------------------FWTDWLWYRSVKYSSVF
Y5204_STRCO      -------------------------------------------FWTDWLWYRSVHYSSVF
Y541_THEFY       -------------------------------------------FWTEYRWFGSVGYTTVF
Y1530_NOCSJ      -------------------------------------------IYTDRLWYVSGGYGAVF
Y6027_FRAAA      -------------------------------------------LYTDLLFYRSVDFSKVF
Y3781_FRACC      -------------------------------------------LYTDLLFYRSIDFSRVF
Y2732_PAEAT      -------------------------------------------VWTDVLWYQQLGFFEVY
Y2749_ARTS2      -------------------------------------------VWTDVLWYQQLGFFEVF
Y930_LEIXX       -------------------------------------------LYADILWYQQFGFLSVL
Y644_TROW8       -------------------------------------------FYSEYLWYDQLGFTGVI
Y641_BIFAA       -------------------------------------------FVTDVMWYSQLGFQSVI
Y1029_BIFLO      -------------------------------------------FITDLMWYGQLGFQSVV
                                                                             

Y1037_NOSS1      GLILVHYGKIALAYWYPAFN--KNSLPIITPFRLETIWELGRQVFSQVLYLGLIVGIAIA
Y3693_TRIV2      GLILVHYGKIALAYWYPAFN--KNSLPIITPFRLETIWELGRQVFSQVLYLGLIVGVAIA
Y938_TRIEI       GLILTHYIDVFTNYLYPDLTVANVSPQIPSEFNIESICKILTSILSNLWLLGLFLLLSFA
Y1193_THEEB      IVATYHIGAIALQLWQQRSE-MTFNSPLLPQLSVWRVAELSLQMVQTPWLLGLSLVAVIL
Y1060_SYNY3      ISLVMYYVFITIQVWTPDYTLPNITPAVPQPFRLHFLFTSFSGMGSQLGVTALAGMLALI
Y2310_SYNP6      IALLALTTQAILAAWNCQTG--RALPFLPQILTLDWLQSSLITAGSWPLGMGLLLGVGSL
Y1783_SYNE7      IALLALTTQAILAAWNCQTG--RALPFLPQILTLDWLQSSLITAGSWPLGMGLLLGVGSL
Y1461_PROM3      CFVVVVGDLVLLTRL--------AWLACFKPFALGHWWSEPFEDIWALVIPLSCVFISIC
Y755_PROMM       CFVVVVGDLVLLSRL--------AWLACFKPFDLGHWWSEPFEDIWALVIPLSCVFISIC
Y1321_SYNS3      CLLVLLSVLAIDTRL--------AWLAWIEPFSLSYWWSLPFSTGWPLLSLSILMLTLIM
Y1212_SYNPX      AIALQLVSLAVINGL--------ILQAIDDSMNLA-----SGWQVSIHQSQLPVLTLISL
Y1151_SYNS9      SGLAFLACSVVLSDL--------AILAWKQPFSLSHWQSTGHSMASEWKALLPIQLAIAG
Y1323_SYNSC      CAVVVLISALLTLDL--------LALAISDPFQLGDWQSNVWPHSRIGSVVKLVQVGGIG
Y1810_SYNJA      WAGLGILAITALASFYVDLA--WFAELNALPVLWTRVLARWGLGLGAFAFALAVVGSNIR
Y372_SYNJB       GVGLGILAITGLAAFYVDLA--WFAELHALPVLWTRVIARWGLGLGAFLFALAVTGSNIC
Y6445_SOLUE      GYAIEIEWWKELGQLNTWFSMLYYGIAPVAVATLVAFLALWISHARALKFAGTGLGEHKL
Y1303_METHJ      LTILITSAALFVIGTLLFFAFSYGNVILAARTGAGA---------------FG---VEKE
Y4385_TRIEI      WTRLNWQIFLWVGAFVIYFLFLWSNYWIAEKLTSDRSFNIL----------LG---TELA
Y086_CLOTE       LKEFFTIGKLFTLSFALIFISIWLYYLSLKKNINWQE-----------------------
Y852_CLONN       LKRFTSVISLFILVFLICFVAIKTYCRSIKKNLSKNESFI----------------DVDI
Y010_CLOAB       FTKLAAILKLMIPIFIIIYTGLWFYYKSIRKIIIKWNKVV----------------EVNV
Y011_CLOPE       FTKLIAICKLFVPIFILYFCVIAIYLFTLRKSIRSLV---------------------GD
Y011_CLOP1       FTKLIAICKLFVPIFILYFCVIAIYLFTLRKSIRSLV---------------------GD
Y011_CLOPS       FTKLIAICKLFVPIFILYFCVIAIYLFTLRKSIRSLV---------------------GD
Y1630_DESHY      WTPLISKGIIQIINGTILFTFIAGTLFSIRHAILTFVNERLRKRLRLVHEMDR---PLYH
Y1421_ARCFU      LTYLKHSLGFFFLEFIIFFVPLFLTNVAVRKVTLEFH-----------------------
Y2689_PELPD      TTKLYAQAGSGLLFAGVLFAGTLLNLLLAGKAVFPTYATPR---EAGDFRPR-------L
Y3567_PELPD      TTTLYAKTGAGLLFGGLLFLFVQINLHVANRAQFPLSGMHLL--GAGNLGIN-------R
Y2333_GEOSL      TTALAAKVGAGLASGLFMFAFAMVNLYFANRASLPHTPRGVFFEGGNVYRLQ-------R
Y1139_MOOTA      LTRLLSEVGIRLGTIAFFFLFFYLNLLFTRKSLHLSPPEGRENWTLKEYLID-------R
Y1161_SYNWW      STILLNKIGLYVFIFLATALLFAFNLRLTRRHMGPVEEPVYDDEEGRVIYLDDEKTPWKE
Y7333_BRADU      WTTIGAKAVVFLAVWTATAVILLLNGWLALHFARRRSTQLAAASVWSAAGNAPPD-LLAL
Y1615_CUPNH      RTIFLTQALLFLAVFAVSAGALWLSGWLAHRSA-------SQAQAWRPEVLGQP---VGE
Y2225_SALRD      WTIRGAQVLLFVLVFLVAGLYFGGNFRVLIGNI-----PPLWASRWAQEGEAPE--VGGE
Y961_NITOC       WQRALYQLVVFIQVSIVFFLIFFVNFWVASHYLGSERPADIPPG------APRKKFKNLF
Y2137_SYNFM      WLRLLYRYIVFGAVTLLFFLIFFLNFWVASRYVGNVPPAPSKFRI-----AALDRYLNVV
Y2716_METCA      WLRFLYRYILSGGVTLFFFLIFFLNFWAASQYLGVDQAIYAAGS-------EESRYRRWL
Y786_CORGL       SKVIVTRIVLFVIFALIAGFVTWLAGYFVTKLRPDEMSAF--DTQSP--------VYQYR
Y802_COREF       STVIVTRIILFIVFALLAGFVTWLAGYFTIRLRPDDLTAF--DAESP--------VFQYR
Y733_CORDI       NKVIATRIGLFVGFGLLAGIVTFLAGWFTYRGRPDELEFF--DPDSP--------VVQYR
Y1603_CORJK      MNVIVTRLVLFVVFGLIGALISWLAAFLAYRARPDEIESL--GTSSP--------LAEYR
Y065_MYCBO       ITVLLTRLAIVAAVALVVAGIVLAALLLAYRSRPFFVPD--EPQRDP--------VAPLR
Y095_MYCBP       ITVLLTRLAIVAAVALVVAGIVLAALLLAYRSRPFFVPD--EPQRDP--------VAPLR
Y064_MYCTU       ITVLLTRLAIVAAVALVVAGIVLAALLLAYRSRPFFVPD--EPQRDP--------VAPLR
Y8670_RHOJR      GTVLVTRLILFTAVTLLVGAVIFAAVVWAYRSRPLFAASGANTAKDP--------VERYR
Y4526_NOCFA      LTVVVTRIILFAAVALFVGATVWLALLLAYRTRPVFVPMA--GPNDP--------IARYR
Y6389_RHOJR      TTVLITRLLLFLVVGVVVGGIVWLALLLAYRSRPVFVPVS--GPNDP--------VARYR
Y3215_MYCBO      TTMLATRIVVCLVAGVVVGGIVFGGLALAYRTRPVFVPDA--D-NDP--------VARYR
Y3193_MYCTU      TTMLATRIVVCLVAGVVVGGIVFGGLALAYRTRPVFVPDA--D-NDP--------VARYR
Y3215_MYCBP      TTMLATRIVVCLVAGVVVGGIVFGGLALAYRTRPVFVPDA--D-NDP--------VARYR
Y3291_MYCPA      STVLVTRFVVFLIAGLLVGGIVFAGLAVAYRTRPVFVPSN--D-NDP--------VARYR
Y4137_MYCA1      STVLVTRFVVFLIAGLLVGGIVFAGLAVAYRTRPVFVPSN--D-NDP--------VARYR
Y2505_MYCUA      TTVLVTRFLVFLVAGVLVGGIVFAGLALAYRTRPVFVPNN--D-NDP--------VARYR
Y644_MYCLE       STVLVTRVVVFLVAGLVVGGIVFAGLAVAYRTRPVFVPSH--D-NDP--------VARYR
Y1433_MYCSK      TTVLLTRVVVFLVVSLLIGAIVFAGLALAYRTRPVFVPTA--GPNDP--------IARYR
Y1415_MYCSS      TTVLLTRVVVFLVVSLLIGAIVFAGLALAYRTRPVFVPTA--GPNDP--------IARYR
Y1469_MYCSJ      TTVLFTRVVVFLVVSLLIGAIVFAGLALAYRTRPVFVPTA--GPNDP--------IARYR
Y1814_MYCVP      TTQIVTRLLLFLAVAVVFGAVVFAAMALAYRTRPVFVPTA--GPNDP--------IARYR
Y1102_SACEN      ATQVFSRLGLGVAAGAFVGVVLLLNLWIAYRSRPVFVPVS--GPDDP--------LARYR
Y3055_STRAW      TTTLSTKIGLFFVFGLLMAVAVGVNIWLAHRLRPPLSAMS--MEQQS--------LDRYR
Y5204_STRCO      TTTLWTKIGLFFVFGLLMALAVGFNIWLAHRLRPPLSAMS--MEQQN--------LDRYR
Y541_THEFY       WTELRTRALLFAGGALLMALAVGLSVYFAYRTRPAYRPFS--LEQQG--------LDRYR
Y1530_NOCSJ      TTLFWTKTVLFFLFGAGMALVVGVNIYLAYRFRPFFRPNS--PEQNG--------LDRYR
Y6027_FRAAA      TTVIYTRILLFLIFGAVMAVVIGTNIVLGYRFRPQLRPLS--TEQQN--------LERYR
Y3781_FRACC      TTVLYTRILLFVLFGVVMAIIVGTNIVLAYRLRPPLRPLS--TEQQN--------LERYR
Y2732_PAEAT      IRENLARIITFLIGFAMMFAAVFFAIRIAYRSRPVYAPDAEARDN----------LNRYQ
Y2749_ARTS2      LTENLARIIIFLAGFALMFVAMFYAIRIAYHARPVYAPDSEIRDN----------LNRYQ
Y930_LEIXX       TTQWFAAIAMFFVGFLGMALPLWVVIQLAYRLRPVYA---KLNSQ----------LDRYQ
Y644_TROW8       VTQWAAIFVVFCLAFVFVSIFLWLCMFSAHKFRPRYT---SLSSV----------LSHYQ
Y641_BIFAA       WTQLGTRVGLWLAYAVLIAAVGFISATLAIWARPDAADGSTIRVNGDT-------IEIGK
Y1029_BIFLO      WTQLGVKIGLWVAYALLMALTGFVSAWLAIRARPDSADGSTIRINGDV-------VEVGK
                                                                             

Y1037_NOSS1      ILIY--SQFFLRAIAVVLSVVFGTILFYNWAKVLQYFFPTPFNSTEPLFGKDISFYIFSL
Y3693_TRIV2      ILIY--SQFFLRAIAVILSVVFGTILFHNWAKVLQYFSPTPFNSTDPLFGKDISFYIFSL
Y938_TRIEI       IIIN--PILWLSVFAVVLSLVFSFILSSHWANILQLLHGTPFNKSEDLFHIDISFYVFQL
Y1193_THEEB      GLWL--PVGLFQGLGILLSLAMGAIASLSWPVVLKGLFAASDPHTEPLFRHSISFYLFQI
Y1060_SYNY3      GVLR--GPRLLPGLVFILSAVWGLLLSGNWFRLLLSVNSQPFNTIDPQFHHDISFYIFQI
Y2310_SYNP6      VLFLWRPWPLLIGLSSLTSLAIALLTSREWLRIWPAFAAESVSDRDPIFQQDLAFYLFRL
Y1783_SYNE7      VLFLWRPWPLLIGLSSLTSLAIALLTSREWLRIWPAFAAESVSDRDPIFQQDLAFYLFRL
Y1461_PROM3      VMLGN--ARGGRIAHLMGCFCFSISIARGWGLWSLALAIPPTGIKEPLLGADVSFGLGQF
Y755_PROMM       VMLGN--ARGGRIAHLIGCFCFSISIARGWGLWALALAIPPTGIKEPLLGGDVSFGLGQF
Y1321_SYNS3      FGLTR--SRRLGLTQVYGSVCICLIVARSWGLWSLAFSIPNLGRVEPMLGSDVSFGLGRF
Y1212_SYNPX      VAVMQ--PRLRRLLPWFVSTAVVLIAARAWGVWALAWSIPLSGLQEPFLKADVSFALGRF
Y1151_SYNS9      VSLCR--PQLRRWVAVAMGFALVLVVSRAWGVWSLAWLIPDEGLREPLLGTDLSFGLGRF
Y1323_SYNSC      LAMTW--LRLRPWLGRIVAASWVVVVSRTWGIWSLALWIPNESTKDPLLGADLSFGLGRF
Y1810_SYNJA      ACWRGASTAGAWAIALGLSGGLAWSLSQHWFALLLWLHQVPVGESDPIFGRDLGFFLFGL
Y372_SYNJB       SCWRGATLAGAWAIATGLSVFFAGSLSNHWFTLLLWLNQGPVGESDPIFNRDLGFFLFSL
Y6445_SOLUE      YARIS--TLALLFLAWFIAAGAIDTWTVVRFAGSRGLPAAAAGWHDNIFNKPLSFYLFDL
Y1303_METHJ      IQYLGGIACAVAAGITGLSLSSS------WEIILAFLDQTPFHISDPVFGLDISFYIFSL
Y4385_TRIEI      PYRNIFVKIIFLVNITLISLSAATATSPAWETFLKFLNAVDFPNQDPIYQRNIGFYIFRL
Y086_CLOTE       --HNKRKKLMIAFNCIVSSLFAYFFSSKYWYQILQFNNSVPFDIKDPIFNKDISFYIFKL
Y852_CLONN       ESKSKGKKIINALTLIISLFIALNFSLGYWDKILEFMNSSKFNVKDPIFNMDISFFIFKL
Y010_CLOAB       KTEKLKKRVAIVIDVIASFFVAYFTSSVYWYRILQFTSGNSFNIKDPIFNLDVSFYVFRL
Y011_CLOPE       TKFKSVKKYFLLSNLVISILGAGATATTQWYKILQFTNAVPFGEVDPIFNKDISFYVFKL
Y011_CLOP1       TKFKSVKKYFLLSNLVISILGAGATATTQWYKILQFTNAVPFGEVDPIFNKDISFYVFKL
Y011_CLOPS       TKFKSVKKYFLLSNLVISILGAGATATTQWYKILQFTNAVPFGEVDPIFNKDISFYVFKL
Y1630_DESHY      LSQRKMTLWLIIISVLISFGVSFVTGFTGWLEVLTFLNATPFGQGDPIFFKDLGFYVFQL
Y1421_ARCFU      ----GEPLKIPHLADFGIAFFAALTVKNYWSSMLFYFNSSNFGVSDPIFGIDAAFYTFQL
Y2689_PELPD      DEARRLVKPLGIPACAILALLVGQWGAMQWEKLLFFVNRVSVGTTDPVMGRDIGFYLFTL
Y3567_PELPD      DQAVRLCKPVSMLVSFVLALLAGNLGAMKWKDLLFFANRLTVGTVDPLIGKDVGFYLFSL
Y2333_GEOSL      DEMVQMVKPLSILAALVLSLLAGRWGALQWQNLLLFTNGVTVGTSDPIMGKDLGFYLFSL
Y1139_MOOTA      FITSRRLGILYLLLSLAGALIFSPLAAGKWLVVQEYLRATPFGLADPLFGRDVSFYIFKL
Y1161_SYNWW      FLRGKSSRWLYLGISLFAAYLVSSVAVDNWIVVQQYINRVPFGTTDPIFNKDLGFYFFNL
Y7333_BRADU      VRDRLRWPRLIAAGAASLALLVAAAEAGNWGVFLQFVYQAPYGADDPLYNNDIGFYLFSL
Y1615_CUPNH      IAARVPWRAAIAGVAVLVGLLMAVGELSSWAIALRYFHQVPFGKTDPIFAKDIGFYFFTL
Y2225_SALRD      PLTRDRLQRLGYVVAGVLSLLFAAGFSGRWNDLLRFWYAGSYGQADPVYGVDLAFYMLEL
Y961_NITOC       FRFQTGSLWIYTPLSLVLSIIIAWPLFQQWESFLLYLVAPDMGIQDPAYGKNISYYLFSF
Y2137_SYNFM      RMFRSGSLWVYTPLSLILAVIIALPIFEKWEAFLLYVAGPKTGVPDPVYGKDISYYLFSY
Y2716_METCA      RMFQTGALPVYLPLSVFLAVLVALPFYHEWEAGLLFFFAPAAGVTEPVFGEDAGFHMFRI
Y786_CORGL       QMIENSLRRVMVIIPIFVALLAGLIGQRSWRTVQMWLNGQDFGVSDQQFGLDYGFYAFDL
Y802_COREF       QMIENSLRRILIIVPIFVGLLGGLVGQRSWQTVQLFLNREPFGVEDQQFGMDYGFYAFTL
Y733_CORDI       AAVEKGVHRFLVVLPVVIGIAAGFLGQQAWQTVQLFFNRQDFGVSDQQFGMDYGFYAFTL
Y1603_CORJK      PLIRRNMRPFLVGIPLFVGVITGMIVQSNWRSVLLFLNGSNFGVHDPQFDKDLGFYAFNL
Y065_MYCBO       SAVMRRPRLFGWGIAVTLGVVCGLIASFDWVKVQLFVHGGTFGIVDPEFGYDIGFFVFDL
Y095_MYCBP       SAVMRRPRLFGWGIAVTLGVVCGLIASFDWVKVQLFVHGGTFGIVDPEFGYDIGFFVFDL
Y064_MYCTU       SAVMRRPRLFGWGIAVTLGVVCGLIASFDWVKVQLFVHGGTFGIVDPEFGYDIGFFVFDL
Y8670_RHOJR      EVVSRRPRSFTVGIALLLALPFGLHAQASWETVQLFLHGGAFGTVDAEFGYDIGFYVFDL
Y4526_NOCFA      TTVMSRLKTFGIGIPVLLGLLAGLVAQSNWVTVQLFLNGGDFGEQDPQFHLDVGFYAFDL
Y6389_RHOJR      TTVMTRLRLFGLAIPIAVGLLAGLIAQSSWVTVQLFVNGGAFGVADPEFGLDVGFYTFDL
Y3215_MYCBO      AVVLARLRLVGIGIPAAIGLLAGIVAQSYWARIQLFLHGGDFGVRDPQFGRDLGFYAFEL
Y3193_MYCTU      AVVLARLRLVGIGIPAAIGLLAGIVAQSYWARIQLFLHGGDFGVRDPQFGRDLGFYAFEL
Y3215_MYCBP      AVVLARLRLVGIGIPAAIGLLAGIVAQSYWARIQLFLHGGDFGVRDPQFGRDLGFYAFEL
Y3291_MYCPA      ALVLSRLRLVSVGVPVAIGLLAGIIAQSYWVRIQLFLHGGDFGIKDPQFGKDLGFYAFEL
Y4137_MYCA1      ALVLSRLRLVSIGVPVAIGLLAGIIAQSYWVRIQLFLHGGDFGIKDPQFGKDLGFYAFEL
Y2505_MYCUA      TVVLARLRLFGIGIPAAIGLLAGIVAQSYWVRIQLFLHGGDFGITDPQFGKDLGFYAFEL
Y644_MYCLE       AMALSRLRLIGVGIPAAIGLLAGIIAQSYWVRIQLFLHGDNFGIRDPQFGKDLGFYAFEL
Y1433_MYCSK      TTVMARLRLFGFGVPAFIGILSGIVAQSYWVRIQLFLHGGEFGVTDPQFGLDLGFYAFDL
Y1415_MYCSS      TTVMARLRLFGFGVPAFIGILSGIVAQSYWVRIQLFLHGGEFGVTDPQFGLDLGFYAFDL
Y1469_MYCSJ      TTVMARLRLFGFGVPAFIGILSGIVAQSYWVRIQLYLHGGEFGVTDPQFGLDLGFYAFDL
Y1814_MYCVP      TAVMARLRLVGIGVPVAVGLLAGLIAQNYWQRVQLFLHGGSFGVSDPQFGIDLGFYAFDL
Y1102_SACEN      TVATERSRLFGWGIPIVIAVIAGLTAQSDWQTLQLFLHSVPFGQVDPEFGNDISFYTFQL
Y3055_STRAW      MGIAPYKKWLLLGITSLVGLIAGASASSQWRTWLMWVNGVPFHQKDPQFHLDVSFYAFDL
Y5204_STRCO      MGIAPYKKWLLLGITALVGLIAGASASGQWRTWLMWVNGVPFGQKDPQFKLDVSFYAFDL
Y541_THEFY       SSIDPHRKVFFWGLVGGLALLTGASATAEWQTFLQFANATKFGAQDAQFGLDISFYTFTY
Y1530_NOCSJ      EAINPIRTWLLVGVALVLGAFAGSSAIGEWRDYLLWRNGTSFGSEDAYFQKDIGFYVFDL
Y6027_FRAAA      SAIEPYMKLVLVAVAAVFGLAAGLSASGRWRTWLLWVNGESFGTKDPQFHRDISYYAFTY
Y3781_FRACC      SVIEPYMLLILLAVTTLFGLAAGLSAAGQWRTWLLWVNGESFGTPDLQFHRDISYYAFSY
Y2732_PAEAT      AQLEPVRRVVMIGLPILFGLFAGSAAASQWQKALLFFNQEPFGQADPLFNMDISFYLMSL
Y2749_ARTS2      AQLEPVRRVVMIGLPVLFGLFAGSAAASQWQKVLLFLNQEPFGQNDPQFNLDISFYLMTL
Y930_LEIXX       QVIEPLRRLAMYGIPIVFGIFAGVSAASRWQTAAMWINGTPYGKTDPLFHLDIGFYLFAL
Y644_TROW8       KVIDPIRKIVVLLVSLGLGAVAGIFAASRWDIVLAWLNKVPTGKSDPIFHNDISFYFFDL
Y641_BIFAA       SVSSKSARRIAVVISLIVGLVFGSQFNANWSEILLMFNSQSFGTKDPQFGIDNGFYVFVL
Y1029_BIFLO      SVSSKTARRVAVVISLIVGVIFGSQFNANWSEILLMFNAQSFGTTDPQFGLDNGFYVFVL
                                                              :       .:     

Y1037_NOSS1      PLWELLELWLMGMFLYGFI-----------AVTLTYLLSADSLSQG--------------
Y3693_TRIV2      PLWELLELWLMGMFLYGFI-----------AVTLTYLLSADSLSQG--------------
Y938_TRIEI       PVLELLRFWLIGLFLYGFV-----------ACILIYLLSGKSLSQG--------------
Y1193_THEEB      PLWELLRLWLVNLSVVGLG-----------GTTLGYLLANESLSHG--------------
Y1060_SYNY3      PLWQLLESWWRGLFLFSLL-----------GVTLIILKSADSLSEG--------------
Y2310_SYNP6      PALEVLQFDLWIGLAFSFC-----------AVLAVYYLAKQSVSNA--------------
Y1783_SYNE7      PALEVLQFDLWIGLAFSFC-----------AVLAVYYLAKQSVSNA--------------
Y1461_PROM3      PALAFALVVLLAQLVLTTS-----------TTIWMKLAQPESLSDW--------------
Y755_PROMM       PALAFALVVLLAQLILTTC-----------TTIWMKLAQPESLSDW--------------
Y1321_SYNS3      SAIAFGLELVLLQLSLTLS-----------TALWSRLTRSTCLSDW--------------
Y1212_SYNPX      AALQLLIALLSSGALFCLG-----------NGLQTLLTRPPALSDW--------------
Y1151_SYNS9      SAIQLGLELLVLSGTFTTA-----------HAVWGRVTVSPHLSDW--------------
Y1323_SYNSC      AGLHLALDLLLLGATFTLV-----------FELWRVLASSQAISDW--------------
Y1810_SYNJA      PFWETLQQWCFNLVLLTLI-----------TVALIYLVELGLSEQR--------------
Y372_SYNJB       PFWETLQHWCFNLVLLTLI-----------AVVLIYLVELGLSEQR--------------
Y6445_SOLUE      PFYSLLRSYVLAVIIFCVLLYWIAARGWQLRFRMPHLRDAQELDPA--------------
Y1303_METHJ      PFYTILIQYLLALFVFTLI-----------ISSVMYAAHRAGVRIDEYGVFQYIPGPFPF
Y4385_TRIEI      PLYEGIKEWLFTLVFAGLI-----------ISIIVYA----------------LKGKFTA
Y086_CLOTE       PFLQSIYVLILRVLVFLVI-----------YTLILYFIINLKDKIK-----EINFRKTLN
Y852_CLONN       PLIESIYNSLLSLLILLAV-----------ITVIVYMFLNIKDRVTL---GHKIDRNFIN
Y010_CLOAB       PLIESLYGVMLLFLIFMAV-----------LTVILYIVLSLRDRVY----NRNIGGINIS
Y011_CLOPE       PLVQSLFSTAISLIIILVL-----------ITVIIYLALGFKDKIY------QNKDNVIN
Y011_CLOP1       PLVQSLFSTAISLIIILVL-----------ITVIIYLALGFKDKIY------QNKDNVIN
Y011_CLOPS       PLVQSLFSTAISLIIILVL-----------ITVIIYLALGFKDKIY------QNKDNVIN
Y1630_DESHY      PFFITIYNAFFGPLFFLTF-----------FTIVFYSFAGVIHFQS-----------LLI
Y1421_ARCFU      PFLKIVIGSLLAALLISLA-----------IAAFAYMYAFRWVKSL--------------
Y2689_PELPD      PLMETITAFAGFTLLTSLF-----------LTVLVYTVRGGICLSE--------------
Y3567_PELPD      PLLDAVKGVSGFIILAAAA-----------LATAVYYVRGGILLTE--------------
Y2333_GEOSL      PLLEHVKGFVAFTVLVTGI-----------MVGAVYFFRGGIILSD--------------
Y1139_MOOTA      PLYHFLYKLLITAVVGAVL-----------VTGFFYFIFNPRELLG--------------
Y1161_SYNWW      TFYKFAYGTLMMALILLII-----------TLGSIYLINASTNLLF--------------
Y7333_BRADU      PAYILIKNWMMLALALSAL-----------FAAAIYLVHGEIEYDI--------------
Y1615_CUPNH      PAYLALRNWLLLLLGCSAV-----------LAGVVYGLRGDIALVR--------------
Y2225_SALRD      PFLQSLQSAVVGLAFLGLL-----------ALVTGYVIAGQIGIQD--------------
Y961_NITOC       PIYVLILQRLLISFLLLLA-----------SLTLFYWIENRLLSQH--------------
Y2137_SYNFM      PIYTLVQRRLLIAFVLLLV-----------GLVALYLLERRLLARQ--------------
Y2716_METCA      PILVLIQSELLVCASVLAV-----------MVAALYWVEHEFSPAH--------------
Y786_CORGL       PMLRLIADSLSMMLIVAFLI----------ALVGHYLMGGIRAGNQMTGQK---------
Y802_COREF       PMLRLITSSLSTLLVVAFII----------ALVGHYLLGGIRPGNQMTGQK---------
Y733_CORDI       PALRLVVSTFSVLLVVAFLI----------ALVGHYLLGGIRAGNQAAGVK---------
Y1603_CORJK      PFLQMLVSTFSVLLILAFVI----------NGIGHYLLGSITTGNPRVGEK---------
Y065_MYCBO       PFYRSVLNWLFVAVVLAFLA----------SLLTHYLFGGLRLTT-GRGML---------
Y095_MYCBP       PFYRSVLNWLFVAVVLAFLA----------SLLTHYLFGGLRLTT-GRGML---------
Y064_MYCTU       PFYRSVLNWLFVAVVLAFLA----------SLLTHYLFGGLRLTT-GRGML---------
Y8670_RHOJR      PFYRLILAWLFIAVFLALLI----------GLGTHYLFGGIRLAP-SKDHV---------
Y4526_NOCFA      PFYRMVLNWMFVAVVIAFFA----------SLVTHYIFGGLRLSG-REGTL---------
Y6389_RHOJR      PFYRFVLNWLFVAVLLAFFA----------SLVTHYIFGGLKLAG-RGGAL---------
Y3215_MYCBO      PFYRLMLSYMLVSVFLAFVA----------NLVAHYIFGGIRLSG-RTGAL---------
Y3193_MYCTU      PFYRLMLSYMLVSVFLAFVA----------NLVAHYIFGGIRLSG-RTGAL---------
Y3215_MYCBP      PFYRLMLSYMLVSVFLAFVA----------NLVAHYIFGGIRLSG-RTGAL---------
Y3291_MYCPA      PFYRLLLSYLFVAVFLAFVA----------NLLAHYIFGGIRLSG-RTGAL---------
Y4137_MYCA1      PFYRLLLSYLFVAVFLAFVA----------NLLAHYIFGGIRLSG-RTGAL---------
Y2505_MYCUA      PFYRLLLSYLFVAIFLAFVA----------NVVSHYLFGGIRLTG-RSGAL---------
Y644_MYCLE       PFYRLVLSYVFVAVFLAFVV----------NLLAHYIFGGIRLSG-RTGAL---------
Y1433_MYCSK      PFYRLVLSYLFVATFLAFIA----------NLLGHYLFGGIRLTG-RNGAL---------
Y1415_MYCSS      PFYRLVLSYLFVATFLAFIA----------NLLGHYLFGGIRLTG-RNGAL---------
Y1469_MYCSJ      PFYRLVLSYLFVATFLAFIA----------NLLGHYLFGGIRLTG-RNGAL---------
Y1814_MYCVP      PFYRLMLTYLFAATFLAFIA----------NLLGHYLFGGIRLAG-RSGAL---------
Y1102_SACEN      PFWRFLLSWSFVAITVGFIG----------ALVTHYIFGGIRLAG-RSGQV---------
Y3055_STRAW      PWYRFLLGFGFAAAVLSLIA----------AALTHYLYGGLRITSPGARAT---------
Y5204_STRCO      PWYRFLLGFGFAAVIISVIA----------AALTHYLYGGLRVTSPGARAT---------
Y541_THEFY       PFLQVIIGYLYTAVVIAFIA----------GVVVHYLYGGVRLQAQGQRVT---------
Y1530_NOCSJ      PWLHYLVDYAMAVLVVALIA----------AAVVHYLYGGIRLQTPRDRLS---------
Y6027_FRAAA      PFQRFLLGFLLTAVLLSLLV----------TVLTHYLFGGIRLQTPGERVT---------
Y3781_FRACC      PFQRFLLGFLLTAVLLSLLV----------TLLTHYLFGGIRMQTTGERVT---------
Y2732_PAEAT      PFLGFITGFLISIAVVAGIA----------GILTHYLYGSIRLMERG-------------
Y2749_ARTS2      PFLGFVTGFLISVVVVAGIA----------GILTHYLYGSIRIMERG-------------
Y930_LEIXX       PFYRSAVGFASAVVLISLLA----------TLATCYLYGSIRLSGRE-------------
Y644_TROW8       PFYRRLLFFLLVTFVLGGIL----------SILISVVYGALRVDGKE-------------
Y641_BIFAA       PGLKLIMSAVSLLLLAGIIF----------SIVTHVLMGGIRITMPVNGHGL--------
Y1029_BIFLO      PGLKLVLAAVAMLLGVGLVF----------SVVTHVLMGGIRITMPVNGRGL--------
                 .                                                           

Y1037_NOSS1      ---IFPGFSPQQQRHLYGMGGLLMLMVAFSYWLSRYELVYSPRG-------VSYGASYTD
Y3693_TRIV2      ---IFPGFSPQQQRHLYGMAGLLMLMVAFSYWLSRYELVYSPRG-------VSYGASYTD
Y938_TRIEI       ---NFYQFSQQQEKHLHGLGGGFILTIAFSYFIACFELLYSRRG-------VVYGAGYTD
Y1193_THEEB      ---KFLGFVRSQRRHLQGLSAFVFATVALSFWLERYKLLYSTKG-------AAFGAGYTD
Y1060_SYNY3      ---RFPGFSAAQLRHISALGAAVALTLGVEHWLKRYDYLFANHG-------VVYGANYTD
Y2310_SYNP6      ---EFRGFAPSQQRHLVRLAIAIALFLAGHCWLAQRQLLFSELG-------AVYGIGFTD
Y1783_SYNE7      ---EFRGFAPSQQRHLVRLAIAIALFLAGHCWLAQRQLLFSELG-------AVYGIGFTD
Y1461_PROM3      ---VFKGLSPRQCDVMRPLIGIILLTLSALLWLSRHELLWTQNG-------TVAGAGWLD
Y755_PROMM       ---VFKGLSPRQCNFLRPLIGIILLTLSALLWLSRHELLWTQNG-------TVAGAGWLD
Y1321_SYNS3      ---AFPGLTARQRHGLRPGFALVLMSFSGLMWLSRHQLLWTQDG-------IVAGAGWLD
Y1212_SYNPX      ---SCAVPGPRNRRLLMLMAALVLVLLAGQCWLSRHALLWHQHG-------IVAGAGWLQ
Y1151_SYNS9      ---SMPALGNRSYRWLSIGVGTNLLGVAGLVWLSRHQLLWHQHG-------LVAGAGWLQ
Y1323_SYNSC      ---ASPAFSPRQMRLIRLLSALLLFGAAGLVWLSRHQLLWTQHG-------LVAGAGWLQ
Y1810_SYNJA      ---LTLALSLFAQRHLLILGGALFLLRAWGHWLERYELLYSTRG-------VVFGAGFAD
Y372_SYNJB       ---LTLALSLYAQRHLLILGGSLFLIRAWGHWLERYELLYSTRG-------VVFGAGFAD
Y6445_SOLUE      ---FFKLEGGLESRFLRGAAVIGLIALAVRFYLGRYEMAYNEHG-----S-FLVGIDYVD
Y1303_METHJ      GLSWKD-TVGRFLPQVNCLLFLIFTTLAAFLWLTRYSTLYTSKG-------TVIGAGYTD
Y4385_TRIEI      GRQWQNFLTGSIKTHISLLLAGVTILIAVGFWFERYELLFDSNG-------VVFGAGYTD
Y086_CLOTE       IKSIKNDVKDFAGKQLAVVSAIILLFLSMGYIIKSRNLVYSPRG-------LIFGASYTD
Y852_CLONN       INNFKSGITKFAGKQLAILGALLLLCISVGYLIKAWNLSYSPRG-------VAFGASYTD
Y010_CLOAB       FKEFFKGLSDFAGRQFAIISGLIMFLVAVGYAIRSFNLVYSPRG-------VVYGGGYTD
Y011_CLOPE       INSKTYGIRKFAGKQLAVLASVLSLLIGCSYLLKSYNLVYSTRG-------VSYGAGYTD
Y011_CLOP1       INSKTYGIRKFAGKQLAVLASVLSLLIGCSYLLKSYNLVYSTRG-------VSYGAGYTD
Y011_CLOPS       INSKTYGIRKFAGKQLAVLASVLSLLIGCSYLLKSYNLVYSTRG-------VSYGAGYTD
Y1630_DESHY      WKKQAIEINSAARRHLALLITVLFLFKGFGCYFDTFRLLYSQHG-------LVLGAGYAD
Y1421_ARCFU      -EEFKEIFPGSGFMHFSALLFASFLLSAALIYLSRFEIVHSEHG-------LISGASYVD
Y2689_PELPD      ---RGVAIDGTVRRHLAILLLLLSCVIAAGFHLDCFRLLFSSNG-------IFHGAGYTD
Y3567_PELPD      ---RGVAIDEKVRRHLAVLVGIFACAVAAGFYLDSFKLLYADNG-------AFYGAGYVD
Y2333_GEOSL      ---RGADVDGAVRRHLAILLGIFSLTLATGFYLDAVRLLLAGGN-------SFHGAGYVD
Y1139_MOOTA      ---LRRGHFSRPLVHFSTLVALLFLIQAWGFRLQALDLVRSSRG-------VAFGASYTD
Y1161_SYNWW      ---GNWRQFSFAKGHMATLLAAIFLLKAWGYKLAAYDILFSPAG-------IVYGATYSD
Y7333_BRADU      ---HRRSMSSTVIAHGSALLGLLFAVKAWSFGLDRYLLLYGDNG-------VVVGASYTD
Y1615_CUPNH      ---SPRGLSPAAATHGSALLGLFFALQAWSYWLDRFMLLYGDNG-------VVVGASYTD
Y2225_SALRD      ---GGFEADSGALRHLGANLIFLLLGWAWGFYLDLYELLQEGGG-------AVYGAGYTD
Y961_NITOC       ----GKRLPTGAKWHLSILVLMVFFIEIWDFFLQRNGLVYSEAH-----QPLFSGPGFVE
Y2137_SYNFM      ----EQPIPAGARLHLSILILLIFLIETWDYVLQRYELLYSEAH-----MPLFYGGGFVE
Y2716_METCA      ----RRPWPRGARIHLNLLVVLVAVVAAWGYVLQRDELLYVDAH-----EPVFFGPGLIE
Y786_CORGL       -----SFVSRGARTQLAVTAGLWMLVKVAGYWLDRYDLLTK-----ENS--TFTGASYTD
Y802_COREF       -----AFISRGARAQLAVTAGLWMLVRVATYWLERYDLLTR-----ENA--TFTGAGYTD
Y733_CORDI       -----GSITNYAKVQLAVTGGLYLLVRMASYWLDRYSLLNN-----SHE--TFTGGSYTD
Y1603_CORJK      -----ASISTNARRQLAVIAGVWMLLKAVGYWFDRYGLLTR-----SHE--TFTGASYTD
Y065_MYCBO       --------TQAARVQLAVFAGAVVLLKAVAYWLDRYELLSSG---RKEP--TFTGAGYTD
Y095_MYCBP       --------TQAARVQLAVFAGAVVLLKAVAYWLDRYELLSSG---RKEP--TFTGAGYTD
Y064_MYCTU       --------TQAARVQLAVFAGAVVLLKAVAYWLDRYELLSSG---RKEP--TFTGAGYTD
Y8670_RHOJR      -----IEVSRPARVQLAVFAGTFIALKAASYWLDRYSLLWSG---RKEP--TFTGAGYTD
Y4526_NOCFA      --------TRPARIQLAVIAGLFVLLKAVAYWFDRYDLLSSS---RKEP--TFYGGSFTD
Y6389_RHOJR      --------TNAARVQLAVLAGTFILLKAVAYWFDRYSLLSSS---RKEP--TFTGGSYTD
Y3215_MYCBO      --------SRSARVQLVSLVGVLVLLKAVAYWLDRYELLSHT---RGGK--PFTGAGYTD
Y3193_MYCTU      --------SRSARVQLVSLVGVLVLLKAVAYWLDRYELLSHT---RGGK--PFTGAGYTD
Y3215_MYCBP      --------SRSARVQLVSLVGVLVLLKAVAYWLDRYELLSHT---RGGK--PFTGAGYTD
Y3291_MYCPA      --------SRSARIQLVTLVGLLVLLKAVAYWLDRYELLSHT---RGGK--PITGAGYTD
Y4137_MYCA1      --------SRSARIQLVTLVGLLVLLKAVAYWLDRYELLSHT---RGGK--PFTGAGYTD
Y2505_MYCUA      --------SRSARIQLVSLVGVLVLLKTVAYWLNRYELLSHT---RGGK--PFTGAGYTD
Y644_MYCLE       --------SRLARLQLVSLVGVLVLLKAVAYWLDRYELLSRT---RSSK--PFTGAGYTD
Y1433_MYCSK      --------TRSARIQLVTLVGILILLKAFAYWLDRYELLSHT---RGGK--PFTGAGYTD
Y1415_MYCSS      --------TRSARIQLVTLVGILILLKAFAYWLDRYELLSHT---RGGK--PFTGAGYTD
Y1469_MYCSJ      --------TRSARIQLVTLVGILILLKAFAYWLDRYELLSHT---RGGK--PFTGAGYTD
Y1814_MYCVP      --------SRAARIQLIALVGFLMLLKAVAYWLDRYELLSHT---RGGK--PFTGAGYTD
Y1102_SACEN      --------AAPARIQLSVLAGLFVLLKAVDYFLDRYDLLLSD---RNS---LFTGATYTD
Y3055_STRAW      ---------AAATGHLSVLLGIFVALKAVAYWLDRYGLAVKSSDFKATG--NWTGLRYVD
Y5204_STRCO      ---------AAATGHLSVLLGVFVALKAVAYWLDRYGLAVKSSDFKATD--NWTGLRYVD
Y541_THEFY       ---------PAARVHLSVLLGVFLLLRAADYWLEQYGLVFSN-----RG--YTFGASYTD
Y1530_NOCSJ      ---------GAAQAQISVLLGFFVLAKAADYWLDRFDLVSQG-----GG--VITGMTYTD
Y6027_FRAAA      ---------PAAKAHISVLLGLLALLKAWAYYLDRFGSVFSS-----RG--VATGASYTD
Y3781_FRACC      ---------PAAKAHISVLLGLLALLKAWAYYLDRFGSVFSS-----RG--VGTGASYTD
Y2732_PAEAT      ----I-FTSRAAQIHIAVTGALFLILLGVNFWLDRYTTVQ-----SNSG--RWAGALYTD
Y2749_ARTS2      ----I-FTSRAAQIHLAVTGAVFLLLLGVNFWLDRYSSVQ-----NSNG--RWAGALYTD
Y930_LEIXX       ----V-RIARAARVQISVIAAVYLLLQGVSVWLDRYATVTDA---NVNN--MINGAAYTD
Y644_TROW8       ----I-WLSKGARVQYAVLAAGIFVLLGLEFWLNRFDTLLS----DRSG--LITGAAYVE
Y641_BIFAA       ----F-RITKRARRQIGIWLMLNMFAWAANQVLGVFSHLTE-----EGS--RITGATYTT
Y1029_BIFLO      ----F-SITKRCRRQLGIWLMLNMFAWAVRQMIGVFDQLTV-----QGS--RITGASYTA
                                                 :                     *     

Y1037_NOSS1      VVVQLPIYNILCVLGLAIAFYLLWRTIFWRAKSQY-------------RQFVFYGLGA--
Y3693_TRIV2      VVVQLPIYNILCVLGLAIAFYLLWRTIFWRAKSQY-------------RQFVFYGLGV--
Y938_TRIEI       IKVQLPAYVFLGILALLIAFFLFWQAIFSVKSIQSYIE----------ASLWFLRLGRKR
Y1193_THEEB      VTVRLPLYGWLSASAFGVACLLAWSAIRRGGEQRRLGP----------IAPGLFGFTLG-
Y1060_SYNY3      IHWRLPVETGLAIFSMAIAIWLGWLSVKGWPRAKGTGAP------QRRGQLPIIGLWLPV
Y2310_SYNP6      RWVKLPLLQVWMILFGIAAIALFWQSRRGLLPQRW---------------IRNFQLAA--
Y1783_SYNE7      RWVKLPLLQVWMILFGIAAIALFWQSRRGLLPQRW---------------IRNFQLAA--
Y1461_PROM3      AHLILPLRSLASLAILVLAFLVIPFPWIQ-------------------QRR-LWRLIASI
Y755_PROMM       AHLILPLRSLASLAILVFAFLVIPFTWIQ-------------------QRR-LLRLIASI
Y1321_SYNS3      VHLLLPLRSLGSIALLVLAFVVLPSPFSS-------------------VRRRQLRLILAF
Y1212_SYNPX      QAVTEPFRMLLTVELLLLALAVMLPSSLL-------------------LRRRLLGVLAVT
Y1151_SYNS9      QHLTLPFRSLLAFVLLVLGVSCIVRGIGH-------------------LQRLLLLCVAAI
Y1323_SYNSC      AHMTLPLRGFATLLLLLMGLALLLPCQRR-------------------LRQFLALALATL
Y1810_SYNJA      VHATLPATTLMSGVAFLTAVGFWALARQGIRFNLPLFKS------WCPAWASSLLAPALL
Y372_SYNJB       VHATLPATTLMSGVAGLTAVGFWALARQGIRLNLPFLKS------WCPSWASSLLAPAIL
Y6445_SOLUE      QNIGLPLQWLVIFACLAAAAFVAMGRWFLAALMAL-------------------------
Y1303_METHJ      VTITIPALTILTVIAFLIGLLFLLNEKIKR------------------SEMIAYGIGGFF
Y4385_TRIEI      VHAKLFAYWAMAIVALLLAVVCVLSVWKNN------------------IIWPTYGIVIYI
Y086_CLOTE       INISLLIYRIIIIVSFIGSIVVFISIINKK------------------IKPIIISLVLIF
Y852_CLONN       TKITLKFYIAISIVSIISSIIVAFSILKSK------------------VKPIISCVILIA
Y010_CLOAB       IHVSLVFYVIIIAAAIVSSVVIFTSIIKYK------------------IKPIFVSIVAIL
Y011_CLOPE       VKITMIFYKVIAVACVISSIVVFISILKLK------------------FRPIIISIASIA
Y011_CLOP1       VKITMIFYKVIAVACVISSIVVFISILKLK------------------FRPIIISIASIA
Y011_CLOPS       VKITMIFYKVIAIACVISSIVVFISILKLK------------------FRPIIISIASIA
Y1630_DESHY      LHATLPALKALLVLCALGVIGGGLAFFKDE------------------VRLLTLPILAIF
Y1421_ARCFU      VNILSPSLMFLSAIVLLSGIFAAYIVARRR------------------VERVFQIVGVLF
Y2689_PELPD      VHSRLPTYRILTILAPLAGTALAIGLWKGA------------------WRMALLAPLAVI
Y3567_PELPD      VNSRLLTYRVLTFLTPLAGAMLAIGIWKGV------------------WRMALLAPAIVV
Y2333_GEOSL      VNARLPLYRILTLATPLAGAVVAFGLWKGA------------------WRLTLIPPIIVA
Y1139_MOOTA      IHALLPGYNILGWVAVACGLIIVLNAFRRN------------------LKLVSAGILSFM
Y1161_SYNWW      IFARLLSYRILLLLSIIIAAVILANIFVKK------------------FKWILISLGAWV
Y7333_BRADU      VHVGLPALWLMIGLSGIAALAAWANVRVRT------------------YRLPAAAFLLVA
Y1615_CUPNH      VHVGLPVLWLQVGLAAAAAAASWANMRWRD------------------YRVPAAAALLVV
Y2225_SALRD      VNVVIPALYVMVAATLVLAGLVGLNLYRRR------------------LRLLGIGGAGYL
Y961_NITOC       MRVILPFIWLSMFFLLGIAFFLLLFIHKRKG-----------------LKTLAVFSLLFI
Y2137_SYNFM      MYVIWALIWLTLFFLMGTAFSMIAFIQTRKG-----------------LKPLVVFAVGFV
Y2716_METCA      LRYHLPLIWVEIVSLVVGVVAALWFAQRHRG-----------------LKLALTCALVWV
Y786_CORGL       INAQLPAKIILLVIALFVAIAFFS------------------AIFLKDLRIPGLAVVLML
Y802_COREF       INAHLPAKIILMVISIIVAVAFFS------------------AIFLRDLRIPGLAVVLLV
Y733_CORDI       INAVLPAKIVLLVISAVVAISFFS------------------VIVTKDLRIPAISTVLMI
Y1603_CORJK      INAVLPAQIVLLVISIFVAAMFFV------------------TIVLRDLRIPALAVALMV
Y065_MYCBO       IHAELPAKLVLVAIAVLCAVSFFT------------------AIFLRDLRIPAMAAALLV
Y095_MYCBP       IHAELPAKLVLVAIAVLCAVSFFT------------------AIFLRDLRIPAMAAALLV
Y064_MYCTU       IHAELPAKLVLVAIAVLCAVSFFT------------------AIFLRDLRIPAMAAALLV
Y8670_RHOJR      INAVLPARLIMVAIAVLCAVAFFA------------------AIAVRDLRIPAMATALLV
Y4526_NOCFA      INAVLPAKLILLAIAVICAVAFFA------------------GVVLRDLRVPAMAAALLV
Y6389_RHOJR      MNAVLQAKLILLAIAVICAGAFFA------------------AIFLRDLRIPAMATALLV
Y3215_MYCBO      INAVLPAKLILMAIALICAAAVFS------------------AIALRDLRIPAIGLVLLL
Y3193_MYCTU      INAVLPAKLILMAIALICAAAVFS------------------AIALRDLRIPAIGLVLLL
Y3215_MYCBP      INAVLPAKLILMAIALICAAAVFS------------------AIALRDLRIPAIGLVLLL
Y3291_MYCPA      INAVLPAKLILMAIALICAAAVFS------------------AITMRDLRIPAIGLVLLL
Y4137_MYCA1      INAVLPAKLILMAIALICAAAVFS------------------AITMRDLRIPAIGLVLLL
Y2505_MYCUA      INAVLPAKLILMAIAVICAAAVFS------------------AIVLRDLRIPAIGLVLLL
Y644_MYCLE       INAVQPAKLILIAIALICAAAVFS------------------AITLRDFRIPAIGLVLLM
Y1433_MYCSK      INAVLPAKLILLAIAVICAVAVFS------------------AIVLRDLRIPAIGVVLLL
Y1415_MYCSS      INAVLPAKLILLAIAVICAVAVFS------------------AIVLRDLRIPAIGVVLLL
Y1469_MYCSJ      INAVLPAKLILLAIAVICAVAVFS------------------AIVLRDLRIPAIGVVLLL
Y1814_MYCVP      INAVLPAKLILMVIAVICAAAVFS------------------AIVLRDLRIPAIGVVLLL
Y1102_SACEN      LNALMPVKLILMIIAVFCALAFFA------------------AIFLRNLQIPAIATVLLV
Y3055_STRAW      ANAYLPAKTILFCIAVICALLFFA------------------TLWRRTWQLPVIGFGLMV
Y5204_STRCO      ANAYLPAKTILFCIAVICALLFFA------------------TLWRRTWQLPVIGFGLMV
Y541_THEFY       VNAVLYAKIILFFIALVCAVLFFA------------------NIYFKNARVPLVSLGLMV
Y1530_NOCSJ      DHAVLPAKNILLGISIICAVLFFV------------------NVWRRTWLLPSVGLALLA
Y6027_FRAAA      VHAVLPAKLILLFISLACAVLFIY------------------NIFQRGWTLPLLGAGILV
Y3781_FRACC      VHAVLPAKLILLFISLACAVLFIY------------------NIFQRGWTLPLLGAGILV
Y2732_PAEAT      VNAVVPTKAILAVAAGLVAILFII------------------AAIIGRWRLPVIGTAMLV
Y2749_ARTS2      VNAVIPTKSILAVAAALVAILFIV------------------AAVIGKWRLPVIGTAMLV
Y930_LEIXX       VSATIPGQAVLAVAAVFVALLFAV------------------TAFTGRWRFPVVGTALLI
Y644_TROW8       VNALIPGFAVLALVALGVALLFCI------------------TAFTSRWRLPIIGVALAV
Y641_BIFAA       VNATIPVTFIMAAITAILGVILGLWIMKSHTLEGSAPIAARASEALKAWKVPTVAIASAI
Y1029_BIFLO      VHANIPVTFIMAALTAILGVVLGIWLMRSHTLEGQASIGVRASAALKAWRVPVTSIAVVV
                                                                             

Y1037_NOSS1      -----------------------YLFVVVAAGSVLPTIVQYLIVQPNELQREQTYIQRTI
Y3693_TRIV2      -----------------------YLFVVVAAGSVLPTVVQYLIVQPNELQREQPYIQRTI
Y938_TRIEI       KRKKKVIAKLFANSYSLRAILTWYLIIAVIAGWLIPKIVQMAIVQPNEIEREIPYIKRSI
Y1193_THEEB      -----------------------YLGVILIVDWLLPTAIEAAIVQPNQLQRELPYIQRTI
Y1060_SYNY3      A----------------------VYLLILLLQNLGGWAIELLVVQPNQLTRERPYLARNI
Y2310_SYNP6      -------------------------IASVLIWVTLPAIVQQLVVQPNEIARELPYLKQAI
Y1783_SYNE7      -------------------------IASVLIWVTLPAIVQQLVVQPNEIARELPYLKQAI
Y1461_PROM3      IG-----------------------VGAILLEVLLAPFVQWMVVKPRELKLETPYIIRAI
Y755_PROMM       IG-----------------------VGAILLEVLLAPFVQWMVVKPRELKLETPYIIRAI
Y1321_SYNS3      IA-----------------------IASFGLEMVLFPLMHWLVVRPRELQLERPYISRAI
Y1212_SYNPX      L----------------------------ALGFSLTPLSRWLILRPQELSLQTPYLEEAI
Y1151_SYNS9      V----------------------------IIESTLTPLTRWLVVRPQELALQAPYLETAI
Y1323_SYNSC      V----------------------------MLETLATPLTRWLVVRPREFALQERYLKNAI
Y1810_SYNJA      WGA--------------------YLGFGLLTTRLYPQLLQTLLVTPNELELERPYIEHNI
Y372_SYNJB       WGA--------------------YLGFGLLTTQLYPQLVQTFLVTPNELELERPYIEDNI
Y6445_SOLUE      ---------------------------ALVVDFAAPRIVSALYVRPNEISLQRPYIETHI
Y1303_METHJ      II-A-------------------------ILSAGAGFLVQTLIVEPNEFNLERTYLGYNI
Y4385_TRIEI      VLLG-------------------------LFNVLYPWFQQKFIVNPNELQKEKPYIANNI
Y086_CLOTE       LLI--------------------------LSEGATSKLVQTFVVNSNEKKLEEPFVRYNI
Y852_CLONN       VLV--------------------------ISERVVSGAWQMLVVKSNERRLETPFIEYNM
Y010_CLOAB       ILI--------------------------IGQSITAEIVQNLIVKSNEKNLEAPYIKNNI
Y011_CLOPE       VLI--------------------------VLEPVVAIFTQQFVVKPNEMELEKPYISYSI
Y011_CLOP1       VLI--------------------------VLEPVVAIFTQQFVVKPNEMELEKPYISYSI
Y011_CLOPS       VLI--------------------------VLEPVVAIFTQQFVVKPNEMELEKPYISYSI
Y1630_DESHY      ISIP-------------------------LLSGLGPMVLQSLVVIPNELEKETPYIQNEI
Y1421_ARCFU      VIAI-------------------------LLTFVAPFFVQKFVVEPSELSYEGRYIAYSI
Y2689_PELPD      VLHV-------------------------IGIRVYPGLLQKFKVAPNELALEAPYIRNNI
Y3567_PELPD      ALYM-------------------------LGIRVYPGVLQKFKVAPNEMALETPYIMNNI
Y2333_GEOSL      AVYG-------------------------IGIVGYPAMLQKFKVAPNELALETPYIANSI
Y1139_MOOTA      AAYF-------------------------LLVIAVPLAVQKFQVEPNEFAREEPYLRYNI
Y1161_SYNWW      LVAV-------------------------LMGSVYPSLIQKLVVQPNEFNKEKPYIENAI
Y7333_BRADU      IGSF-------------------------VLSGLVPVLFRQFFVRPSELELERPYIERNI
Y1615_CUPNH      GSAI-------------------------VLGTIWPALFQRFYVKPNELQLETPYLQHNI
Y2225_SALRD      VLLV-------------------------GGLVLAPSLVTQLTVLPSELQVERPYLENNI
Y961_NITOC       LSLG------------------------ARHFHFLHWATQEYIVKPNELSIQKPFIENSI
Y2137_SYNFM      LVLG------------------------LRYSAFLPATVEKLVVKPNEVSRERDFIVNNI
Y2716_METCA      SAAA------------------------LRKIDVVPQLIDRFVVKPNPVKTEREFIKYNI
Y786_CORGL       LSSV-------------------------IIGAAWPLMLERFSVQPNRAEKEAEYISRNI
Y802_COREF       LSSV-------------------------VVGAVWPLMLERFSVQPNRAEKESEYISRNI
Y733_CORDI       VSSL-------------------------AIGNAWPIMMERFSVSPNRAEKESEYISRNI
Y1603_CORJK      GSSL-------------------------TVGLAWPAMLEQFSVNPNRAEKEREYIARNI
Y065_MYCBO       LSAI-------------------------LVGGLWPLLMEQFSVRPNAADVERPYIQRNI
Y095_MYCBP       LSAI-------------------------LVGGLWPLLMEQFSVRPNAADVERPYIQRNI
Y064_MYCTU       LSAI-------------------------LVGGLWPLLMEQFSVRPNAADVERPYIQRNI
Y8670_RHOJR      LSAI-------------------------LVGGIYPALIEQFSVRPNAADRESPYIERNI
Y4526_NOCFA      LSSV-------------------------LVGAVYPLVVEQFSVRPNAADKESEYIERNI
Y6389_RHOJR      LSSI-------------------------LVGAVWPLVVEQFSVRPNAADKESAYIERNI
Y3215_MYCBO      LSSL-------------------------IVGAGWPLIVEQISVKPNAAQKESEYISRSI
Y3193_MYCTU      LSSL-------------------------IVGAGWPLIVEQISVKPNAAQKESEYISRSI
Y3215_MYCBP      LSSL-------------------------IVGAGWPLIVEQISVKPNAAQKESEYISRSI
Y3291_MYCPA      LSSL-------------------------IVGAGWPLIVEQISVKPNAAQKESEYISRSI
Y4137_MYCA1      LSSL-------------------------IVGAGWPLIVEQISVKPNAAQKESEYISRSI
Y2505_MYCUA      LSSL-------------------------IVGAAWPMIVEQISVKPNAAQKESEYISRSI
Y644_MYCLE       LSSL-------------------------IVGTGWPLIVEQLIAKPDAVRKESEYIRRSI
Y1433_MYCSK      LSSL-------------------------VVGAGWPLVVEQFSVKPNAAQKESEYISRSI
Y1415_MYCSS      LSSL-------------------------VVGAGWPLVVEQFSVKPNAAQKESEYISRSI
Y1469_MYCSJ      LSSL-------------------------VVGAGWPLVVEQFSVKPNAAQKESEYISRSI
Y1814_MYCVP      LSSL-------------------------IVGAGWPLVVEQISVRPNAAQKESEYISRSI
Y1102_SACEN      LSSI-------------------------LVGSVWPALLEQFSVRPNANQREALSIERNL
Y3055_STRAW      LSAI-------------------------LIGGLYPAIVQKFQVQPNEQAKEAPYVEKNL
Y5204_STRCO      LSAI-------------------------LIGGLYPALVQKFQVQPNEQAKEAPYVEKNL
Y541_THEFY       LSAI-------------------------LIGGVYPAIVQQVTVSPNEQRLERPYIQRNI
Y1530_NOCSJ      VSAI-------------------------LLGLIWPGIVQQFQVKPSEADKEAPYIEKNI
Y6027_FRAAA      LSSV-------------------------VIGGIYPAFIQQFQVRPNEATREQPYIERNI
Y3781_FRACC      LSSV-------------------------VIGGIYPAIVQQFQVRPNEATREEPYIARNI
Y2732_PAEAT      ITAI-------------------------LAGGVYPWVIQQFQVRPSENTLEKEFIDRNI
Y2749_ARTS2      ITSI-------------------------LAGGVYPWVIQQFQVRPSEQTLERQFIERNI
Y930_LEIXX       VAAL-------------------------VIGAIYPWAIQRFQVEPSQKTLETPYIQDSI
Y644_TROW8       VSAL-------------------------VVITALPWGVQRFHVDPNARVLESEYIKRNI
Y641_BIFAA       VVSL-------------------------VLTVAWPVLLQRFRVNPNAQEMESTYIQRNI
Y1029_BIFLO      VVGL-------------------------VLTVAWPVLLQRFRVNPNAQEMESTYIQRNI
                                                              .     :   :   :

Y1037_NOSS1      ALTRQAF-GLETIDARTFNPQGDLTTAAIQ-------ANDLTIRNIRLWDQRPLLETNRQ
Y3693_TRIV2      ALTRQAF-SLETIDARTFNPQGNLTTAAIQ-------ANDLTIRNIRLWDKRPLLETNRQ
Y938_TRIEI       TFTKEAYIDVDKLEVELFDPNNELTYDDLI-------NNKLIIENIRLWDTRPILQTNRQ
Y1193_THEEB      THTREGF-NLEKMRVEPFQPENNLNAEILA-------ANAATTRNIRLWDTRPLLETNRQ
Y1060_SYNY3      AATREAF-NLQIIQPATLTGRGQLTPASLE-------RNRLTLNNIRLWDPIPLLKTNRQ
Y2310_SYNP6      LFTRRAF-GLDQIETRTFDPQPSLNRAVLA-------ANRETVQNIRLWDTRPLLQSNRQ
Y1783_SYNE7      LFTRRAF-GLDQIETRTFDPQPSLNRAVLA-------ANRETVQNIRLWDTRPLLQSNRQ
Y1461_PROM3      KATRKAF-QLDSITTTLINPQPQLTQLDLE-------QGASTLRNIRLWDSQPLLATNRQ
Y755_PROMM       KATRKAF-QLDSITTTLINPQPQLTQLDLE-------QGASTLRNIRLWDSQPLLATNRQ
Y1321_SYNS3      EATRHAY-QLDAIETEPFDPSSRLSREDLR-------DGASTLRNIRLWDSQPLLATNRQ
Y1212_SYNPX      RSTRHAF-QLDRITRGSYKPEPSLTKADIV-------QGASTLSNLRLWDSAPLLETNRQ
Y1151_SYNS9      RSTRHGF-QLDRIQRRRTEPNVDLTEEDLE-------SGASTLRNVRLWDSGPLLETNRQ
Y1323_SYNSC      EATQWGF-QLDQIKSQVDDPS-RFSPTDRE-------EGASTLENVRIWDSGPLLEANRQ
Y1810_SYNJA      RFTRAGF-GLAEVEVKPFPEEGSLTWEILQ-------QNQSTLRNVRLWDTEPLLATYRQ
Y372_SYNJB       RFTRAGF-GLADVEVQPFPEGGALTWEILQ-------QNQSTLSNVRLWDADPLLATYRQ
Y6445_SOLUE      HATRSAF-GIEQNVREVEFKAKPEAPIDVA-------ANKPLLDNVRLWDTRAFHDTVTQ
Y1303_METHJ      NSTLDGY-NLANINARDFPVLYNLTETDIR-------NNNATISNIRLWDWRPMKTTLEQ
Y4385_TRIEI      KFTREAY-GLDNVETKSFPAKFELDSQTLK-------NNQGTVRNITLWDYRPLLSTYRQ
Y086_CLOTE       DYTRKAF-DIDDIEEINFDINNNLTAQDIK-------NNKESIDNIRINSFEPALEFYNQ
Y852_CLONN       KYTKKAF-GIANVKEQLYPLTNVLNKKSLE-------NNKETINNIKINSVGQALEFYNQ
Y010_CLOAB       EYTRKAF-NIDKLSESNFPSSDSLTQADID-------SNRDTVNNIKVNSVTPALEFYNQ
Y011_CLOPE       DATKKAF-NIDEIEVKEMEPNENITSEKLE-------DNKDIIENLKVNSTGPLLSFYQQ
Y011_CLOP1       DATKKAF-NIDEIEVKEMEPNENITSEKLE-------DNKDIIENLKVNSTGPLLSFYQQ
Y011_CLOPS       DATKKAF-NIDEIEVKEMEPNENITSEKLE-------DNKDIIENLKVNSTGPLLSFYQQ
Y1630_DESHY      ALTRFAY-GLDQISEEDYQADQPLTSETLQ-------KELPTLNNVRLNDPHPLLRTYTQ
Y1421_ARCFU      NYTLFAY-NLHDVKLQKFDYWDVVNYNDIL-------EAKDTIDNIRIWDHRPIRDVFRQ
Y2689_PELPD      ALTRLGF-DLDKIETIPFDVDTQLSSADIA-------RNDATIKNIRLWDHAPLLKTYSQ
Y3567_PELPD      TATRFGY-DLEKIETVPFDVDTKLTAADIA-------NNDATIKNIRLWDHAPLLKTYSQ
Y2333_GEOSL      RFTRLGY-DLDKIKTVPFDVELNLSAADIA-------KNDATIRNIRLWDHGPLLKTYSQ
Y1139_MOOTA      NFTRRAY-GLDRITIQEFPALDNLTPASLR-------EEGATLDNIRLWDYRPLEQTYSQ
Y1161_SYNWW      KYTRQAY-GLDRAENREFNIDYNLDISDP--------SHQSTIDNIRLWDWQPLRTTYKN
Y7333_BRADU      ALTRQAY-NLDQIAAKPFAAEQKLSFKTLD-------ANKATIDNIRLWDWQPLADTYAQ
Y1615_CUPNH      ALTREAY-GLTQIEVKPFPVEQNLNLAALQ-------ANRPTIDNIRLWDLQPLRDTYAQ
Y2225_SALRD      DMTREAY-ALGDFKERSYPAQPDLPADAVE-------QNEETIDNVRLWDPRLLIDTYRQ
Y961_NITOC       KATLDAY-KLSNVEVRKFERKKALKNIFNA-------KVQDLLHNVPVWDKELVGQVYRQ
Y2137_SYNFM      KATLSAY-NLNTVQTRDFTPARTAADVASP-------KVKAQLRNIPVWDGELLDDVYKQ
Y2716_METCA      EATLAAF-DLDEIRTIDITAAPEGSETIDP-------HVREHLHNIPVWDPEYLDDVYQQ
Y786_CORGL       ESTRYAY-GITDEDVTYEENWGAGETTNEE-----VAADSATISNIRLLDPQILSPTFTQ
Y802_COREF       ESTRFAY-GITDDEVTYIENWGAGGATNAE-----VAADEATISNIRLLDPQILSPTFTQ
Y733_CORDI       EATRYAY-GITDDAVTYKDNWGAKGASSEK-----VASDSATVSNIRLLDPEIISPTFTQ
Y1603_CORJK      EATRYAY-GIGDDKVTYDRDWGASGDAASKEQKKAVADDSATLSNVRLLDPEVLTPTFTQ
Y065_MYCBO       EATREAY-RIGGDWVQYRSYPGIGTKQPRD-----VPVDVTTIAKVRLLDPHILSRTFTQ
Y095_MYCBP       EATREAY-RIGGDWVQYRSYPGIGTKQPRD-----VPVDVTTIAKVRLLDPHILSRTFTQ
Y064_MYCTU       EATREAY-RIGGDWVQYRSYPGIGTKQPRD-----VPVDVTTIAKVRLLDPHILSRTFTQ
Y8670_RHOJR      AATRQAY-GIGPDRVDYLDYPGVGTRSPRD-----IPADVTTIANARLLDPTVLSRTFTQ
Y4526_NOCFA      AATRQAF-GITSDKIEYKDYKGESDKNPLD-----VPVDAATIGNARLLDPNILSPTFTQ
Y6389_RHOJR      AATRQAY-GITDDKVEYQDYQGYGTKPPRD-----VPADVMTIENTRLLDPNILSRTFTQ
Y3215_MYCBO      TATRQAY-GLTSDVVTYRNYSGDSPATAQQ-----VAADRATTSNIRLLDPTIVSPAFTQ
Y3193_MYCTU      TATRQAY-GLTSDVVTYRNYSGDSPATAQQ-----VAADRATTSNIRLLDPTIVSPAFTQ
Y3215_MYCBP      TATRQAY-GLTSDVVTYRNYSGDSPATAEQ-----VAADRATTSNIRLLDPTIVSPAFTQ
Y3291_MYCPA      TATRQAY-GLTSDVVTYRNYTGDAQATAQQ-----VADDRATTSNIRLLDPTIVSPAFTQ
Y4137_MYCA1      TATRQAY-GLTSDVVTYRNYTGDAQATAQQ-----VADDRATTSNIRLLDPTIVSPAFTQ
Y2505_MYCUA      TATRQAY-GLTSNVVTYRNYTGDGEATAQQ-----VAADRATTSNIRLLDPTIVSPAFTQ
Y644_MYCLE       TATRHAY-GLTEDVVTYRNYIGDAPAIAQQ-----IATDHATTSNIRLLDPTIVSPAFTQ
Y1433_MYCSK      AATRQAY-GLTDEVVTYRDYPGNAPATAQQ-----VAADRSTTSNIRVLDPNIVSPAFTQ
Y1415_MYCSS      AATRQAY-GLTDEVVTYRDYPGNAPATAQQ-----VAADRSTTSNIRVLDPNIVSPAFTQ
Y1469_MYCSJ      AATRQAY-GLTDEVVTYRDYPGNAPATAQQ-----VAADRSTTSNIRVLDPNIVSPAFTQ
Y1814_MYCVP      TATRQAY-GLTDEAVEYRDYPGNATATAQQ-----VAADRATTSNIRVLDPNIVSPAFTQ
Y1102_SACEN      AATRSAF-GIGADKVTIKDYPGKTALTPGE-----VADDEGTIPNIRLLDPNVLSDTFTQ
Y3055_STRAW      KATREAY-GIDGAKVTEYPGKSDTTDKTKLR------DDADATASVRLLDPNVVSPTFQQ
Y5204_STRCO      AATRDAY-GIEGTQVAEYPGKSETKDKTKLR------DDADAAASVRIMDPNIISPTFQQ
Y541_THEFY       EATRAAY-GIDGAEVIDYDAQTELT-TAELA------AEAETIPSVRLVDPAVVSQTFQQ
Y1530_NOCSJ      EATRTAY-DVANVDVEKYDPATALG-AGSAS------MVEEETSSVPLVDPQLVRDAFEQ
Y6027_FRAAA      AATRAAY-GIQNVKPQSYAARTDVT-AAQVA------ADTGTVPNTRLLDPSKLSRTFQQ
Y3781_FRACC      AATRAAY-GIQDVEPQDYAASTDVT-AQQVA------ADTGTVPNIRLLDPSKLSRTFQQ
Y2732_PAEAT      KMTRAAY-GLDKIDVSAYNATTTATTGALAA-------DAQTTANIRLLDPNLISSAFAQ
Y2749_ARTS2      SMTRAAY-GLDKIQEKRYNATTNATTGALAP-------DAQTTANIRLLDPNLISDAFSQ
Y930_LEIXX       EATRDAY-GLSDIDVVPYNATTSAEAGALRQ-------DAQTTAQIRIMDPAVISPSFQQ
Y644_TROW8       ESTRFAY-GIDKTHEVLYSAKTDVKPGQLRN-------DARTTASIRILDPGLVSRAFGQ
Y641_BIFAA       DATRAAY-GLDKVKAEQYKATTEGEEGALAD-------SAESTAQIRLLDPQIISPTFKQ
Y1029_BIFLO      DATRAAY-GLDKLKTEQYKVTDKGEQGALAK-------EGDTTAQIRLLDPQVVSPTFKQ
                   *  .:  :                                  .  : .         :

Y1037_NOSS1      LQQFRPYYRFPDAD-IDRYTLEAEAAANRPASANQSPAPAEIAATERRQVLIAARELDYS
Y3693_TRIV2      LQQFRPYYRFPDAD-IDRYTLEAEAAANRPVNPNQLPAPTE-----RRQVLIAPRELDYS
Y938_TRIEI       LQQIRPYYEFINAD-IDRYTFLKKESERTKNNLTK-----------KQQVIIAARELNYE
Y1193_THEEB      LQQLRSYYRFPAAF-LDRYSLKLAPDQDQSE---------------IRQVLIAAREVDYS
Y1060_SYNY3      LQQIRLYYKFSDAD-LDRYTIRVQKDDTQTISTA------------KQQTLIAPRELDYT
Y2310_SYNP6      LQQIRLYYSFPSAQ-IDRYRLQTSFGD------------------ALQQVIIAARELDYT
Y1783_SYNE7      LQQIRLYYSFPSAQ-IDRYRLQTSFGD------------------ALQQVIIAARELDYT
Y1461_PROM3      LQQLRVYYRFSNAA-VDRYRFVPDKAN-------------------RQQVMITARELDQA
Y755_PROMM       LQQLRVYYRFSNAA-VDRYRFVPDVAN-------------------RQQVMITARELDQA
Y1321_SYNS3      LQQLRVYYRFTNAA-VDRYQLRPELLE-------------------RQQVILAARELDQA
Y1212_SYNPX      LQQLRVYYRFPQAS-VDRYPLSPQGDT-------------------PQQVILSARELDQS
Y1151_SYNS9      LQQLRVYYRFSNAA-VDRYPLIPDSDT-------------------SQQVIISARELDQS
Y1323_SYNSC      LQQLRVYYRFSNAA-VDRYPLNQDSDS-------------------SQQVIVSARELDQS
Y1810_SYNJA      LQEIRPYYQFPYVD-VDRYRIGGELRQ----------------------VMHAARELDFA
Y372_SYNJB       LQEIRPYYQFPYVN-VDRYRIGGELRQ----------------------VMHAARELDFA
Y6445_SOLUE      IQALRPYYVFADTD-VDRYTIDGQYRQ----------------------VLLTPRELDLR
Y1303_METHJ      LQLFRTYYTFNDVD-VDRYWLDGNYKQ----------------------VHISAREMNSY
Y4385_TRIEI      LQEMRLYYQFNDVD-IDRYTIDGNYRQ----------------------VMLSPREMVYS
Y086_CLOTE       YQTIRPYYIFNDID-IDRYKINGKESQ----------------------IFISARELNLK
Y852_CLONN       VESKKNYYIFNDID-IDRYKINGKYNQ----------------------VFIAPREIDYE
Y010_CLOAB       VQVVRYYYDFRDLD-VDRYNIGGKYSE----------------------VFLAPREIDSK
Y011_CLOPE       VQLIKNYYEFNDAD-TDRYNINGKYTQ----------------------VFVSPREINRD
Y011_CLOP1       VQLIKNYYEFNDAD-TDRYNINGKYTQ----------------------VFVSPREINRD
Y011_CLOPS       VQLIKNYYEFNDAD-TDRYNINGKYTQ----------------------VFVSPREINRE
Y1630_DESHY      KQGIRPYYKFYNID-MDRYWINGEYRQ----------------------VMLAPREFSYQ
Y1421_ARCFU      LQQIRTYYVIQDVD-VDRYRINDSYVQ----------------------LLLAARELSTE
Y2689_PELPD      LQQIRTYYRFFDVD-NDRYLVNGRYSQ----------------------VMLSPRELSYA
Y3567_PELPD      LQQIRTYYKFFDVD-NDRYMVNGRYSQ----------------------VMLSPRELSYA
Y2333_GEOSL      LQQIRTYYKFFDVD-NDRYLVNGQYTQ----------------------VMLSPRELSYN
Y1139_MOOTA      LQEIRSYYSFKDID-VDRYTLDGRERQ----------------------VMLAARELDQN
Y1161_SYNWW      LQQLRSYYVFDDVD-IDRYTVDGEYRQ----------------------LMLSVREIDQE
Y7333_BRADU      LQEIRTYYKFHHLD-VDRYWLNGSYQS----------------------VMISARELRPS
Y1615_CUPNH      LQEIRTYYKFLATD-IDRYQLGAGYQQ----------------------VMLSARELEPA
Y2225_SALRD      LQEIRLYYEFYSVD-VDRYMLDGDYRQ----------------------VMVSPRELTQQ
Y961_NITOC       LQQLRTYYGFPAEN-VDRYMINGKKQQ----------------------VFLGARELNYD
Y2137_SYNFM      LQQLRTYYTFPSVD-VARYTVNGMPQQ----------------------VFLSVRELDYT
Y2716_METCA      LQGIRPYYSFTEVD-TARYLVNGQIEQ----------------------VNLAAREINLA
Y786_CORGL       QQQLRNFYGFPDQLAMDRF-EVDGKLR---------------------DFVVAARELDPN
Y802_COREF       QQQLRNFYGFPEQLAMDRY-EVDGELR---------------------DFVVAARELDPN
Y733_CORDI       QQQLRNFYGFPKSLAMDRY-VIDGELR---------------------DFVVAARELDPN
Y1603_CORJK      QQQLRNFYGFPDELAIDRY-EVDGKMR---------------------DFVVAARELNPN
Y065_MYCBO       QQQLKNFFSFAEILDIDRY-RIDGELQ---------------------DYIVGVRELSPK
Y095_MYCBP       QQQLKNFFSFAEILDIDRY-RIDGELQ---------------------DYIVGVRELSPK
Y064_MYCTU       QQQLKNFFSFAEILDIDRY-RIDGELQ---------------------DYIVGVRELSPK
Y8670_RHOJR      QQQLKNFYGFPEHLNIDRY-TIDGQLT---------------------DYIVAARELSPN
Y4526_NOCFA      LRQLKNFYGFPESLDIDRY-NLDGNLQ---------------------DYIVAARELSPA
Y6389_RHOJR      QQQLKNFYGFPPTLDIDRY-DIDGQLR---------------------DYIVAARELSSK
Y3215_MYCBO      FQQGKNFYYFPDQLSIDRYLDRNGNLR---------------------DYVVAARELNPD
Y3193_MYCTU      FQQGKNFYYFPDQLSIDRYLDRNGNLR---------------------DYVVAARELNPD
Y3215_MYCBP      FQQGKNFYYFPDQLSIDRYLDRNGNLR---------------------DYVVAARELNPD
Y3291_MYCPA      FQQGKNFYYFPDQLSIDRYLDRNGALR---------------------DYVVAVRELNPD
Y4137_MYCA1      FQQGKNFYYFPDQLSIDRYLDRNGALR---------------------DYVVAARELNPD
Y2505_MYCUA      FQQGKNFYYFPDQLSIDRYFDRNNNLR---------------------DYVVAARELNPD
Y644_MYCLE       FQRGKNFYYFPDQLSIDRYLDKKGNLR---------------------DYVVAARELNPD
Y1433_MYCSK      FQQGKNFYFFPEQLAMDRYRDADGNLR---------------------DYVVAARELNPD
Y1415_MYCSS      FQQGKNFYFFPEQLAMDRYRDADGNLR---------------------DYVVAARELNPD
Y1469_MYCSJ      FQQGKNFYFFPEQLAMDRYRDADGNLR---------------------DYVVAARELNPD
Y1814_MYCVP      FQQGKNFYFFPDQLNMDRYRDEDGNLR---------------------DYVVAARELNPD
Y1102_SACEN      LTQQYNFYGFNEKLDVDRYREPNGQLR---------------------DYLVALREIDTD
Y3055_STRAW      LQQMRNYYAFPTNLDVDRYSK-DGKDQ---------------------DTVIGLRELNLN
Y5204_STRCO      LQQMRNYYAFPTNLDVDRYAK-DGKDQ---------------------DTVIGLRELNLA
Y541_THEFY       LQQVRGFYQFPQVLEVDRYTTSDGETV---------------------DTIVAARELDGP
Y1530_NOCSJ      NQQVRAYYSVAQVLDVDRYDI-DGNDR---------------------ALVLGVRELDQS
Y6027_FRAAA      LQQIRGYYTFPKTLDVDRYTVTGADKKQTTR-----------------DYVVSVRELNQA
Y3781_FRACC      LQQFRGYYGFPPTLDVDRYTVTGADKKSTTQ-----------------DYVVSVRELNQA
Y2732_PAEAT      LEQYRPYYQFPQTLNVDRYMVDGKVQD----------------------TVIAVRELNPD
Y2749_ARTS2      LEQYRPYYQFPSALNVDRYEVDGKVQD----------------------TVIAVRELNPD
Y930_LEIXX       LQQFRQYYSFPRNLNVDRYTLNGSQQD----------------------AVVSVRELNQS
Y644_TROW8       LQQFRQYYTFGDDLSVDRYHLGGETRD----------------------AVVALRELSLS
Y641_BIFAA       LQQSKQYYTFADTVAVDKYDVDGVSQD----------------------TVIAARELDLD
Y1029_BIFLO      LQQSKQYYTFADTLAVDKYEIDGVSQD----------------------TVIAARELDLA
                       :: .       ::                                   **.   

Y1037_NOSS1      AVPEQAQTWINQHLIYTHGYGFTMSPVNTVGPGGLP--------------EYFVKDIAGS
Y3693_TRIV2      AVPEQAQTWINQHLIYTHGYGFTMSPVNTAGPGGLP--------------EYFVKDIAGS
Y938_TRIEI       SVPQPAQTWVNEHLVYTHGYGFTLSPINQVEKNGLP--------------EYFVKNIGPD
Y1193_THEEB      AVQQFARSWINEHLVFTHGYGFTMSPVNTAEANGLP--------------KYFVRDIGDT
Y1060_SYNY3      AVPEKAQTWVNKHLVYTHGYGFTLSPVNLVDQGGLP--------------YYFVKDIGTD
Y2310_SYNP6      AIPAAAKTWVNEHLVYTHGYGFTLSPVNSSAPDGLP--------------RYFVKDIGAN
Y1783_SYNE7      AIPAAAKTWVNEHLVYTHGYGFTLSPVNSSAPDGLP--------------RYFVKDIGAN
Y1461_PROM3      ALPKRSRTWLNRHFVFTHGYGFTLSPVNTRAPDGLP--------------DYFISDLGTS
Y755_PROMM       ALPKRSRTWLNRHFVFTHGYGFTLSPVNTRAPDGLP--------------DYFISDLGTS
Y1321_SYNS3      ALPKRSRTWQNRHFVFTHGFGFTMSPVNSRGADGLP--------------DYFISDIGSS
Y1212_SYNPX      ALPRRSKTWLNRHFVFTHGYGFTVSPVNTRGDDGLP--------------EYFISDLGTD
Y1151_SYNS9      ALPRRSKTWQNRHFVFTHGNGFTVSPVNTRGTDGLP--------------SYVISDLGSN
Y1323_SYNSC      ALPRRSKTWQNRHFIFTHGYGFTVSPVNERRDDGLP--------------SYFIKGLGTE
Y1810_SYNJA      QVPPAAQTWVNRRFFYTHGYGLTLSPVNVVTAEGLP--------------DFFLSDIPPR
Y372_SYNJB       QVPPAAQTWVNRRFFYTHGYGLTLSPVNVVTPEGLP--------------DFFLSDIPPR
Y6445_SOLUE      QLPAARANWINPAFIYTHGYGVVLAPVSQITPDGLP--------------VLFIENAPPE
Y1303_METHJ      NLPQQAQTWVNRHLVFTHGYGAVMSPVDRITTNGLP--------------EFFVKDIPPS
Y4385_TRIEI      QVPRKAQTWVNKHLKYTHGYGLVMNPVNEVKADGLP--------------VLFIKDIPPV
Y086_CLOTE       AIE--PNTWQNRHLIYTHGYGVAMSKVNSVTEEGQP--------------DFSIKDIPQV
Y852_CLONN       KLQEKANTWQNKHLTYTHGYGVVMSKVNSVTAEGKP--------------DFVIKDMPLV
Y010_CLOAB       SLEGNADTWQNRHLIYTHGYGLVMSKVNSVTSEGQP--------------NFVIKDIPPQ
Y011_CLOPE       SMT----TWQNKHLRYTHGYGLAMSRVNSVTEFGQP--------------DFVMKDIPTV
Y011_CLOP1       SMT----TWQNKHLRYTHGYGLAMSRVNSVTEFGQP--------------DFVMKDIPTV
Y011_CLOPS       AMT----TWQNKHLRYTHGYGLAMSRVNSVTEFGQP--------------DFVMKDIPTV
Y1630_DESHY      DLEKTAQTFVNLRFKYTHGFGVVASFANAVTPEGLP--------------AFAIKDVPPT
Y1421_ARCFU      NLPSRAQTWLNKHLIYTHGYGIVASPVNKVSKEGLP--------------EFYIYDIPPE
Y2689_PELPD      DLP--SRNWINERLIFTHGNGITFGPVSRISKEGLP--------------EFFVKDIPAV
Y3567_PELPD      DLP--SKNWINERLIFTHGNGITFGPVSRISKEGLP--------------EFFVKDIPAV
Y2333_GEOSL      DLP--SRNWINERLIFTHGNGLAVGPVSRISREGLP--------------EFFIKDIPAV
Y1139_MOOTA      KLPDRARTWINEKMRYTHGYGLAMNPANTVTAGGQP--------------EFIAGDLPFH
Y1161_SYNWW      ELPQQAKTWINQRLMYTHGYGLVVSPVTEVAEEGFP--------------QFFVKDIPPR
Y7333_BRADU      LLPPNAQTWVNHHVLFTHGTGAVMSPVTRKSSEGLP--------------FLYLRDIPPV
Y1615_CUPNH      LIPANAQTWVNLHLLFTHGNGVVMSPVTEKSAEGLP--------------SLYLHDIPPL
Y2225_SALRD      L---PEDTWDNRHVRFTHGYGSVSNLVAREGSEGSP--------------EFLTQDIPPQ
Y961_NITOC       KLPSGAQKWVNEHLLYTHGYGLAMSSAGQGQGEASM--------------DWFIRGIPPE
Y2137_SYNFM      LIPEAARNWVNEHLSYTHGYGAVMTPASQG-GDEPM--------------TWFIKGIPPE
Y2716_METCA      KLPEEARNWENIHLRYTHGYGAVITPAAQS-GDQPM--------------QWWLRDLNMH
Y786_CORGL       ALQQNQQDWINRHTVYTHGNGFIAAQANQVDEVARDV-----GSTRGGYPVYTVSDLQSN
Y802_COREF       SLQQNQQDWINRHTVYTHGNGFIAAQANQVDEVARDV-----GSTRGGYPVYTVSDLQTN
Y733_CORDI       ALKENQRDWINRHTVYTHGNGIVAAQANQVDEVARDV-----GSARGGYPVYTVSDLQTT
Y1603_CORJK      TLDGNQNDWINRHTVYTHGNGFVAAPSRKVDEVARDV-----GSARGGYPVYTVADLQSM
Y065_MYCBO       SLTGNQTDWINKHIVYTHGNGFVAAPANRVNAAARDAENIS-DS-NSGYPIYAVSDIASL
Y095_MYCBP       SLTGNQTDWINKHTVYTHGNGFVAAPANRVNAAARDAENIS-DS-NSGYPIYAVSDIASL
Y064_MYCTU       SLTGNQTDWINKHTVYTHGNGFVAAPANRVNAAARGAENIS-DS-NSGYPIYAVSDIASL
Y8670_RHOJR      SLSGNQTQWINRHTVYTHGNGFIAAPANRVNAAVRDVAGQS-ASSDSGYPIYAVSDIASQ
Y4526_NOCFA      ALTGNQTDWINKHTVYTHGNGFVAAPANRVNKPQSEDVAAG-GSSDSGYPIFLVSDLFTP
Y6389_RHOJR      SLTGNQTDWINKHTVYTHGNGLVAAPANRVNAAAGESAEEA-ANSNSGYPVYMVSDIASQ
Y3215_MYCBO      RLIDNQRDWINRHTVYTHGNGFIASPANTVRGIAND------PNQNGGYPEFLVNVVGAN
Y3193_MYCTU      RLIDNQRDWINRHTVYTHGNGFIASPANTVRGIAND------PNQNGGYPEFLVNVVGAN
Y3215_MYCBP      RLIDNQRDWINRHTVYTHGNGFIASPANTVRGIAND------PNQNGGYPEFLVNVVGAN
Y3291_MYCPA      RLIDNQRDWINRHTVYTHGNGFIASPANTVRGIAND------PNQNGGYPEFLVNVVGAN
Y4137_MYCA1      RLIDNQRDWINRHTVYTHGNGFIASPANTVRGIAND------PNQNGGYPEFLVNVVGAN
Y2505_MYCUA      RLIDNQRDWINRHTVYTHGNGFIASPANTVRGIAND------PNQNGGYPEFLVNVVGAN
Y644_MYCLE       RLIDNQRDWINRHTVYTHGNGFIASPANTVRGIAND------PNQNGGYPQFLVNVVG-N
Y1433_MYCSK      RLIDNQRDWINRHTVYTHGNGFIASPANTVRGIAND------PNQNGGYPEFLASVVGAN
Y1415_MYCSS      RLIDNQRDWINRHTVYTHGNGFIASPANTVRGIAND------PNQNGGYPEFLASVVGAN
Y1469_MYCSJ      RLIDNQRDWINRHTVYTHGNGFIASPANTVRGIAND------PNQNGGYPEFLASVVGAN
Y1814_MYCVP      RLIDNQRDWINRHSVYTHGNGFIASPANTVRGIAND------PNQNGGYPEFLASVVGAN
Y1102_SACEN      GLAQNQQSWINRHMVYTHGNGFIAAPADRVDSTFQE------GATQGGYPVFQISDVANG
Y3055_STRAW      GIPK--NNWINDHFRYTHGFGVVAAKGTTADSEGRP--------------VFTESDLPSR
Y5204_STRCO      GIPK--KNWINNHFRYTHGYGVVAAKGTQVDSEGRP--------------VFTESNLPSE
Y541_THEFY       PSQE--DRWLTRHLVYTHGFGMVAAAGNQVDSEGRP--------------VFLEYNIPPT
Y1530_NOCSJ      GMNAGDRNWTNLHTVYTHGNGIIAAFANQRSEDNKTQIDNADNTGDQAGIVWAQGTNAGQ
Y6027_FRAAA      GLGADQRNWINEHLTYTHGKGFVAAPSNTVD-EGQPA------------FDEGEQNLPQK
Y3781_FRACC      GLGTQQRNWINEHLTYTHGKGFVAAPSNTVD-VGRPD------------FDHGVSGFPQD
Y2732_PAEAT      GLSANQQTWVNRHIVYTHGYGVVAAKGNKFTADGKP--------------EFLQSGIPSN
Y2749_ARTS2      GLSANQQSWLNRHVVYTHGYGVVAAKGNKFTADGKP--------------EFLQAGIPST
Y930_LEIXX       GLTS--RSWYNDTVVYTHGYGMVAAYGNQRSSDGQP--------------VFMEYGIPTQ
Y644_TROW8       GLGSG-NTWVNQALVYTHGYGLVAAYGNDRTPDGEP--------------KFFESGIPTT
Y641_BIFAA       GLDN--RNWVNDHTVYTHGYGVVAAYGNKVTADGQP--------------KFFEAGIPTQ
Y1029_BIFLO      GNDN--RNWVNDHTVYTHGYGVVAAYGNKVTADGQP--------------EFFESGIPTQ
                         : .    :*** *                                       

Y1037_NOSS1      ----NEGALSTSSEAVRDSIPIGQPRIYYGEITNTYVMTGTRVR----------------
Y3693_TRIV2      ----NEGALSTSSEAVRDSIPIGQPRLYYGEITNTYVMTGTKVR----------------
Y938_TRIEI       PTL-EKNSTLEVLNRIRDSIPIGKPRIYYGELTNTNIMTSTAQRNK--------------
Y1193_THEEB      ------GQLLVNPPQIRESISFFYPRIYYGELTNTYIFVPSEVP----------------
Y1060_SYNY3      E---NAGALRTSSELIRTSIPIGKPRIYFGEITDNYIMTNTAIP----------------
Y2310_SYNP6      TRIIGDASLGISTEAVKAAISTENPRIYYGQLTRNYVFTPSRTQ----------------
Y1783_SYNE7      TRIIGDASLGISTEAVKAAISTENPRIYYGQLTRNYVFTPSRTQ----------------
Y1461_PROM3      TRLEGSSELGITREDVKEAVPIGRAALYFGMLPSPYALAPSKLK----------------
Y755_PROMM       TRLEGSSELGITREDVKEAVPIGRAALYFGMLPSPYALAPSKLK----------------
Y1321_SYNS3      ERINGNKALDISRADVKKNVPIGRPALYFGMLPSPYAVAPTQIE----------------
Y1212_SYNPX      TRIQGNRELGIEREDVERAIPVEDAALYFGMLRSPYAVAPTRVD----------------
Y1151_SYNS9      TRIEGNRDLGIKRKDVEAAIPAQNAALYFGMLPSPYAVVPTEVD----------------
Y1323_SYNSC      TKIAGNPALGIERSEVEKEIPVGDAALYYGMLPSPYAVAPTDIA----------------
Y1810_SYNJA      --------VSPRYPEVAQVLRVEQPALYYSELTTTDVFVGAEAR----------------
Y372_SYNJB       --------VSPRYPEVASVLRVEQPALYYGELTTTDVFVGAEAR----------------
Y6445_SOLUE      --------------VKASSLKLTRPELYYGEVTHEPVFVDTARE----------------
Y1303_METHJ      SPF--------------PSLSLDHPQIYYGEGDIPYCITNTRTE----------------
Y4385_TRIEI      S-Q--------------VNLQVKEPAIYYGEKTDTHIFTGMSTE----------------
Y086_CLOTE       NN---------------TDILIDNPRIYFGEKTDEYAIINTKLK----------------
Y852_CLONN       NT---------------SGVEIKDPRIYYGEKTNEYAIVNTKLN----------------
Y010_CLOAB       NS---------------TNLKITNPRIYYGEETDDYAIANNTLG----------------
Y011_CLOPE       NT---------------TDINLENPRIYFGESDNDYVIVNTEGG----------------
Y011_CLOP1       NT---------------TDINLENPRIYFGESDNDYVIVNTEGG----------------
Y011_CLOPS       NT---------------TDINLENPRIYFGESDNDYVIVNTEGG----------------
Y1630_DESHY      TDY--------------QELQISQPRIYFGEMTHDWVVVNTDLK----------------
Y1421_ARCFU      GL-----------------IKIERPEIYYGELTDDYVVVNTLQE----------------
Y2689_PELPD      SL---------------ADIRVTRPEIYFGELSNEYVIVRTRVP----------------
Y3567_PELPD      SL---------------ADIKVSRPEIYYGELSNEYVIVKTNVP----------------
Y2333_GEOSL      SL---------------ADIRVTRPEIYYGELSNDYVIVGTKVP----------------
Y1139_MOOTA      SS---------------AGLQVNEPRIYYGELTGDYVITGGTAA----------------
Y1161_SYNWW      FS---------------TDLKIERPEIYFGEKTDNYVIVNTSQK----------------
Y7333_BRADU      A-D--------------GGPQIREPRIYYGEEHDSYVIVKGSTP----------------
Y1615_CUPNH      S-D--------------GGPVIQEPRLYFGEGGKGYVIVKGSVP----------------
Y2225_SALRD      SKY--------------ESLDVDNPALYYGERTPTYRIVPAGVPGDSL------------
Y961_NITOC       SDE---------------GFNIKQPGIYYGRGSYRYAIAPNENR----------------
Y2137_SYNFM      SEY---------------GFRIEQPGVYIGLGSYTYVIAPNDAG----------------
Y2716_METCA      SDV---------------GLTTEKPDIYFGLENLDYAIVPNRLN----------------
Y786_CORGL       ARAAESED------AEELGIKVDEPRVYYGPLIASATDG-ADYAI---------------
Y802_COREF       ARAAESED------AEELGIMVEQPRIYYGPLIASAADG-KDYAI---------------
Y733_CORDI       DKEAQ-----------ELGIVVKEPRIYYGPVIASATDG-ADYAV---------------
Y1603_CORJK      QSGKQ---------GGELKLDVKQPRIYFGPVIASSNQNNSDYAI---------------
Y065_MYCBO       GSGRQ-----------V--IPVEQPRVYYGEVIAQADPDYAIVG----------------
Y095_MYCBP       GSGRQ-----------V--IPVEQPRVYYGEVIAQADPDYAIVG----------------
Y064_MYCTU       GSGRQ-----------V--IPVEQPRVYYGEVIAQADPDYAIVG----------------
Y8670_RHOJR      VGGDQ-----------V--IPVEQPRIYFGEVIAQADPDYAIVG----------------
Y4526_NOCFA      K-DRQ-----------R--IPVEQPRIYFGELISQSDPDYAIVG----------------
Y6389_RHOJR      EAGNQ-----------V--IPVQQPRIYYGEVIADTDADYAIVG----------------
Y3215_MYCBO      GTVVS-----------DGPAPLDQPRIYFGPVISNTSADYAIVGR---------------
Y3193_MYCTU      GTVVS-----------DGPAPLDQPRIYFGPVISNTSADYAIVGR---------------
Y3215_MYCBP      GTVVS-----------DGPAPLDQPRIYFGPVISNTSADYAIVGR---------------
Y3291_MYCPA      GNVVS-----------DGPAPLDQPRVYFGPVISNTSADYAIVGR---------------
Y4137_MYCA1      GNVVS-----------DGPAPLDQPRVYFGPVISNTSADYAIVGR---------------
Y2505_MYCUA      GTVVS-----------DGPAPLDQPRIYYGPVISNTPADYAIVGK---------------
Y644_MYCLE       GTVVS-----------EGPARLDQPRVYFGPVISNTSADYAIVGK---------------
Y1433_MYCSK      GAVVS-----------PGPAPLDQPRIYFGPVIANTASDYAIVGE---------------
Y1415_MYCSS      GAVVS-----------PGPAPLDQPRIYFGPVIANTASDYAIVGE---------------
Y1469_MYCSJ      GNVVS-----------PGPAPLDQPRIYFGPVIANTASDYAIVGE---------------
Y1814_MYCVP      GEVVS-----------PGPAPLDQPRIYFGPVIANTPADYAIVGE---------------
Y1102_SACEN      G---------------KGAIPVDNPRVYYGELLNQN--DYAIVG----------------
Y3055_STRAW      GDLKA-----------------YQQRIYYGEKTSQYSIVGGP------------------
Y5204_STRCO      GDLGK-----------------YEQRIYYGEKTTTYSIVGGP------------------
Y541_THEFY       GELSQVG-------------EGYEPRIYFGREGAEYVIVNAEAEYDYPVDPDTPEVPTTE
Y1530_NOCSJ      DALARAT-------------GGFEDRIYYGEQSPQYSVVGKATP----------------
Y6027_FRAAA      GDFDVR-----------------ENRVYFGEMSPNYSVVGTRQV----------------
Y3781_FRACC      GTFGIK-----------------ENRVYFGEMSPSYSIVGTRQM----------------
Y2732_PAEAT      GVLGND--------------TSYEPRIYFGENSPEYSIVGAPDGA---------------
Y2749_ARTS2      GVLGND--------------STYQPRIYFGENSPEYSIVGAPEGS---------------
Y930_LEIXX       GTFG-----------------AYEPRVYFGQQSPTYSIVGAQKSA---------------
Y644_TROW8       GLLG-----------------KYEPRIYFGRKSPPYSIVGAPSGA---------------
Y641_BIFAA       GKLTDS--------------EKYEPRIYFSPNATEYSIVGAPEGT---------------
Y1029_BIFLO      GKLTES--------------EKYEPRIYFSPNTTEYSIVGAPEGT---------------
                                           :* .                              

Y1037_NOSS1      ---------------------------------------------ELDYPSGSDNA--YN
Y3693_TRIV2      ---------------------------------------------ELDYPSGSDNA--YN
Y938_TRIEI       ---------------------------------------------ELDYPSGEANS--YN
Y1193_THEEB      ---------------------------------------------ELDFPRGTENV--YN
Y1060_SYNY3      ---------------------------------------------ELDFPSGEANV--YN
Y2310_SYNP6      ---------------------------------------------ELDYPSGNDNV--YN
Y1783_SYNE7      ---------------------------------------------ELDYPSGNDNV--YN
Y1461_PROM3      ---------------------------------------------ELDYPVGDKNI--YN
Y755_PROMM       ---------------------------------------------ELDYPVGDKNI--YN
Y1321_SYNS3      ---------------------------------------------EFDHPEGDVNT--YN
Y1212_SYNPX      ---------------------------------------------EFDYPEGDLNV--YT
Y1151_SYNS9      ---------------------------------------------EFDYPDGDLNV--YS
Y1323_SYNSC      ---------------------------------------------EFDYPEGDINV--MT
Y1810_SYNJA      ---------------------------------------------ELDYPAADRYV--YS
Y372_SYNJB       ---------------------------------------------ELDYPAAERYV--YS
Y6445_SOLUE      ---------------------------------------------EFNYPSGESNV--TS
Y1303_METHJ      ---------------------------------------------EFDYPSGD-EN-IYS
Y4385_TRIEI      ---------------------------------------------EFDYPRSG-EN-AFT
Y086_CLOTE       ---------------------------------------------EFDYPQGA-NN-KIT
Y852_CLONN       ---------------------------------------------EMDYLKDSGEN-ATK
Y010_CLOAB       ---------------------------------------------EFDYPDGS-KN-KTN
Y011_CLOPE       ---------------------------------------------EFDYPTGD-TE-NTF
Y011_CLOP1       ---------------------------------------------EFDYPTGD-TE-NTF
Y011_CLOPS       ---------------------------------------------EFDYPTGD-TE-NTF
Y1630_DESHY      ---------------------------------------------EFDYPEGK-AN-AET
Y1421_ARCFU      ---------------------------------------------EFDYPKGD-VN-FFT
Y2689_PELPD      ---------------------------------------------EFSYPTSSGN--INT
Y3567_PELPD      ---------------------------------------------EFSYPTATGN--ITT
Y2333_GEOSL      ---------------------------------------------EFSYPTATGN--INT
Y1139_MOOTA      ---------------------------------------------EFDYPVTGEDNFVET
Y1161_SYNWW      ---------------------------------------------EFDYPAGEKN--VYT
Y7333_BRADU      ---------------------------------------------EFDYPKGKDNV--YA
Y1615_CUPNH      ---------------------------------------------EFDYPKGKDNV--YT
Y2225_SALRD      ---------------------------------------------ELDYPRSGENK--YT
Y961_NITOC       ---------------------------------------------EFDYPKGNANV--MT
Y2137_SYNFM      ---------------------------------------------EIDYPKGNSNT--MV
Y2716_METCA      ---------------------------------------------IVDIASFDQGS--SQ
Y786_CORGL       ------------------------------------------VGDTGDGPVEYDTDTSSY
Y802_COREF       ------------------------------------------VGDTGDGPVEYDTDSTSY
Y733_CORDI       ------------------------------------------VGSENDSSVEYDTDSSTY
Y1603_CORJK      ------------------------------------------VGNTEGEPLEYDTDASNY
Y065_MYCBO       -------------------------------------------GAPGSAPREYDTDTSKY
Y095_MYCBP       -------------------------------------------GAPGSAPREYDTDTSKY
Y064_MYCTU       -------------------------------------------GAPGSAPREYDTDTSKY
Y8670_RHOJR      -------------------------------------------GPEGVPPREYDTDTAQY
Y4526_NOCFA      -------------------------------------------GAEGQAPREYDSDTAQY
Y6389_RHOJR      -------------------------------------------GSGGSDPREYDTDTSRY
Y3215_MYCBO      ------------------------------------------NGDDREYDYETNIDTKRY
Y3193_MYCTU      ------------------------------------------NGDDREYDYETNIDTKRY
Y3215_MYCBP      ------------------------------------------NGDDREYDYETNIDTKRY
Y3291_MYCPA      ------------------------------------------NGADREYDYETSTETKNY
Y4137_MYCA1      ------------------------------------------NGADREYDYETSTETKNY
Y2505_MYCUA      ------------------------------------------TGADREYDYETSADTKNY
Y644_MYCLE       ------------------------------------------NGDDREYDYETNTDTKRY
Y1433_MYCSK      ------------------------------------------NGTPREYDYENNVETRNY
Y1415_MYCSS      ------------------------------------------NGTPREYDYENNVETRNY
Y1469_MYCSJ      ------------------------------------------NGTPREYDYENNVETRNY
Y1814_MYCVP      ------------------------------------------SGTPREYDYETNTATRNY
Y1102_SACEN      -------------------------------------------GNPGEAPREYDTDRSAY
Y3055_STRAW      ---------------------------------------------QKEIDYSDDSGEKTT
Y5204_STRCO      ---------------------------------------------QKEIDYSDDTGEKTF
Y541_THEFY       DAVVPTPSPSPEADEAPAPADSREEGSAQEQQDQEGQDGGEDAQGTEEEQSGQGSGQANN
Y1530_NOCSJ      ----------------------------------------DSTDVELNLQTAGSDEGSTT
Y6027_FRAAA      ---------------------------------------------EIDGPGPGADTQVTT
Y3781_FRACC      ---------------------------------------------EIDGPGPG-ETQVTT
Y2732_PAEAT      -----------------------------------------PNREQDRPAGREGGGETQY
Y2749_ARTS2      -----------------------------------------PHREQDRPAGKEGDGETQY
Y930_LEIXX       -----------------------------------------KSIELDYPGGDNDAQQTYT
Y644_TROW8       -----------------------------------------APFEFDYPS--SSGGESYT
Y641_BIFAA       -----------------------------------------KSWEFDYPTG---SEGATN
Y1029_BIFLO      -----------------------------------------QAWEFDYPTG---SEGALT
                                                                             

Y1037_NOSS1      SYSGLGGIVIGSGWRKGLFAMYLKDWQMLFTRDFLPETKVLFRRNVKSRIQAIAPFLKFD
Y3693_TRIV2      AYDGLGGVIIGNGWRRGLFAMYLKDWQMLFTQDFLPETKVLFRRDVKQRIQAIAPFLKFD
Y938_TRIEI       TYDGSGGIVIGQGWQRWIFAKYLKDWKMLLTNEFIPETKLLYRRNINARVRSIAPFLRYD
Y1193_THEEB      HYDGTGGVPIASWWRRLVYSVYFRDWQLLLTPNLRPDSRVLFRRLIQDRVRAIAPFLRFD
Y1060_SYNY3      FYDGRGGIFLNSPIRKLLFAVYLRDWQMLFTENFKPDTRVLFRRNINHRIRHIAPFLRFD
Y2310_SYNP6      IYDGKGGVTLGNYAQRLLFSLYLRDWRLPFSGDLTAQTRVLFRRQIEDRVRAIAPFLRYD
Y1783_SYNE7      IYDGKGGVTLGNYAQRLLFSLYLRDWRLPFSGDLTAQTRVLFRRQIEDRVRAIAPFLRYD
Y1461_PROM3      HYLGSGGVPVGHPWQQLAAAMYLFEPRLLNTGSLTINSKLLIRREVRQRVSAIAPFLEVI
Y755_PROMM       HYLGSGGVPVGQPWQQLAAAMYLFEPRLLNTGSLTINSKLLIRREVRQRVRAIAPFLEVI
Y1321_SYNS3      HYSGRAGIPLASFGQRIAASIYIRDPRLLNTGVLKPDSRLLLRRDVKKRVKALAPFLQLK
Y1212_SYNPX      HYRGSAGVPIGHWLQRVAAATYLGEPRLLTAGSIDHSSKLLIRREVRDRVQAIAPFLDLR
Y1151_SYNS9      HYAGSAGVPIGSLIQRLCASIYLAEPRLLTTKAIQKDSRVLLRREVRQRIRAIAPFLDLR
Y1323_SYNSC      HYQGSGGVPIGTWLQRCSAAVYLREPRLLFTNAINADSKLLIRRDVRSRVKAIAPFIDFR
Y1810_SYNJA      SYRGTGGVPIPHLWQRLLYAWHFRDLRILLSRELSPSTRFLYRRQIRERVRQVMPFLLYD
Y372_SYNJB       SYRGSGGVPIPHLWQRFLYAWHFGDLRILLSRELSSATRFLYRRQIRERIRRVMPFLLYD
Y6445_SOLUE      RYEGKGGFPISSLGMRMAAAIREGEPNILLTSYLKPNSRMMIHRKVEDRLHELAGFLEWD
Y1303_METHJ      LYDGNAGVEL-SLLPRLVYAIQLGSVELLVSGSLTPDSKLHLYRNILERTSKIAPFLTYD
Y4385_TRIEI      FYSGTGGVPVNSLWRKLAYAYDLSSINILISGYFTDNSKIHYYRNIKERVNQVAPFLRFD
Y086_CLOTE       EYDGKSGIKM-NLLNKIIFAINKKDLNFLLSRDVTRESRILINRNIVERAKKIAPFLTYD
Y852_CLONN       NYDGDSGIKM-SFINRILFAINKGDMKFLLSSDITSDSRILMNRNIVNRVKKIAPFLKYD
Y010_CLOAB       NYDGKGGIKA-NILNRLIFAINKRDSNFLLSENITSNSKILINRNIMDRLNKIAPFLSYD
Y011_CLOPE       NYNGTGGLKM-TPFNRVLFSIYERNPKILMSSSITSESRIILNRNIVKRVQEIAPFLTYD
Y011_CLOP1       NYNGTGGLKM-TPFNRVLFSIYERNPKILMSSSITSESRIILNRNIVKRVQEIAPFLTYD
Y011_CLOPS       NYNGTGGLKM-TPFNRVLFSIYERNPKILMSSSITSESRIILNRNIVKRVQEIAPFLTYD
Y1630_DESHY      RYEGKSGIKL-TPFNRLMLSIKHGTLRFYLANEINSQSRILLHRNIMDRVEKLAPFLQYD
Y1421_ARCFU      KYAGDGGIKL-DYFRKVLFSFRFGDINLILSNYITDESRLMMHRDIVERVSTIMPFFVYD
Y2689_PELPD      TYAGTGGVPMDSLAKRMLFAARFRTEKILLSSDITSQSSIIFNRNINERVRAVAPFLHFD
Y3567_PELPD      TYAGTGGVPMDSLLKKALFAAKFRTEKILLSSDITKESRILYNRNINERIRTIAPFLHFD
Y2333_GEOSL      TYGGKGGVALDSMLRKALFAARFKTEKILLSSDITDQSRILYYRTVGERVKTVAPFIRFD
Y1139_MOOTA      RYQGRGGVPINTPWRRLVFAFRFHDYRLLMSNGLTPQSKILYYRNIQERVRKIMPYLRYD
Y1161_SYNWW      RYEGKDGIKIKSFARRLLFGWVLKDYKMLLSSDITNESQVLMNRNILDRVQKVAPYLSYD
Y7333_BRADU      AYDGTGGVPIGAAVWRGLFAYYFNDPNLLLSSYITADSRIMIRRNIGERVRTIAPFLRLD
Y1615_CUPNH      AYRGRDGIGIGGIARRTLFAWHLGDPNILLSGYITQESRILLHRNIRNRVRTIAPFLSLD
Y2225_SALRD      RYGGEGGVSVGSFWKQLLFSYYMGDFNILLTDYIQDDSQIQFWNQVEERVRHVAPFLKLD
Y961_NITOC       DYQGKGGVSLSSLFEKYIFSVYFQDKDIFFTTQTYDKSKILFRRNIIERIETLTPYLLLD
Y2137_SYNFM      SYKAEDGVPLSSFLRRILFAYHFGDRNLLFTTKTTPDSKILFRRNLLERIRVLTPFLLLD
Y2716_METCA      NYSGNGGVPISSLLRRLLLSIYFRDERLFFSLNITENSQALFHRNIIERINTVTPFLALD
Y786_CORGL       TYEGAGGVDIGNMVNRAMFALRYQEMNMLLSDRVGSESKILFERDPRSRVEKVAPWLTTD
Y802_COREF       TYDGEGGVGIGNLFNRAAFALRYQEMNMILSDRVGSESKILFERDPRTRVEKVAPWLTTD
Y733_CORDI       TYQGKGGVNIGNVINRAAFAMRYQELNLILSDRVNGNSKILYDRDPRERVHNVAPWLTTD
Y1603_CORJK      TYTGTGGVDVSNYFNRLMFSAHFESMNMLLTDRIGEGSKILYERDPRERVHKVAPWLTTD
Y065_MYCBO       TYTGAGGVSIGNWFNRTVFATKFAQHKFLFSREIGSESKVLIHRDPKERVQRVAPWLTTD
Y095_MYCBP       TYTGAGGVSIGNWFNRTVFATKFAQHKFLFSREIGSESKVLIHRDPKERVQRVAPWLTTD
Y064_MYCTU       TYTGAGGVSIGNWFNRTVFATKVAQHKFLFSREIGSESKVLIHRDPKERVQRVAPWLTTD
Y8670_RHOJR      TYTGTGGVPVGSWVNRLAFAARYGERNILFSGAIGSESKIIFNRDPAARVEHVAPWLTTD
Y4526_NOCFA      TYTGKGGVPIGNWFNRLAFAAKYAERNILFSSAIGDDSKIIFNRSPRERVQKVAPWLTTD
Y6389_RHOJR      TYTGSGGVPIGNWFNRLAFAAKYTERNILFSGAIGSDSKIIYNRDPRDRVTHVAPWLTAD
Y3215_MYCBO      TYTGSGGVPLGGWLARSVFAAKFAERNFLFSNVIGSNSKILFNRDPAQRVEAVAPWLTTD
Y3193_MYCTU      TYTGSGGVPLGGWLARSVFAAKFAERNFLFSNVIGSNSKILFNRDPAQRVEAVAPWLTTD
Y3215_MYCBP      TYTGSGGVPLGGWLARSVFAAKFAERNFLFSNVIGSNSKILFNRDPAQRVEAVAPWLTTD
Y3291_MYCPA      TYTGLGGVPIGDWLSRSVFAAKFAERNFLFSNVIGSNSKILFNRDPARRVEAVAPWLTTD
Y4137_MYCA1      TYTGLGGVPIGDWLSRSVFAAKFAERNFLFSNVIGSNSKILFNRDPARRVEAVAPWLTTD
Y2505_MYCUA      TYTGSGGVSVGSWISRTVFAAKFAERNFLFSNVIGSNSKILFNRDPAQRVEAVAPWLTTD
Y644_MYCLE       TYAGSGGVPIGSWLSRSVFAAKFAERNFLFSSVIGSNSKILFNRDPAQRVEAVAPWLTTD
Y1433_MYCSK      TYTGSGGVPIGNWLTRSLFAAKFAERNFLFSNVIGENSKILFNRDPADRVEAVAPWLTTD
Y1415_MYCSS      TYTGSGGVPIGNWLTRSLFAAKFAERNFLFSNVIGENSKILFNRDPADRVEAVAPWLTTD
Y1469_MYCSJ      TYTGSGGVPIGNWLTRSLFAAKFAERNFLFSNVIGENSKILFNRDPADRVEAVAPWLTTD
Y1814_MYCVP      TYTGSGGVPIGNWLTRSVFAAKYAERNFLFSNVIGENSKILFNRDPADRVEAVAPWLTTD
Y1102_SACEN      TYAGKGGVPLGSFFNRLVFAGYYGERNFLFNTAIGSDSKIMYERNPRDRVQKVAPWLKLD
Y3055_STRAW      SYQGKSGVNLSSPINRAAYAVAFSEPQILYSGAIGEGSRILYNRTPKERVEAVAPWLTID
Y5204_STRCO      SYKGDGGVDLSNPINRAAYAAAFSEPQILYSGAIGDGSRILYNRTPKERVEAVAPWLTID
Y541_THEFY       YYDGKGGVQLKSFFDKLMYALKYQEINILLNNAISNESQIIYVRDPAERVEKVAPFLTVD
Y1530_NOCSJ      TYDGNGDASVGGFFNQLMFATKFGEPNFLLSGRVNPNSKVLFNRNPADRVEKVAPWLTVD
Y6027_FRAAA      TYTGDGGVSIGSTFRQALFALRFGEKNLLLSGDITKNSRILYERNPRDRVSKAAPWLTLD
Y3781_FRACC      TYQGDGGVSIGSTFRRALFALRFGEKNILLSGDITKNSRILDERNPRDRVSKAAPWLTLD
Y2732_PAEAT      TFSGNGGPNVGNWLNRILYSIKFQSSDLLLSDGVNAESQILYERNPRERVEKLAPYLTVD
Y2749_ARTS2      TFTGNGGPNVGSFFNKVLYAIKFQSSDLLLSDGVNAESQILYDRNPRDRVEKVAPYLTVD
Y930_LEIXX       TFSGDGGPKLDNIFNRLVYALKFQDEQIVLSTAVNKDSQILYDRDPIKRVKKAAPYLTMD
Y644_TROW8       TFKGSGGPKLDSFLKRLIYAMKFGSEQILLSSQVGDYSQILYDRDPIKRVGKVAPWLRLD
Y641_BIFAA       TFKGDGGPKIGNIFSRLLYAIRFGSDQILFSNRVNSNSQILYDRSPKERVAKVAPYLTLD
Y1029_BIFLO      TFKGDGGPSVGNLFSRILYAIRFGSDQILFSDRVTSESQILYDRSPKERVAKVAPYLTLD
                  : .  .        :   .       :         :     .    *      ::   

Y1037_NOSS1      SDPYLVSADGSPAFSGRD---------NYLYWMVDAYTTSDRYPYSDPDN----------
Y3693_TRIV2      SDPYLVAADGSPAFPGQN---------NYLYWIVDAYTTSDRYPYSDPDN----------
Y938_TRIEI       HDPYLVVADPNFGHKNMNQ-----KNPNYLYWIIDAYTTTNHYPYSDPEN----------
Y1193_THEEB      SEPYLVVADPRSEQEIAPRP--STAGVNYLYWMIDAYTVSRYYPYSDPGE----------
Y1060_SYNY3      RDPYLVTAKVKGEE------------HSTLYWLIDAYTTSNSYPYSDPGEGDA-------
Y2310_SYNP6      AEPYLVSVNADTAEASGLG-------RSSLFWILDAYTVSDRYPYADPGE----------
Y1783_SYNE7      AEPYLVSVNADTAEASGLG-------RSSLFWILDAYTVSDRYPYADPGE----------
Y1461_PROM3      GDPYLVSTSVNSRD-------HDYQAKQNQYWIVEAYTSSRTYPYAANLP----------
Y755_PROMM       GDPYLVSTSVSSKD-------LNYEAKQNQYWIVEAYTSSRTYPYAANLP----------
Y1321_SYNS3      GDPYLVSVPMESGL-------DQYHDDQHQYWIVDGFTSSNTYPYASTLP----------
Y1212_SYNPX      GDPYLISIPQSGQP-----TSASN---QHQYWVVEGFTHSSTYPYSSAVS----------
Y1151_SYNS9      GDPYLVSVPGDNLE-----LGTSGNRIQHQFWIAEGYTHSATYAYSAAVS----------
Y1323_SYNSC      GEPYLISIPDAQQGSSNRINQNSNQRQQHQYWVVEGYTHSSTLAYSAAVS----------
Y1810_SYNJA      QDPYLVIQGG------------------RLYWFFDAYTTSSRYPYSEHLP----------
Y372_SYNJB       RDPYLVIQGG------------------KLYWFFDAYTTSSRYPYSEHLP----------
Y6445_SOLUE      SDPYLVITDAG-----------------RLVWMIDGYTTSEAHPYARSVD----------
Y1303_METHJ      SDPYVVM-SDGK-----------------LSWIIDAYTTSDRYPYSEPV-----------
Y4385_TRIEI      NDPYIAL-IDGK-----------------IQWILDAYTVSDRYPYSEPLYLSNNARAILN
Y086_CLOTE       NDPHLVI-HDNK-----------------LYWVIDAYTTSNKYPYSQPY-----------
Y852_CLONN       NNPYIVI-NNGK-----------------LYWVIDAYTVSNAYPFSEPI-----------
Y010_CLOAB       KDPYVVL-SGGK-----------------LFWIVDAYTTSDRFPYSQPY-----------
Y011_CLOPE       SDPYIVV-HDGR-----------------LVWMMDAYTSTDKYPFSEPH-----------
Y011_CLOP1       SDPYIVV-HDGR-----------------LVWMMDAYTSTDKYPFSEPH-----------
Y011_CLOPS       SDPYIVV-HDGR-----------------LVWMMNAYTSTDKYPFSEPH-----------
Y1630_DESHY      DNPYLVV-DEGR-----------------LKWIIDAYTVSKTFPYSSMYP----------
Y1421_ARCFU      DDPYVAV-IDGE-----------------IWWIIDAYSVLQNFPYSAEV-----------
Y2689_PELPD      DDPYMVVDDRGR-----------------LKWIIDAYTFSDRLPCSKPIK----------
Y3567_PELPD      SDPYLVVDQKGR-----------------LKWIIDAYTHSTRLPYSRPLK----------
Y2333_GEOSL      GDPYLVVADNGT-----------------LKWIIDGYTHSSRLPYSKPLR----------
Y1139_MOOTA      ADPYLVV-AGGR-----------------LYWFLDAYTITNMYPYSEPNS----------
Y1161_SYNWW      GDPYIVINDDGK-----------------LYWVLDAYTVSDKYPYSEPFDK---------
Y7333_BRADU      HDPYLVI-SNGR-----------------MFWMQDAYTVSSYFPSAQPAQDQ--------
Y1615_CUPNH      HDPYVVV-SDGR-----------------LYWIQDAYTTSRWFPYSQPGTGG--------
Y2225_SALRD      KDPYLVH-GDDR-----------------HYYIADAYTTSNSFPYSEPIRGQQ-------
Y961_NITOC       AAPYLVATTEGL------------------YWIQDAYTASTWYPNADVLGLMRFEFPIP-
Y2137_SYNFM      GDPYAVVTPGKL------------------YWIQDAYTTSEFYPGATPTLWGR-------
Y2716_METCA      RDPYIVVTPQRI------------------FWIVDAYTTLNSYPVSKRMRYKFRGDTE--
Y786_CORGL       SKTYPTVIDGRI------------------KWIVDGYTTLDSLPYSTRTSLTEATQDAVM
Y802_COREF       SKSYPAVIDGSI------------------KWIVDGYTTLSSLPYATRTSLTEATLDSVV
Y733_CORDI       STTYPAVIDGRV------------------KWIVDGYTTLTSLPYAERTSLSEATNDTTA
Y1603_CORJK      SKTYPIVIDGRV------------------KWVVDGYTTLNNLPYSERIGLTDSTADAIN
Y065_MYCBO       DNPYPVVVNGRI------------------VWIVDAYTTLDTYPYAQRSSLEGPVTSP--
Y095_MYCBP       DNPYPVVVNGRI------------------VWIVDAYTTLDTYPYAQRSSLEGPVTSP--
Y064_MYCTU       DNPYPVVVNGRI------------------VWIVDAYTTLDTYPYAQRSSLEGPVTSP--
Y8670_RHOJR      SNPYPAVVGGRI------------------VWIVDGYTTAAHYPYSQVGSLAEPVVND--
Y4526_NOCFA      GNAYPAVVDERI------------------VWIVDAYTTLDNYPYAQKTSLEGAVEDSID
Y6389_RHOJR      GDSYPAVVDGKV------------------VWIVDAYTTLQDYPYAQRSSLDGLVEDSID
Y3215_MYCBO      SAVYPAIVNKRL------------------VWIVDGYTTLDNYPYSELTSLSSATADSNE
Y3193_MYCTU      SAVYPAIVNKRL------------------VWIVDGYTTLDNYPYSELTSLSSATADSNE
Y3215_MYCBP      SAVYPAIVNKRL------------------VWIVDGYTTLDNYPYSELTSLSSATADSNE
Y3291_MYCPA      SSVYPAIVNKRL------------------VWIIDGYTTLDNYPYSELTSLESATADSNE
Y4137_MYCA1      SSVYPAIVNKRL------------------VWIIDGYTTLDNYPYSELTSLESATADSNE
Y2505_MYCUA      SAVYPAIVNKRM------------------VWILDGYTTLDNYPYSQLTSLSSATADSNE
Y644_MYCLE       SSVYPAIVNKRL------------------VWIIDGYTTLDNYPYSERTSLSSATADSTE
Y1433_MYCSK      TTVYPAIVNKKI------------------VWIVDGYTTLDNYPYSELTSLSSATADSNE
Y1415_MYCSS      TTVYPAIVNKKI------------------VWIVDGYTTLDNYPYSELTSLSSATADSNE
Y1469_MYCSJ      TTVYPAIVNKKI------------------VWIVDGYTTLDNYPYSELTSLSSATADSNE
Y1814_MYCVP      TAVYPAIVNKRI------------------VWIVDGYTTLDNYPYSELMSLSSATTDSNE
Y1102_SACEN      GDPYPAVVDGKV------------------KWIIDGYTTLDNYPYSQQTQFGQATTDTLT
Y3055_STRAW      GDAYPAVVDNKI------------------QWIVDAYTTTNGYPYASRTTLGDTTADSLT
Y5204_STRCO      GDAYPAVVDGRI------------------QWIVDAYTTTNGYPYASRTTLGDTTADSLT
Y541_THEFY       GKAYPAVVDGRI------------------VWIVDAYTTSDRYPYSTPIDLAQATTDTFT
Y1530_NOCSJ      SDPYPAVVDGRI------------------LWIIDGYTTTDRYPLSEKESFQTMIDDSLQ
Y6027_FRAAA      GDPYPAVVNGRI------------------TWILDGYTTSDGYPYSARRTLGDVTADSVT
Y3781_FRACC      GDPYPAIVNGRV------------------TWILDGYTTSDGYPYSARRTLGDVTADSVT
Y2732_PAEAT      GNAYPAVVDGRV------------------KWIVDGYTTSQYFPYSQPQQLQNATVDSQT
Y2749_ARTS2      GNAYPAVVDGRV------------------KWIVDGYTTSQYYPYSQQEQLSAATADSQT
Y930_LEIXX       SQAYPAVIDGRI------------------KWVVDGYTTSNQFPYSHVGSLSDAIADTET
Y644_TROW8       RNPYPSVVDGRI------------------VWIVDGYTTSDQFPYSDLNSFTTLSQDSQS
Y641_BIFAA       GRVYPAVVDGRV------------------KWIVDGYTTSDAYPYSQMTDLGEATKDSTT
Y1029_BIFLO      GRVYPAVVDGRV------------------KWIVDGYTTSDAYPYSQMTDLGSATKDSTT
                    :                           :. :.::     . :              

Y1037_NOSS1      ------------NGINYIRNSVKIVIDAYNGSVKFYIADPTDPIIATWSAIFPGMFQPLS
Y3693_TRIV2      ------------NGINYIRNSVKVVIDAYNGSVKFYIADATDPIIATWSAIFPQMFQPLS
Y938_TRIEI       ------------NEFNYIRNSVKVVIDAYNGSVKFYVADPKDPIIRTWKKAFSDMFNSIE
Y1193_THEEB      ------------HSFNYIRNSVKVVVDAYNGDVTFYVVEPEDVMIRTWQRIFPTLFHPLS
Y1060_SYNY3      --------NQPGRNFNYIRNSVKILVDAYNGDVRFFTIDKQDPLINAWQKIFPELFLPFS
Y2310_SYNP6      ------------QPFNYIRNSVKVIIDAYNGSVQFYIVDPKDPLIQTWSRLFPSLFQPID
Y1783_SYNE7      ------------QPFNYIRNSVKVIIDAYNGSVQFYIVDPKDPLIQTWSRLFPSLFQPID
Y1461_PROM3      ----------DGRPVRYLRNSVKAIVDAYSGRVHLYVSEPRDPIILGWQRLFPDLFKPLE
Y755_PROMM       ----------DGRPLRYLRNSVKAIVDAYSGRVHLYVSEPRDPIILGWQRLFPDLFKPLE
Y1321_SYNS3      ----------DGKEMRYLRNSVKAIVDAYNGTVHLYVSEPDDPMIRGWQKVFPELFQPLE
Y1212_SYNPX      ----------NSDSDRYLRNSVKAVVDAYNGSVQLFISEPDDPLIRGWARVFPQLFQPLD
Y1151_SYNS9      ----------KTDSDRYLRNSVKVVVDAYNGSMRLFVSEPDDPIIKSWQKLFPQLFESIE
Y1323_SYNSC      ----------PDDSDRYLRNSVKAIVDAYNGSIRFFVSEPEDPIVNAWIRGFPDLFEPMQ
Y1810_SYNJA      -----------GFPFNYIRNSVKAVLDAYNGSIDWYIADPRDPLIQAYARIYPTLFKPLE
Y372_SYNJB       -----------GFPFNYIRNSVKAVMDAYNGSIDWYIADPRDPLIQAYARIYPTLFKPLE
Y6445_SOLUE      --------VPDIGRVNYIRNAVKATVDAYDGETHMYVFAPDDPIISAYQRLFPDLFQPSD
Y1303_METHJ      -----RTGELSAKSMNYVRNSVKVIVDAYTGDIRYYIVDPDDPVIQTYAKMFPGLFRPVD
Y4385_TRIEI      R---GNIERIARGNVNYIRNSVKVMVDAYNGTMKFFVVDENDPVLNTYRKIFPQLFTEKS
Y086_CLOTE       ------------EDINYIRNSAKVIIDAIDGDINFYITNKNDPIIVSYSKIFKNLFKDYS
Y852_CLONN       ------------GDINYMRNSVKVIIDAVNGTTNFYIIDKNDPIISTYSKIFPGLFKNES
Y010_CLOAB       ------------NNVNYIRNSVKVVIDAVDGTTNFYIVDKNDPIANSYSKIFPGLFKDVS
Y011_CLOPE       ------------EGVNYIRNSVKVVIDAFNGNVDFYVTDENDPIINCYLKIYKGLFKPLS
Y011_CLOP1       ------------EGVNYIRNSVKVVVDAFNGNVDFYVTDENDPIINCYLKIYKGLFKPLS
Y011_CLOPS       ------------EGVNYIRNSVKVVVDAFNGNVDFYVTDENDPIINCYLKIYKGLFKPLS
Y1630_DESHY      -----------ERELNYIRNSVKVVVDAYDGTVDFFAVDAQDPILQTYRKIFPGVFKDLS
Y1421_ARCFU      ------------RGFNYMQNPVKVFVNAYNGSVRFYVVQE-DAYVRALEKALPGVF--LK
Y2689_PELPD      ------------GGVNYMRNSVKAVVDAYDGTLAFYISDPHDVLIRVYDRMFPGLFRPIS
Y3567_PELPD      ------------GGINYIRNSVKTVVDAYDGSVDFYISDPDDVILKVHGRIFPKLFKPMA
Y2333_GEOSL      ------------GGINYMRNSVKAVVDAYDGTLDFYISDPDDVMIKVYARIFPGLFKPLS
Y1139_MOOTA      ------------GGFNYIRNSVKVVIDAYNGSVDYYLVDPGDPLAQTLARIFPGLFKPRE
Y1161_SYNWW      ------------QRNNYLRNSVKVICDAYTGKMNFYIADESDPIIKTYSRIFPQVYQPLS
Y7333_BRADU      -------------DLNYIRNSVKVIVDAYNGTVDFYLMDTGDPVAATWRRIFPNLFKPFS
Y1615_CUPNH      -------------GANYIRNAVKVVIDAYNGTVDFYTSDPADPIVQVYQRIFPGMFRPLG
Y2225_SALRD      ----------GYQGTRYIRNSVKVVVDAYNGDVSLYVSNPEDPIIQTYQRIFPDLFQPLD
Y961_NITOC       --------PKGSEKINYIRNSVKIVVDAYHGTVNYYIFDSSDPIIQAYSRIYPGLFKPKE
Y2137_SYNFM      ------------DRFNYIRNSVKIVVDAFSGKVEYYVFEPGDPIVRAYSRIYPGVFRNAD
Y2716_METCA      -----------EREFNYIRNSVKIVVDAFDGSLDYYVVDHDDPVLKGYIKAYPGLFQDAS
Y786_CORGL       --PDGTPQPLITDRVGYIRNSVKAVVDAYDGTVELYEFDTEDPVLKAWRGVFPDTVKDGS
Y802_COREF       --VDNFQQPLLTEEVGYIRNSVKAVVDAYDGTVELYEFDSEDPVLKAWRGVFPDVVQPES
Y733_CORDI       Q-VGNSAQRLVTDNVGYIRNSVKAVVDSYDGSVDLYEFDENDPVLKAWKGVFPGTVKAKS
Y1603_CORJK      P-DGVSETQVVDNEVGYIRNSVKAVVDAYDGSVDLYAFDEADPVLKAWRGAFPGVVKPRS
Y065_MYCBO       -----TGIVRQGKQVSYVRNSVKATVDAYDGTVTLFQFDRDDPVLRTWMRAFPGTVKSED
Y095_MYCBP       -----TGIVRQGKQVSYVRNSVKATVDAYDGTVTLFQFDRDDPVLRTWMRAFPGTVKSED
Y064_MYCTU       -----TGIVRQGKQVSYVRNSVKATVDAYDGTVTLFQFDRDDPVLRTWMRAFPGTVKSED
Y8670_RHOJR      -----TGRTLAREEVSYVRNSVKATVDAYDGTVTLYQVDENDPVLGAWMKVFPGTVQPPT
Y4526_NOCFA      ---KKTGRLLPRKEVSYIRNSVKATVDAYDGTVTLYEVDSTDPVLKAWRGVFPGAVKPES
Y6389_RHOJR      ---QNTGRLLPRKEVSYIRNSVKATVDAYDGTVKLYQVDQNDPVLDAWMGVFPDAVQPAD
Y3215_MYCBO      ---VAFNRLVPDKKVSYIRNSVKATVDAYDGTVTLYQQDEKDPVLKAWMQVFPGTVKPKS
Y3193_MYCTU      ---VAFNRLVPDKKVSYIRNSVKATVDAYDGTVTLYQQDEKDPVLKAWMQVFPGTVKPKS
Y3215_MYCBP      ---VAFNRLVPDKKVSYIRNSVKATVDAYDGTVTLYQQDEKDPVLKAWMQVFPGTVKPKS
Y3291_MYCPA      ---VAFNKLAPDKRVSYIRNSVKATVDAYDGTVTLYQQDEQDPVLKAWMQVFPGTVKPKS
Y4137_MYCA1      ---VAFNKLAPDKRVSYIRNSVKATVDAYDGTVTLYQQDEQDPVLKAWMQVFPGTVKPKS
Y2505_MYCUA      ---VAFNRLLPDKQVSYIRNSVKATVDAYDGTVTLYQQDEQDPVLKAWMQVFPGTVKPKG
Y644_MYCLE       ---VAFNRLAPDKRVAYIRNSVKATVDAYDGAVTLYQQDEYDPVLKVWMKVFPGTVRPKG
Y1433_MYCSK      ---VAVNRLALNKQVSYIRNSVKATVDAYDGTVTLYAQDETDPVLQAWMKVFPDTIKPKS
Y1415_MYCSS      ---VAVNRLALNKQVSYIRNSVKATVDAYDGTVTLYAQDETDPVLQAWMKVFPDTIKPKS
Y1469_MYCSJ      ---VAVNRLALNKQVSYIRNSVKATVDAYDGTVTLYAQDETDPVLQAWMKVFPDTIKPKS
Y1814_MYCVP      ---VALNRLQPDKQVSYIRNSVKATVDAYDGTVTLYAQDEQDPVLQAWMKVFPDTVKPKA
Y1102_SACEN      ---GVERQP--NQPINYIRNSVKATVDAYDGSVDLYAVDEKDPVLKAWQGVFPGVVKPAK
Y3055_STRAW      ANNNQRAVVAQQNQVNYIRNSVKATVDAYTGKVTLFEWDTKDPVLKTWEKAFPGTVKPKG
Y5204_STRCO      ANNNSRAVVAQQNQVNYIRNSVKATVDAYSGDVKLYEWDTQDPVLKTWKKAFPGTVQDKG
Y541_THEFY       ESTTAVNALPG-NRVNYIRNSVKATVDAYDGTVTLYGWDEEDPVLQTWSKAFPGVVTSKD
Y1530_NOCSJ      EETGLRTLPTD--EINYMRNAVKATVDAYTGDVTLYAWDEEDPILQAWRSAFPGTVEDKS
Y6027_FRAAA      AQSGNRARQAA-NQVNYIRNSVKATVDAYDGTVTLYAWDESDPVLRTWMKAFPDTVKPKK
Y3781_FRACC      TQSGNRTRQAS-NQVNYIRNSVKATVDAYNGTVTLYAWDESDPVLRTWMKAFPDTVKPKS
Y2732_PAEAT      --SAGRTVALPNSSVNYIRNSVKATVDAYDGSVNLYAWDDQDPILKAWQKVFPTVIKPYS
Y2749_ARTS2      --TAGRTVALPNSSVNYIRNSVKATVDAYDGSVTLYAWDDQDPVLKAWQNVFPTSLKPYS
Y930_LEIXX       --PKS---AYAFDDINYIRNSVKATVDAYDGSVTLYAWDAKDPVLKTWQKIFPSTIKPIS
Y644_TROW8       --LPA--LVNGSDSINYIRNSVKATVDAYSGQVKLYAWDPNDPILKVWEKVFPGTLHPIK
Y641_BIFAA       E-SSDTVSSLNSKNANYIRNSVKATVDAYDGSVDLYVWDQSDPVVKAWEKIFPGQYHQLS
Y1029_BIFLO      V-SSATVSSLGSQKANYIRNSVKATVDAYDGSVDLYVWDQSDPVIKAWEKIFPGQYHQLS
                                 *::*..*   ::  *    :     *                  

Y1037_NOSS1      DMPVTLRSHIRYPLDYFAIQSERLMTYHMTDTQVFYNREDQWQIPNEIY-----------
Y3693_TRIV2      DMPVTLRSHIRYPLDYFGIQSERLMTYHMTDTQVFYNREDQWQIPNEIY-----------
Y938_TRIEI       EMPTSLYTHIRYPLDLFQVQSEVLSTYHMDDPRVFYNREDLWRVPIEIY-----------
Y1193_THEEB      AMPHQLYRHIRYPIDLLQVQSEQLLKYHMSDPVVFYNREDLWQIPKEIY-----------
Y1060_SYNY3      SMPSTLKSHIRYPVDMFSTQSERLLTYHMEDIDVFYNREDQWRIPQETY-----------
Y2310_SYNP6      AMAPVLRSHLRYPTDLFKAQSSQLLTYHVLDPQVFYNRDDQWAYPREIY-----------
Y1783_SYNE7      AMAPVLRSHLRYPTDLFKAQSSQLLTYHVLDPQVFYNRDDQWAYPREIY-----------
Y1461_PROM3      EMPSSLREHLKVPTDLFNVQVQQLLRYHVTDPRIFYSGDDVWQVPKELY-----------
Y755_PROMM       EMPSSLREHLKVPTDLFNVQVQQLLRYHVTDPRIFYSGDDVWQVPKELY-----------
Y1321_SYNS3      SMPTSLRQHLMVPSSMFELQVQQLLRYHVTDPRIFYSGDDVWQVPKELY-----------
Y1212_SYNPX      AMPSSIRDHLRVPKELFDVQVKQLQRYHVEDPRVFYSGDDVWQVPLEVY-----------
Y1151_SYNS9      SMPNILKAHLLVPEDFFKVQVSQLQRYHVEDPRIFYSGDDVWQVPLEVY-----------
Y1323_SYNSC      AMPLLVRDHRRVPEDFFNVQVNQLKRYHVDDPQIFYNGDDVWQVPSEIY-----------
Y1810_SYNJA      AMPEPLRQHIRYPQDLFRVQVQQFATYHMTDPRVFYNREDQWQIPNQFR-----------
Y372_SYNJB       AMPEPLRQHIRYPQDLFRLQAQQFATYHMTDPRLFYNREDQWQIPGQFR-----------
Y6445_SOLUE      KMPADLRRHARYPETLFRAQAEIYRTYHMLDPQSFYNKEDLWDLARHTT-----------
Y1303_METHJ      DIPDDLRSHLRYPHGLFNIQAEIYGIYHMTDPRVFYNREDAWVIP---------------
Y4385_TRIEI      AIPTNVKAHFRYPLDLFKIKAQMYLSYHMSNPQLFYNQEDLWRFP---------------
Y086_CLOTE       KIPEGIKEHLKYPEDIFKIQCKVFEKYHMTDTIAFLNGDDLWELS---------------
Y852_CLONN       EIKEGFREHFKYPQDYFAIQCKAMERYHVKNSGTFFSGQNVWDVA---------------
Y010_CLOAB       QVPKDIRSHFKYPEDLFSTQCNVLGKYHVTDTGVFYNSEDLWETA---------------
Y011_CLOPE       EMPEDLKEHFRYPQDLFELQSKVLTKYHVDDPIKLFTEEDLWDRSLEVVKHGGENLSQGD
Y011_CLOP1       EMPEDLKEHFRYPQDLFELQSKVLTKYHVDDPIKLFTEEDLWDRSLEVVKHGGENLSQGD
Y011_CLOPS       EMPEDLKEHFRYPQDLFELQSKVLTKYHVDDPIKLFTEEDLWDRSLDVVKHGGENLSQGD
Y1630_DESHY      AMPDTLQTHLRYPETLFKIQSTMLKNFHMTDPTVFYNKEDTWDIA---------------
Y1421_ARCFU      DMPEEFRKHIRYPRDYFEVQAHIYSTYHMKDVTAFYNREDVWAVA---------------
Y2689_PELPD      AMPDDLRRHVRYPHHFLQLQAAMYTAYHMTDPKVFYNKENLWQVP---------------
Y3567_PELPD      EMPGDLRKHVRYPHHLLQIQAAMFATYHMTDPKVFYNKENLWEIP---------------
Y2333_GEOSL      AMSADLRGHIRYPHQFLQVQAAMFATYHMTDPKVFYNRENLWEIP---------------
Y1139_MOOTA      DMPAGLQQHLRYPPDLLSIQAQMLTNYHMENTMLFYNKEDAWSIAE--------------
Y1161_SYNWW      AMPEGLRSHLRYPVDMFSIQAQMYRTFHMTDPSVFYNKEDPWLIPN--------------
Y7333_BRADU      VMPADLQRHIRYPEDLFLIQAQLYQSYHMEAADVFYNREDLWQFPRQ-------------
Y1615_CUPNH      AMSQDLQRHIRYPEDLFLIQARIYRAYHMEAAEVFYNREDLWEFPRQL------------
Y2225_SALRD      AMPELLQNHIRYPQDFFEIQMERYRRYHQTQPQVFYNNEDLWTRPQE-------------
Y961_NITOC       QMPEDIRAHIRYPKDLFEIQMGIYAKYHQTDLEIFYQQEDMWTFAQKYN-----------
Y2137_SYNFM      QMPPELKAQVRYPQDIFEIQMNIYAKYQQTDPEVYYQQEDMWEPAKTFQ-----------
Y2716_METCA      AMPPLIRDQLRFPHDFFEIQMRMYAKYHQTQPELFYQQAETWDFAKVGV-----------
Y786_CORGL       EISDELRAHLRYPEDLFKVQRDMLAKYNVDDSGTFFTNDAFWSVPGDPTAAEG-------
Y802_COREF       EISNELRDHLRYPEDMFKVQREMLSRYHVEDAGTFFTNDAFWSVPNDPTAPEG-------
Y733_CORDI       EISEELMNHLRYPEDMFKVQRKMLARYHVDDARDFFTNDRFWSVPSDPSATEG-------
Y1603_CORJK      EISKELEDHLRYPEDMFKVQRELIAKYHVSDPGVFFQNDSFWSVPTDPTAPQD-------
Y065_MYCBO       QIPDELRAHFRYPEDLFEVQRSLLAKYHVDEPREFFTTNAFWSVPSDPTNDA--------
Y095_MYCBP       QIPDELRAHFRYPEDLFEVQRSLLAKYHVDEPREFFTTNAFWSVPSDPTNDA--------
Y064_MYCTU       QIPDELRAHFRYPEDLFEVQRSLLAKYHVDEPREFFTTNAFWSVPSDPTNNA--------
Y8670_RHOJR      AIPTELRAHFRYPEDLFRLQRDLLAKYHVDDPREFFTTNAFWSVPSDPTADT--------
Y4526_NOCFA      EISPELRAHFRYPEDLFKVQREMLTKYHVDNPREFFTNNAFWSVPSDPTIEGG-------
Y6389_RHOJR      SIPDELRAHFRYPEDLFKVQREMLAKYHVDDPKEFFTNNAFWSVPSDPTIDT--------
Y3215_MYCBO      DIAPELAEHLRYPEDLFKVQRMLLAKYHVNDPVTFFSTSDFWDVPLDPNPTA--------
Y3193_MYCTU      DIAPELAEHLRYPEDLFKVQRMLLAKYHVNDPVTFFSTSDFWDVPLDPNPTA--------
Y3215_MYCBP      DIAPELAEHLRYPEDLFKVQRMLLAKYHVNDPVTFFSTSDFWDVPLDPNPTA--------
Y3291_MYCPA      DISPELAEHLRYPEDLFKVQRMLLAKYHVNDPVTFFSTSDFWDVPLDPNPTA--------
Y4137_MYCA1      DISPELAEHLRYPEDLFKVQRMLLAKYHVNDPVTFFSTSDFWDVPLDPNPTA--------
Y2505_MYCUA      DISPELAAHLRYPEDLFKVQRMLLAKYHVNDPVTFFSTSDFWDVPLDPNPTA--------
Y644_MYCLE       DITPELAEHLRYPEDLFKVQRMLLAKYHVNDPGTFFNTSDFWDVPLDPNPTA--------
Y1433_MYCSK      EISPELQQHLRYPEDLFKVQRALLAKYHVDDPVTFFSTSDFWDVPLDPNPTA--------
Y1415_MYCSS      EISPELQQHLRYPEDLFKVQRALLAKYHVDDPVTFFSTSDFWDVPLDPNPTA--------
Y1469_MYCSJ      EISPELQQHLRYPEDLFKVQRALLAKYHVDDPVTFFSTSDFWDVPLDPNPTA--------
Y1814_MYCVP      DITPELQEHLRYPEDLFKVQRALLAKYHVDDPVTFFSTSDFWDVPLDPNPTA--------
Y1102_SACEN      EISPQLQEHFRYPEDLFKVQRQLLTQYHVTNPGDFFSNRTFWEVPPDPTSSGQGGS----
Y3055_STRAW      DIPKSLIDHLRYPQDLFKVQRELLTRYHVKDAQTFLSGSEVWQVPDDPSNKSGN------
Y5204_STRCO      EISKELMAHLRYPQDLFKVQRELLTRYHVKDANTFLSGSEVWQVPDDPTNKSGD------
Y541_THEFY       EISDTLLSHLRYPDDLYKVQREILERYHITNADAFYGGQDFWTVPNDPKPQAGNN-----
Y1530_NOCSJ      EISDDLLDHLRYPEDLFQVQRYQFARYHVTEPIDFYQGNNRWQVPEDPYSKGKF------
Y6027_FRAAA      DISPSLMAHLRYPEDLFKVQRDLIGQYHVSDPRDFYSQEDFWQVSESPDGSGQP------
Y3781_FRACC      DIPPSLRAHLRYPEDLFKVQRDLIGQYHISNPRDFYSQEDFWDVSDSPDGSGQP------
Y2732_PAEAT      EMSGDLMSHVRYPEDLFKVQRELLGRYHVTDPDSFYQNNDAWSVPNDP------------
Y2749_ARTS2      EMSGALMSHVRYPEDLFKVQRELLGRYHVTQPDNFYTNNDAWSVPNDP------------
Y930_LEIXX       AMSAQLLQHVRYPSDLFKVQRSVLGQYHVTDAGSFYSRDDAWTTPNDPT-----------
Y644_TROW8       EISGDLMSHVRYPLELFNIQRQILARYHVTDPGVFFSHEDAWGIPIDPQKSEPVMQSTGQ
Y641_BIFAA       EISGDLMSHMRYPESLFKVQRELLAKYHVSSANQFFSGEDFWQTPVDPTESQ--------
Y1029_BIFLO      DISGDLMSHMRYPESLFKVQRELLSKYHVTSANQYYSGEDFWQTPVDPTESQ--------
                  :   .  :   *      :      ::             *  .               

Y1037_NOSS1      ------------GSE--SRPVEPYYLITSLPTVPF------EEFILLLPYTPKQ-----R
Y3693_TRIV2      ------------GSE--SRPVEPYYLITSLPTVPF------EEFLLLLPYTPKQ-----R
Y938_TRIEI       ------------GAQ--QQKVKPYYLITQLPTETS------EEFILLLPYTPAS-----R
Y1193_THEEB      ------------REK--PQAVAPYYLITKLPIGAT------EEFILLVPFTPVN-----R
Y1060_SYNY3      ------------ADE--QQPIAPYYLIMKLAGIDAK----EEEFVLSQVYTPNA-----R
Y2310_SYNP6      ------------AGE--TATVQPYYLITRLPTAAS------EEFLILTPFTPLG-----R
Y1783_SYNE7      ------------AGE--TATVQPYYLITRLPTAAS------EEFLILTPFTPLG-----R
Y1461_PROM3      ------------GKR--QVPVDPYHITAQLGSQES------SEFLLLQPLTPLA-----R
Y755_PROMM       ------------GRR--QVPVDPYHITAQLGTQES------SEFLLLQPLTPLA-----R
Y1321_SYNS3      ------------GKT--QIPVAPYHITAQLKRSLD------SEFLLLQPLTPLA-----R
Y1212_SYNPX      ------------DGE--QISVRPYHITAQVQDRSN------SEFLLLQPLTPLA-----R
Y1151_SYNS9      ------------GGE--QISVEPYHITAQIEGNNS------SEFLLLQPLTPLA-----R
Y1323_SYNSC      ------------GGQ--KINVEPYHITAQVQGNNN------SEFLLLQPLTPLA-----R
Y1810_SYNJA      ------------KRR--RLPMQPQYLILTLPEDPQKGSPNQPEFVLLSPFTPLN-----K
Y372_SYNJB       ------------NRR--RIPMQPQYLILTLPRDPQGVANHTPEFVLLSPYAPVN-----K
Y6445_SOLUE      ------------AQNGGAEPVTPTYVVATLPGEAK------PEFLLLIPFTPRN-----K
Y1303_METHJ      ----------DEIYRKTQQRFEPYYVIMKLPGE------EREEFILMLPFTPRN-----K
Y4385_TRIEI      ----------TEVYEDNKQLMEPYYLIMRLPEK------KGEEFVLILPFTPVN-----K
Y086_CLOTE       --------QDEKTMNTDKATNESPYVFMKLPND------NLEEMILLGYFNMKQ-----R
Y852_CLONN       --------KTQKDIDGKKSVNEASYLIMKLPGE------KNEEMILLQYFNQYQ-----R
Y010_CLOAB       --------KNQKQINGEKGVNDASYFIMRLPGE------NKSEMVLMEYFNMKD-----K
Y011_CLOPE       EVKEESILNKAKENKNNEAENEGLYLMTKLPDE------ENVEMMLLDYFNMRG-----K
Y011_CLOP1       EGKEESILNKAKENKNNEAENEGLYLMTKLPDE------ENVEMMLLDYFNMRG-----K
Y011_CLOPS       EGKEESILNKAKENKNNEAENEGLYLMTKLPDE------ENVEMMLLDYFNMRG-----K
Y1630_DESHY      ----------KELFGSEPQNIAPYYSVMRLPDS------EQPESVLMIPFTPSSNANNIR
Y1421_ARCFU      ----------KEKYEDDVIEVEPYYVTLAIED--------KPEFILMLPMTPVN-----R
Y2689_PELPD      ------------ALGEK--PMEPYYTIMKLPGE------TAEEYILLLPFTPSK-----R
Y3567_PELPD      ------------VLGDK--AMEPYYTIMKLPGE------KAEEYILLLPFTPSK-----R
Y2333_GEOSL      ------------VLGEA--PMEPYYTVMKLPGE------AREEYILLLPFTPSK-----R
Y1139_MOOTA      -----------EMVGDKRQAMDPYYTLMRLPGE------TQAEYILMLPFTPAR-----K
Y1161_SYNWW      -----------ETVEDKQVKMEPYYLVMRLPEE------ENPEYILMMPFTPKS-----R
Y7333_BRADU      ------------PGGGGVATMAPYYIIMRLPG--E----SQAEFFLMLPMVPSR-----R
Y1615_CUPNH      --------TGMSTGNTPAARMMPYYMILRLPD--E----PRAEFVLMLPMVPSQ-----R
Y2225_SALRD      ------------QYANQQRKMEPYYILTDLPGKDD----AGLEFMLMLPMTPDG-----R
Y961_NITOC       ---------RESE-----TRLRPYYLTLDLIE------ENRLDFLLFLPMIVKG-----Q
Y2137_SYNFM      ---------DRTP-----VTIKPYYVTLDLID------PSRFDFLLLAPMSPKG-----R
Y2716_METCA      ---------RLRDGRTVMRTVAPYYFTTQLDGC-----ENMQNFVLINPMTPIG-----R
Y786_CORGL       ---------------RQELKQPPYYVVAADPE------TGESSFQLITPFRG-----LQR
Y802_COREF       ---------------RQEMKQPPYYVVAADPD------TGESSFQLITPFRG-----LQR
Y733_CORDI       ---------------QKDVAQPAYYVVAADPD------TGKPSFQLITPFRG-----LQR
Y1603_CORJK      ---------------RQDNAQPPYYVVAADPE------TNKPSFQLITPFRG-----LRR
Y065_MYCBO       -----------------NATQPPFYVLVGDQQ------SAQPSFRLASAMVG-----YNR
Y095_MYCBP       -----------------NATQPPFYVLVGDQQ------SAQPSFRLASAMVG-----YNR
Y064_MYCTU       -----------------NATQPPFYVLVGDQQ------SAQPSFRLASAMVG-----YNR
Y8670_RHOJR      -----------------GGEQPPYYVLVGDAG------TAAPSFRLTSAMVG-----FNR
Y4526_NOCFA      -----------------SFNQPPYYVLLGDPK------TNRPVFNLTSAMVG-----YNR
Y6389_RHOJR      -----------------SANQPPYYVLVGDPE------TGKPSFNLTSAMVG-----YSR
Y3215_MYCBO      -----------------SSYQPPYYIVAKNIAK----DDNSASYQLISAMNR-----FKR
Y3193_MYCTU      -----------------SSYQPPYYIVAKNIAK----DDNSASYQLISAMNR-----FKR
Y3215_MYCBP      -----------------SSYQPPYYIVAKNIAK----DDNSASYQLISAMNR-----FKR
Y3291_MYCPA      -----------------SSYQPPYYIVAKNIAK----NDNSSSYQLTSAMNR-----FKR
Y4137_MYCA1      -----------------SSYQPPYYIVAKNIAK----NDNSSSYQLTSAMNR-----FKR
Y2505_MYCUA      -----------------SSYQPPYYIVAKNIAK----NDNSASYQLISAMNR-----FKR
Y644_MYCLE       -----------------SSYQPPYYIVAKNILK----NDRSASYQLTSAMNR-----FKQ
Y1433_MYCSK      -----------------SSFQPPYYIVAKDLAE----NNNSAAFQLTSAMNR-----FRR
Y1415_MYCSS      -----------------SSFQPPYYIVAKDLAE----NNNSAAFQLTSAMNR-----FRR
Y1469_MYCSJ      -----------------SSFQPPYYIVAKDLAE----NNNSAAFQLTSAMNR-----FRR
Y1814_MYCVP      -----------------SSYQPPYYIVAKDLAE----NNNSSSFQLTSAMNR-----FRR
Y1102_SACEN      ---------------NQGNQQPPYYVLAQIEG------QNQPTFQLTSALTA-----LKR
Y3055_STRAW      -------------------AVPPYYLSMKMPD------QQAQTFSLTTTLTP-----NGR
Y5204_STRCO      -------------------AVPPYYLSMKMPD------QKAQAFSLTTTFTP-----NGR
Y541_THEFY       -------------------PEPPYRQTIRFPG------DDTPTYSLTSTFVP-----RGR
Y1530_NOCSJ      --------------------QPPYRLFVDSNG------GTDQVFALTSVYVP-----YNK
Y6027_FRAAA      --------------------QPPFYVYSKLPD------RSGPSYNLTSPLIS-----ARS
Y3781_FRACC      --------------------QPPFYVYSQLPG------RKDPSYNLTSPLIS-----ARS
Y2732_PAEAT      -------------TVSEAVKQPPFYMSLQMPD------QEKPAFQLTSSFIPQTVNGSAR
Y2749_ARTS2      -------------TVKEEVKQPPFYMSLQMPD------QDKPAFQLTSSFIPQVVNGTAR
Y930_LEIXX       ------------SSPTDPTLQPPYYLTMQMPG------QKAPTFSLYTTFIPQAASDSSR
Y644_TROW8       RR----------SRTVFSVAQPPYYLTMRMPG------QNLAAYSIYSVFIPKSTGENSR
Y641_BIFAA       ------------QAQQRDILQPPYYLTLQTGG------SSEPVFSLTSSYIP--AGSSTR
Y1029_BIFLO      ------------SQQDQDILQPPYYLTLQTGG------TKEPVFSLSSTYIP--AGQSTR
                                                              :              

Y1037_NOSS1      TNLIAWLAARS--------DGENYGKLLLYNFPKER--LVYGTEQIEARINQDPVISQQI
Y3693_TRIV2      TNLIAWLAARS--------DGENYGKLLLYNFPKER--LVFGPEQIEARINQDPVISQQI
Y938_TRIEI       NNLIAWLAARS--------DGENYGKLLLYQFPKQR--LIYGIEQIEALINQDPEISQQI
Y1193_THEEB      PNLIGWLAARS--------DGENYGKLLLYVFPKQE--LVFGPEQMEARINQDPVISQQI
Y1060_SYNY3      NNLIALLFARC--------DEQNYGKLLLYTLPKER--LVYGPEQIEALVNQDPVISERI
Y2310_SYNP6      NNMIAWLAGRS--------DGEEYGRLLLYEFPRQR--LIFGPEQITARINQDPQISEQI
Y1783_SYNE7      NNMIAWLAGRS--------DGEEYGRLLLYEFPRQR--LIFGPEQITARINQDPQISEQI
Y1461_PROM3      PNLSAWLAARS--------DGDHYGKLVLLRFPSQT--PIFGPEQIQALINQDPQISQQF
Y755_PROMM       PNLSAWLAARS--------DGEHYGKLVLLRFPSQT--PIFGPEQIQALINQDPQISQQF
Y1321_SYNS3      PNLSGWLAARS--------DADHYGELVLLRFPSDV--PIFGPEQIQALINQNPEISQQF
Y1212_SYNPX      PNLTAWLAARN--------DGKHYGDLVQIDFPKDT--PILGPEQVQALINQDPEISKVF
Y1151_SYNS9      PNLTAWLAARN--------DAEHYGELLLIDFPKDR--PILGPEQIQALINQDPEVSKVF
Y1323_SYNSC      PNLTAWLVARN--------DGDHYGELELIDFPKDK--IILGPEQVQALIHQDPDVSEQF
Y1810_SYNJA      QNMVAWMAARC--------DGENYGKLLVYEFSKQR--LIYGPEQVEARVNQDPAISEQI
Y372_SYNJB       QNMVAWIAARC--------DGENYGKLLVYEFSKQR--LIYGPEQVEARVNQDPLISEQI
Y6445_SOLUE      DNLIGLMVARC--------DGKSLGDMVVLQLSKQE--LIFGPMQIGARINQDQTISKDL
Y1303_METHJ      QNLIGWMAVRC--------DPDRYGEMIVYQFSKQE--LTYGPMQIEARIDQDTDISQSI
Y4385_TRIEI      DNMIAWMAAES--------DGDNYGKLLLYEFPKQK--LVYGPSQIEARIDQNPKISQQL
Y086_CLOTE       NTMSSMLAARM--------TSDNYGKLIMYRFPIHK--TIYSPYFFKQKIKQDPLISKEL
Y852_CLONN       ENMIALFGARM--------DNSNYGNLVLYKFPTTKSETVNSPILFKQKIKQDTTISKEL
Y010_CLOAB       DNMSAIFGARM--------DGNNYGKLILYKLPTDK--TVYSPYLFKQKLNQDPSISKEV
Y011_CLOPE       QSMVALLGARM--------DGDNYGELVMYKFPPQR--TIYSPILFKNRIQQDPNISKEI
Y011_CLOP1       QSMVALLGARM--------DGDNYGELVMYKFPPQR--TIYSPILFKNRIQQDPNISKEI
Y011_CLOPS       QSMVALLGARM--------DGDNYGELVMYKFPPQR--TIYSPILFKNRIQQDPNISKEI
Y1630_DESHY      TNMVAWLAARM--------DGEHYGELILYKVPKNT--EVDGPLQVESRIDQDPEISRQL
Y1421_ARCFU      DNMIAWMAARC--------D-EKYGELIIYEFPKGE--LIYGPMQIEARIDQDSELSKLF
Y2689_PELPD      DNLAAWLTARS--------DGANYGKIRAYTFPRDR--LIYGPKQIDARINQDSFISQQL
Y3567_PELPD      DNLAAWLTARC--------DEPQYGKIRAYTFPRDR--LIYGPKQIDARINQDSFISQQL
Y2333_GEOSL      DNLAAWLTARC--------DGENYGKLLAYTFPRDR--LIYGPKQIDARINQDSHISQQL
Y1139_MOOTA      VNMIAWLAARN--------DGPHYGQLLLYQFPKNR--SIYGPMQVEARIDQEPRISQQL
Y1161_SYNWW      ANMVGWMCARM--------DGDNYGKMLVYNFPKQE--TIYGPEQIESRINQNTEIAQQL
Y7333_BRADU      DNMIAWLAARC--------DAPDYGKLIVYEFPKEK--LVYGPFQIEARINQSTEISQQI
Y1615_CUPNH      ENMIAWLAARS--------DPPNYGKLVAYTFPKEK--LVYGPFQIEARIQQNTEISQQI
Y2225_SALRD      DNMIGWVAARS--------DPPNYGEVVVYELPKDR--LIRGPNQIESRIDQDTEISQQL
Y961_NITOC       DNMRAMLVAGS--------DDPYYGKLIAYSFPKGE--LVFGPAQINAVINEDPKVSAQF
Y2137_SYNFM      DNLRALALAGS--------DPPHYGKIIVYNFPKGE--LIYGPSQIYALINQDTRISEQF
Y2716_METCA      NNMSVLAIGGALRPDAC--GMPYSKSIVLYKYSKDV--QVDGPAQVSAMIDQDAEIAKEF
Y786_CORGL       EYLSAHMSASSDPV--------TYGEITVRVLPTDS--VTQGPKQAQDAMMSSDQVAQDQ
Y802_COREF       EFLSAHMTASSDPD--------NFGKITVRVLPTGA--VTQGPKQAQDAMMSSDQVAQDQ
Y733_CORDI       EYLAAHMSVSSDPD--------NYGKITVRVLPTDT--LTQGPKQAQDTMMSSDQIASDR
Y1603_CORJK      EFLAAHMSVGSDPD--------NYGKINVRVLPTGT--QTLGPNQAQDTMMSSDEIARER
Y065_MYCBO       EFLSAYISAHSDPA--------NYGKLTVLELPTDT--LTQGPQQIQNSMISDTRVASER
Y095_MYCBP       EFLSAYISAHSDPA--------NYGKLTVLELPTDT--LTQGPQQIQNSMISDTRVASER
Y064_MYCTU       EFLSAYISAHSDPA--------NYGKLTVLELPTDT--LTQGPQQIQNSMISDTRVASER
Y8670_RHOJR      EFLSAYLSAHSDPE--------NYGRIDILRLPTDT--QTQGPRQTQNSMISDTRVASER
Y4526_NOCFA      QFLSAYISVRSDPD--------DYGKFTILRLPTDT--QTQGPQQTQNTMTTAPQVSQEK
Y6389_RHOJR      EFLSAYLSVKSDPE--------NYGKFTVLQLPTDT--QTQGPQQTQNSMISDPRVASER
Y3215_MYCBO      DYLAAYISASSDPA--------TYGNLTVLTIPGQV--N--GPKLANNAITTDPAVSQDL
Y3193_MYCTU      DYLAAYISASSDPA--------TYGNLTVLTIPGQV--N--GPKLANNAITTDPAVSQDL
Y3215_MYCBP      DYLAAYISASSDPA--------TYGNLTVLTIPGQV--N--GPKLANNAITTDPAVSQDL
Y3291_MYCPA      DYLAAYISASSDPA--------TYGRITVLTIPGQV--N--GPKLANNAITTDPAVSQDL
Y4137_MYCA1      DYLAAYISASSDPA--------TYGRITVLTIPGQV--N--GPKLANNAITTDPAVSQDL
Y2505_MYCUA      DYLAAYISASSDPA--------TYGKITVLTIPGQV--N--GPKLANNAITTDPAVSQDL
Y644_MYCLE       DFLAAYISASSDPE--------TYGKITVLTIPGNV--N--GPKLANNAITTDPAVSQDL
Y1433_MYCSK      DFLAAYMSASSDPE--------TYGKITVLTIPGQV--N--GPKLAFNAISTDTAVSQDL
Y1415_MYCSS      DFLAAYMSASSDPE--------TYGKITVLTIPGQV--N--GPKLAFNAISTDTAVSQDL
Y1469_MYCSJ      DFLAAYMSASSDPE--------TYGKITVLTIPGQV--N--GPKLAFNAISTDTAVSQDL
Y1814_MYCVP      DFLAAYISASSDPE--------TYGKLTVLTIPGQV--N--GPKLAFNAISTDTAVSQDL
Y1102_SACEN      QNLAAWVSASSDPR--------DYGKLTVLRLPTDT--QTPGPNQVQNQMESTPEVTENR
Y3055_STRAW      DNLSAFMSVNAEAGT------SDYGKIRILKLPTSR--TVDGPKQVQSQFNSEQDIAESI
Y5204_STRCO      DNLSAFMAVDAEAGT------SDYGKIRILKLPTST--TVDGPKQVQSQFNSEQDIAESI
Y541_THEFY       ENLAAFMAVNSDASS------EDYGQMRILELPRST--AVQGPGQIQNTFQSSAEVREVL
Y1530_NOCSJ      NNLASFVSVNADATS------DQYGQMQVLELPNEQ--TP-GPGQVANQFATDPEVANEL
Y6027_FRAAA      SKLAAYMAVSSDPS--------NYGQFTLLKLPPGG--TINGPVQVQNAIESNGDVANKL
Y3781_FRACC      SKLAAYMAVSSDPA--------NYGRFTLLKLPAGN--TINGPVQVQNAIEGNGDVAKQL
Y2732_PAEAT      NILYGFLAADSDAGNVKGVKGESYGKLRLLELPTDT--QVPGPGQAQNKFNSDPTVSQAL
Y2749_ARTS2      NVLYGFLAADSDAGNQKGVKAESYGQLRLLQIPPEA--QVPGPGQAQNKFNSDPTVSQAL
Y930_LEIXX       SILKGYLAVDADAGSTKGKVAPGYGKLRLLSLPSSD--TIPGPGQVQNNFNSDPTVSQEL
Y644_TROW8       SVLTGYLSANSDAGNIPGQISPDYGKLTLLRLSKDQ--TVPGPGQIQNAFDSDPKVGNQL
Y641_BIFAA       EILTGFLSVDSDAGHEKGKIGSSYGTIRLQELPKDS--NVPGPGQAQNNFNASADVSKEL
Y1029_BIFLO      EILTGFLSVDSDAGNEKGKIGSNYGTIRLQELPKDS--NVPGPGQAQNNFNANADVSKEL
                   :                       .     .        .       .     :    

Y1037_NOSS1      SLWNRQ--GSRAIQG-NLLVIPIE-QSLLYVEPIYLEATQ-----NSLPTLVRVVVAYEN
Y3693_TRIV2      SLWNRQ--GSRAIQG-NLLVIPIE-QSLLYVEPIYLEATQ-----NSLPTLVRVVVAYEN
Y938_TRIEI       SLWNRQ--GSKAIKG-NLLVIPIN-ESLIYVEPIYLEAEQ-----NSLPTLRRVIVSYKN
Y1193_THEEB      SLWNRQ--GSRSVQG-NLLIIPIQ-RSLLYVEPIYLEADQ-----NRLPTLARVIVMDNQ
Y1060_SYNY3      SLWNRR--GSRAIQG-NLLVIPIE-ESLLYVEPIYLEAEK-----NSLPTLARVVVVYGN
Y2310_SYNP6      TLWNRE--GSRAAEG-NLLVIPID-QALLYVEPLYLEASR-----NSLPALTRVITAYQD
Y1783_SYNE7      TLWNRE--GSRAAEG-NLLVIPID-QALLYVEPLYLEASR-----NSLPALTRVITAYQD
Y1461_PROM3      GLWDRA--GSEVVQG-NLLVVPLG-KALLYVEPVYLRARQ-----GGLPTLTRVVVSDGK
Y755_PROMM       GLWDRA--GSEVVQG-NLLVVPLG-KALLYVEPVYLRARQ-----GGLPTLTRVVVSDGK
Y1321_SYNS3      GLWDRA--GSQVVQG-NLLVVPLG-NALLYVEPIYLRARR-----GGLPTLTRVVVSDGS
Y1212_SYNPX      GLWDRG--GSQVVQG-NLLVVPVG-QCLLYVEPVYLRASK-----GGLPSLTRIVVSDGR
Y1151_SYNS9      SLWDGG--GSELVQG-NLLVLPVG-TSLLYVEPVYLKATK-----GGLPSLVRIVVSDGR
Y1323_SYNSC      GLWDQD--DLELVQG-NLLVLPVG-SGLLYVEPVYLRTRK-----VGLPSLARIVVSDGR
Y1810_SYNJA      ALWNEH--GSRVNLG-TLLVIPIE-TSLLYIQPLYLEAEQ-----GRLPQLTRVIAAYED
Y372_SYNJB       SLWNQH--GSRVNLG-TLLVIPIE-TSLLYVQPLYIEAEQ-----GRLPQLTRVIAAYED
Y6445_SOLUE      TLWNQQ--GSQVLRG-QILVLPVG-NTFLYVDPIYIQATE-----ARMPQLKKIVLAVGN
Y1303_METHJ      TLWSQA--GSSVVRG-NTLIIPVE-QSLLYVEPLYLEATQK----GTLPQLQRVIVSYGD
Y4385_TRIEI      TLWSQK--GSKVIRG-DLLVIPIE-ESLMYIEPIYLRAEQ-----GELPELKRVIVAYDK
Y086_CLOTE       SLWNIGEGGAKVQFG-DTIILPIN-NSLLYVESMYLRAKGK----NSAPEVKGIILSYGD
Y852_CLONN       SLWDAK--GSQVQFG-DTMIIPID-NSLLYVEPLYLRADSE----RSIPEMKRVIVAYGD
Y010_CLOAB       SLWNTQ--GSSVQFG-DTSIIPIK-NSLLYVEPVYLRAQGK----NSMPEVKRVIVSFGN
Y011_CLOPE       SLWAGK--GSEVIYG-DIIIVPIE-DSLLYLNTIYLKANSE----NSMPEMKRVILSNGD
Y011_CLOP1       SLWAGK--GSEVIYG-DIIIVPIE-DSLLYLNTIYLKANSE----NSMPEMKRVILSNGD
Y011_CLOPS       SLWAGK--GSEVIYG-DIIIVPIE-DSLLYLNTIYLKANSE----NSMPEMKRVILSNGD
Y1630_DESHY      ALWDQK--GSSVIRG-DLVVLPLA-GNFLYVEPIYLQSEKA----GSIPEMKRVIVAYGD
Y1421_ARCFU      TLWNQA--GSRVIRG-NLLVVPIN-HSVLYVEPVYLRGES-----AKIPELRLVIVVQDE
Y2689_PELPD      TLWNQR--GSEVIRG-SLLVIPIE-KSLLYVQPLFLAA-DK----AGLPELKRVIVAFGD
Y3567_PELPD      TLWSQR--GSEAIRG-SLLVIPIE-KSLLYVQPLFLAA-DK----AGLPELKRVIVAFGD
Y2333_GEOSL      TLWSQR--GSQVIRG-SMLVIPIE-QSLLYVQPLFLAAADK----AGLPELRRVIVAYGD
Y1139_MOOTA      TLWDQH--GSQVIRG-NLLVIPIK-GSLLYVEPIFLQA-QE----SKLPELRQVVVAYEE
Y1161_SYNWW      SLWDQR--GSRVYRG-NLLVIPMG-NSVLYVEPLYLQA-EN----NRLPELKRVIAAFEN
Y7333_BRADU      TLWNQM--GSRVIRGANLLVIPIE-NSILYVTPLYLRAEH-----GHLPELKRVIAAYGE
Y1615_CUPNH      SLWNQM--GSRVIRG-HLQVVPIE-NSILYVSPLYLRAES-----GQLPELKRVIAAYGD
Y2225_SALRD      SLWDQR--GSSVIRG-NLIVVPIE-ESFLYVEPIYLIADE-----IQIPEMQRVIAATDQ
Y961_NITOC       TLWNQD--DSKVVLG-DMIIMPVD-QVILYIQPVFLTIKDD----VRIPKLERIIISDGR
Y2137_SYNFM      TLWDQV--GSQVARG-KMIILPIS-NMILYIQPVYLKSATK----LKIPELKRIIMSQGQ
Y2716_METCA      ALWDQK--GSHLTRG-RIIIVPIG-RSLLYVQPVYIESTSS----VKIPELARVILSMGD
Y786_CORGL       TLWRGS---NDLHNG-NLLTLPVGGGEILYVEPIYSQRK---DQASAFPKLLRVLVFYKG
Y802_COREF       TLWRGS---NDLFNG-NLLTLPVGGGEILYVEPIYSQRR---DQESAFPKLLRMLVFYKG
Y733_CORDI       TLWKDT---NDLFNG-NLLTLPVGDGDILYVEPLYSQRK---NQASAFPKLLRVLVSYQG
Y1603_CORJK      TLLKGT---NDLTNG-NLLTLPVGDGQILYVEPVYSQRS---GQDSAFPKLLRVLVSYNG
Y065_MYCBO       TLLERS---NRIHYG-NLLSLPIADGGVLYVEPLYTERISTSPSSSTFPQLSRVLVSVRE
Y095_MYCBP       TLLERS---NRIHYG-NLLSLPIADGGVLYVEPLYTERISTSPSSSTFPQLSRVLVSVRE
Y064_MYCTU       TLLERS---NRIHYG-NLLSLPIADGGVLYVEPLYTERISTSPSSSTFPQLSRVLVSVRE
Y8670_RHOJR      TLLERS---NRIYYA-NLLTLPIADGGILYVEPVFTERLTSTPNSSTFPQLARVLVSYRE
Y4526_NOCFA      TLLSNS---NKIRYG-NLLTLPIADGGILYVEPFYNERN-TGPNTATFPQLLRVLVSYRD
Y6389_RHOJR      TLLERS---NKIQYG-NLLTLPIADGGILYVEPMYTERSSTGPNTSTFPQLSRVLVSYRE
Y3215_MYCBO      GVIGRDN-QNRIRWG-NLLTLPVAQGGLLYVEPVY-ASPGASDAASSYPRLIRVAMMYND
Y3193_MYCTU      GVIGRDN-QNRIRWG-NLLTLPVARGGLLYVEPVY-ASPGASDAASSYPRLIRVAMMYND
Y3215_MYCBP      GVIGRDN-QNRIRWG-NLLTLPVAQGGLLYVEPVY-ASPGASDAASSYPRLIRVAMMYND
Y3291_MYCPA      GVIGRDN-QNRIRWG-NLLTLPVGQGGLLYVEPVY-ASPGASDAASSYPRLIRVAMMYND
Y4137_MYCA1      GVIGRDN-QNRIRWG-NLLTLPVGQGGLLYVEPVY-ASPGASDAASSYPRLIRVAMMYND
Y2505_MYCUA      GVIGRDN-QNRIRWG-NLLTLPVGQGGLLYVEPVY-ASPGASDAASSYPRLIRVAMMYND
Y644_MYCLE       GVIGRDN-QNRIRWG-NLLTLPVAQGGLLYVEPVY-ASPGVSDAASSYPRLIRVAMMYND
Y1433_MYCSK      GVIGRDN-QNRIRWG-NLLTLPVGPGGLLYVAPVY-ASPGTSDAASTYPRLIRVAMFYND
Y1415_MYCSS      GVIGRDN-QNRIRWG-NLLTLPVGPGGLLYVAPVY-ASPGTSDAASTYPRLIRVAMFYND
Y1469_MYCSJ      GVIGRDN-QNRIRWG-NLLTLPVGPGGLLYVAPVY-ASPGTSDAASTYPRLIRVAMFYND
Y1814_MYCVP      GVIGRDN-QNRIRWG-NLLTLPMGQGGLLYVAPVY-ASPGASDAASSYPRLIRVAMMYND
Y1102_SACEN      TLFNNP--QVTAIFG-NLLTLPVA-GGLLYVEPIYIQRN----ETESYPQLARVLVSFGG
Y3055_STRAW      RLLKGG--DSEVEYG-NLLTVPLD-GGLLYVEPVYVRGGG-----LKYPLLRKVLVTYGG
Y5204_STRCO      RLLRGG--DSEVEYG-NLLTVPLD-GGLLYVEPVYVRGGD-----LKYPLLRKVLVSYGG
Y541_THEFY       LPLEQS--SAQVTYG-NLLTLPFA-GGLLYVEPLYVQAGGSD---ASYPLLQQVLVGFGD
Y1530_NOCSJ      AQFNRS--GARPVYG-NLLTLPIN-DGLMYVQPVYATQALSD---SSFPILRYVLVKYGN
Y6027_FRAAA      TLWRGA--GSQTIEG-NLLTLPVA-GGLLYVEPYYVQARGG----SGYPTLQGIATAFGE
Y3781_FRACC      SLWRSG--GATTIEG-NLLTLPLA-GGLLYVEPYYVQARGS----TGYPTLQGVATAFGD
Y2732_PAEAT      NLLRQG--ASDVLNG-NLLTLPVG-GGLLYVQPVYLKSTGE----TSYPTLQRVLVAFGD
Y2749_ARTS2      NLLRQG--ASAVLNG-NLLTLPVG-GGLLYVQPVYLRSTGE----TSYPTLQRVLVAFGD
Y930_LEIXX       NLLRQG--KTDVTNG-NLLTLPVG-GGLLYVQPVYVKSTGE----TSYPILQKVLVAFGD
Y644_TROW8       NILRQGG-QTRVLPG-NLLTLPVG-GGFLYVQPVYVQSTGS----TSYTLLQKVLAAFGN
Y641_BIFAA       NLLESG--STNVQRG-NLLTLPLG-GGLVYVQPVYVKSSGS----TSFPLLKKVLVAFGD
Y1029_BIFLO      NLLQSG--DTQVVRG-NLLTLPLG-GGLVYVQPVYVKSSGA----TSFPLLKKTLVAFGD
                               .     :*.    .:*: . :             . :         

Y1037_NOSS1      R-------IVMAQTLEQALQAIFQPEVTPAPAIIRPFE----------------------
Y3693_TRIV2      R-------IVMAQTLEQALQAIFQPEVTPAPAIIRPFE----------------------
Y938_TRIEI       R-------VVMKPTLDEALQEVFQIQ----------------------------------
Y1193_THEEB      R-------IVMAPTLEEALKQLFPQ-----------------------------------
Y1060_SYNY3      Q-------IAMAESLNEAIEAIFDPNPTGRNAIVRPLD----------------------
Y2310_SYNP6      R-------IVMTPSLLESLQKLFPDSTPALTPLEQPVL----------------------
Y1783_SYNE7      R-------IVMTPSLLESLQKLFPDSTPALTPLEQPVL----------------------
Y1461_PROM3      R-------IAMAEDLGEGLRALVDGSSKKAVYLNRNDL----------------------
Y755_PROMM       R-------IAMAEDLGEGLRALVDGSSNKAVYLNRNDL----------------------
Y1321_SYNS3      R-------VAMANDLNTGLEALLQGSGSKDVVVQELDQ----------------------
Y1212_SYNPX      T-------IAMADTLPGAIDRLMQKTLPPVATGS--------------------------
Y1151_SYNS9      G-------IAMDVNLSAAIDRLIKKTPYGITEGVSTDR----------------------
Y1323_SYNSC      L-------VAMDQDLNLALDQLMKKAPPV-------------------------------
Y1810_SYNJA      R-------VVMEPTLSQALEALFSPTGSRRSNR---------------------------
Y372_SYNJB       R-------VVMEPTLGQALEALFLPRGSR-------------------------------
Y6445_SOLUE      R-------LIYADTYDQALAQLSSGAQALVTEATAPGS----------------------
Y1303_METHJ      K-------LTMQPTLNEALQVIFGGRQARQDITKRVE-----------------------
Y4385_TRIEI      E-------VVMTETLSKSLETIFGMEVKQPEVKVTEK-----------------------
Y086_CLOTE       K-------IVLDTTMDEALTKLFTK--KEEGKEENIE-----------------------
Y852_CLONN       K-------LILAENIEKALSQLFDYDKKNDAKEEVIL-----------------------
Y010_CLOAB       K-------MVMANSIDEALNQIFNNSSNNQSETRTET-----------------------
Y011_CLOPE       K-------IVIEENIEKALLKLFNYNSSEENKNSNKD-----------------------
Y011_CLOP1       K-------IVIEENIEKALLKLFNYSSSEENKNSNKD-----------------------
Y011_CLOPS       K-------IVIEENIEKALLKLFNYNSFEENKNSNKD-----------------------
Y1630_DESHY      K-------IVMSETFEEALAQLFGVRLKLSPPPPANV-----------------------
Y1421_ARCFU      E-------LATGTNLYEALENLFKGEKPAEKPATPEK-----------------------
Y2689_PELPD      Q-------VVMEENLEQALQRLFGGKRAPEPASSATA-----------------------
Y3567_PELPD      Q-------LVMEENLELALQRIFGGKKAAPAATSGVS-----------------------
Y2333_GEOSL      E-------VVMEESLELALQRIFGGKRAPVAGVAAAP-----------------------
Y1139_MOOTA      K-------IAMADTLAGALQVIFGTQTPAPAASPQPPS----------------------
Y1161_SYNWW      K-------VVMEPSLDTALLKLFGQNQRVESQQTGVVV----------------------
Y7333_BRADU      H-------VVMKETLDEALSALFTEPGAVRPVSSTMEE----------------------
Y1615_CUPNH      R-------VVMEDTLGAALAALFKE--------SAPAA----------------------
Y2225_SALRD      D-------VAMKRTLRQSLNSVLGEQVVETRDQALAQM----------------------
Y961_NITOC       S-------VVMEPTLMEAYAKLKERIETEGAEGESH------------------------
Y2137_SYNFM      I-------VVMEPSLEEAYAKLQERIKLEIDRVDKRFA----------------------
Y2716_METCA      I-------VVMETSLEAALNKLEERLIALQKARGIVPV----------------------
Y786_CORGL       Q-------VGYAPTIAEALSQVGIDPKEAQDIEEV-------DGTATTPS----------
Y802_COREF       Q-------VGYAPTIAEALSQVGIDPAAAQDIEVVE-----EDGTVTVPD----------
Y733_CORDI       K-------VGYAPTIAEALSQVGIDPKEAQDLGEA---------KGLKPE----------
Y1603_CORJK      Q-------VGYAPTIAEALDQVGIKTSSTTDIQEID-----GSVVDPTKDGGSGNKGDKG
Y065_MYCBO       PRTEGGVRVGYAPTLAESLDQVFGPGTGRVATAPG------GDAASAPPPGAGGPAPPQA
Y095_MYCBP       PRTEGGVRVGYAPTLAESLDQVFGPGTGRVATAPG------GDAASAPPPGAGGPAPPQA
Y064_MYCTU       PRTEGGVRVGYAPTLAESLDQVFGPGTGRVATARG------GDAASAPPPGAGGPAPPQA
Y8670_RHOJR      P-GTGGVRIGYAPTLAEALDQVFGTGTGAVATAPG------GDATTPPPTGGQPPAPP--
Y4526_NOCFA      Q--AGSVKVGYASTLAEALNQVL-PGAGSLATPFG------GDPATRPQPGTAPPVVDST
Y6389_RHOJR      PPPSNSVRVGYAPTLAQALDQVFGAGTGSVATAPS------AEEGTPPETGTTPPV----
Y3215_MYCBO      K-------VGYGPTVRDALTGLFGPGAGATATGIAPTEA--AVPP-SPAANPPPPASGPQ
Y3193_MYCTU      K-------VGYGPTVRDALTGLFGPGAGATATGIAPTEA--AVPP-SPAANPPPPASGPQ
Y3215_MYCBP      K-------VGYGPTVRDALTGLFGPGAGATATGIAPTEA--AVPP-SPAANPPPPASGPQ
Y3291_MYCPA      K-------IGYGPTVRDALTGLFGPGAGAAATNIQPTEG--GAPAASPPANAPAPAVTPG
Y4137_MYCA1      K-------IGYGPTVRDALTGLFGPGAGAAATNIQPTEG--GAPAASPPANAPAPAVTPG
Y2505_MYCUA      K-------IGYGPTVRDALNGLFGPGAGDAATGIQPTEG--GAPANVPPNNAPSPEALPG
Y644_MYCLE       K-------IGYGPTVGDALTGLFGPGAASAATGIEPTEA--VPPK-SPAGSSTPPIA---
Y1433_MYCSK      Q-------VGYGPTVRDALTDLFGAGADATATGPAPANLPDGQPAAQPPNGQQPAAQTPG
Y1415_MYCSS      Q-------VGYGPTVRDALTDLFGAGADATATGPAPANLPDGQPAAQPPNGQQPAAQTPG
Y1469_MYCSJ      Q-------VGYGPTVRDALTDLFGAGADATATGPAPANLPDGQPAAQPPNGQQPAAQTPG
Y1814_MYCVP      Q-------IGYGPTVRDALTDLFGPGADATATGPAATEPPAGQ-APQPQGNNQPPAAAPP
Y1102_SACEN      K-------VGFSETLAGALEQVFGPGAGQTAGDEPP-----PGQDSNQPPGQQPPTQ---
Y3055_STRAW      N-------TAFEDTLDEALNKVFGADS--TTQPPDEG---TTKPPT--------------
Y5204_STRCO      N-------TAFENTLDAALNKVFGAQAAETEQPPDEGDDTTEPPPT--------------
Y541_THEFY       Q-------VAIGSNLQEALNNLFDGDEAPLEEPTTDGEAREEEEQP--------------
Y1530_NOCSJ      D-------IGFGSTLRDALENLLGVSTGPGTQPPDTGQPGDNENPPPATG----------
Y6027_FRAAA      R-------IGFGTSLGEALDKVFGSGAGAAAAGAGTGATTTTGG--GGQATTQGGGTGAA
Y3781_FRACC      R-------IGFGASLGEALDKVFGAGAGAAAAGAGIGATTTDAGQDGTPAPRSGQGGAGV
Y2732_PAEAT      K-------IGFAPTLDEALDQLFGGDSGATAGDS-------------------------D
Y2749_ARTS2      K-------IGFAPTLDEALNQLFGGQSGAKAGDF-------------------------A
Y930_LEIXX       K-------IAFEDTLDQALDSLFGGDSGATAGDNNVPAT--PGGSGGGSSGDAGSSAGGG
Y644_TROW8       K-------IAFESTLNQALDSLFAGNSGAS------------------------------
Y641_BIFAA       Q-------VGFADTLDEALDQVFGGDSGASAGDAENVGD--TTDDKQDAKNDDSADGKTN
Y1029_BIFLO      Q-------VGFADTLDEALDQVFGGDSGAAAGDAENVSG--DQSG-------------SD
                                  .   :                                      

Y1037_NOSS1      ----------------EGTTPDS-------------------------------------
Y3693_TRIV2      ----------------EVTPPG--------------------------------------
Y938_TRIEI       ------------------------------------------------------------
Y1193_THEEB      ------------------------------------------------------------
Y1060_SYNY3      ----------------DTVNDLNSELN---------------------------------
Y2310_SYNP6      ----------------TTEQSAVLNPDQP-------------------------------
Y1783_SYNE7      ----------------TTEQSAVLNPDQP-------------------------------
Y1461_PROM3      ----------------PPIKAADQSN----------------------------------
Y755_PROMM       ----------------PPIKAADQLN----------------------------------
Y1321_SYNS3      ----------------SS------------------------------------------
Y1212_SYNPX      ------------------------------------------------------------
Y1151_SYNS9      ----------------LDESRKRSIS----------------------------------
Y1323_SYNSC      ------------------------------------------------------------
Y1810_SYNJA      ------------------------------------------------------------
Y372_SYNJB       ------------------------------------------------------------
Y6445_SOLUE      ----------------STAPKAAAVAPATGDARLQSVRDHLRRYRELASQGKWSDAGKEL
Y1303_METHJ      ----------------QPGDD---QSSSILGQISGLYKQAQQALS----SGSLGEYQQFV
Y4385_TRIEI      ----------------TPETK---NISELINSIVEAYSQTEAARR----KDNWVEYGKSK
Y086_CLOTE       ----------------DNK-------INSIKEAKVIYDKAIKAQR----DGDWAKYGEYI
Y852_CLONN       ----------------NKKES----VPDELKDAKELYEKAIEAQK----QGNWAEYGENI
Y010_CLOAB       ----------------GGTSTDSSNNKDKLKQAQDLYNQAVDAQK----NGDWSKYGDYI
Y011_CLOPE       ----------------ETPKTEITSDKSGVKEAADLFNKAIEAQK----NGDWATYGEFI
Y011_CLOP1       ----------------ETPKNEITSDNSGIKEAADLFNKAIEAQK----NGDWATYGEFI
Y011_CLOPS       ----------------ETSNTEITSDNSGVKEAADLFNKAIEAQK----NGDWATYGEFI
Y1630_DESHY      ----------------SALAVSPMSAELKPEETEETTEETEEPVDP---QEDTQALLKQI
Y1421_ARCFU      ----------------PSE-----TVEEKLEILREYYSKLVDAAK----NGDWETFGEML
Y2689_PELPD      -------------------KDSTTSPALLAKEAMAAYEKAISQQR----QGNWSGYGEEL
Y3567_PELPD      -------------------ADTQASPATLAKEAVSIYEKAITLQR----QGNWAAYGEEL
Y2333_GEOSL      -------------------EDGKASTGDLAREAMSIFERATNLQR----QGDWAGYGEEL
Y1139_MOOTA      ----------------QAATGSPGNLSELIKEANRLYSEAQDRLK----QGDWAGYGENL
Y1161_SYNWW      ----------------TPGELPGATVAELAKSAREYYDRANQLLR----DGDWAGYGENI
Y7333_BRADU      ----------------MPVTRPSASQAREALDRYNQAVERLR-------SGDWKGFGTQF
Y1615_CUPNH      ----------------IPAQGAANARAREALAHYDRAVERLK-------AGDWSGFGAEL
Y2225_SALRD      ----------------QQAAQTAQAASPEQVEGLERAKELIQEARDALQGGDFATFGDRF
Y961_NITOC       ------------------------------------------------------------
Y2137_SYNFM      ----------------PLLPGSPAGR----------------------------------
Y2716_METCA      ----------------SPVRDSPGMHPM--------------------------------
Y786_CORGL       --TDETDTDTDQP--ATETPTAPV----SEAEGIAAINDALSNLEAARD-SSFEEYGRAL
Y802_COREF       --VNATEDADATTDGEDETPAAPAAPAGSEAEGIEAINEALRNLEAARD-GSFEEYGRAL
Y733_CORDI       --SQNRDKPEDKEGKAPSTPSAPASGSGTTGEAIGKINDALNKLQSAKN-GSNEEYGRAL
Y1603_CORJK      KDADKDKKSKDEQSSDAKGAAGKSDDKGTDTAPEQRVRDAMDKVNKTRESGTFEEFGKAL
Y065_MYCBO       VP------PPRTTQPPA----APPRGPDVPPATVAELRETLADLR------------AVL
Y095_MYCBP       VP------PPRTTQPPA----APPRGPDVPPATVAELRETLADLR------------AVL
Y064_MYCTU       VP------PPRTTQPPA----APPRGPDVPPATVAELRETLADLR------------AVL
Y8670_RHOJR      --------PP--GAPPA----PPPATSDQLTAAVLELNNALANLREAQHTGDFTTYGAAL
Y4526_NOCFA      QP------PADGGTPQPQ-TTPPPTGSAAKDAAAAELDRKIEAVRNAMRSGNFQDFGKAL
Y6389_RHOJR      ---------DQGAAPAPT-APATPPSGTDVSAAVAELDASLDALTSAQRSGDFAAYGAAL
Y3215_MYCBO      P-------PPVTAAPPV--PVGAVTLSPAKVAALQEIQAAIGAARDAQKKGDFAAYGSAL
Y3193_MYCTU      P-------PPVTAAPPV--PVGAVTLSPAKVAALQEIQAAIGAARDAQKKGDFAAYGSAL
Y3215_MYCBP      P-------PPVTAAPPV--PVGAVTLSPAKVAALQEIQAAIGAARDAQKKGDFAAYGSAL
Y3291_MYCPA      S-------APPVAAPPV--PDGSVTLSPAKAAVLQEIQAAIGAAKDAQKKGDFAGYGAAL
Y4137_MYCA1      S-------APPVAAPPV--PDGSVTLSPAKAAVLQEIQAAIGAAKDAQKKGDFAGYGAAL
Y2505_MYCUA      TPP-----SPPTAVPPA--PEASVTLSPARAAAMKEIQSAIGAARDAQKKGDFAAYGAAL
Y644_MYCLE       ------------VVPSA--PDGSVALSAAKAAALQEIQAVIGAAREAQKKGDFVAYGSAL
Y1433_MYCSK      NQAGRAPTPPPAAIPSG--PSGPQQLSEAKAAALQEVQEAMSGLQDAQRSGNFAEYGEAL
Y1415_MYCSS      NQAGRAPTPPPAAIPSG--PSGPQQLSEAKAAALQEVQEAMSGLQDAQRSGNFAEYGEAL
Y1469_MYCSJ      NQAGRASTPPPAAIPSG--PSGPQQLSEAKAAALQEVQEAMSGLQDAQRSGNFAEYGEAL
Y1814_MYCVP      NRPGQAPTPQQPEVPVAVPPTGPTQLSAGKAAALQDVNAALDALQDAQRSGDFAQYGEAL
Y1102_SACEN      ---------------------QPPAGSPEMTKAVADIRTALESVRSAQQSGNFGRLGAAY
Y3055_STRAW      --------------------SSNPTVQEALNDAQKAFDAGQEALKKP----DWQAYAKAQ
Y5204_STRCO      --------------------STNPTVREALSDAQKAFDAGQKALEQK----DLAAYAEAQ
Y541_THEFY       --------------------QASSDLAQALEDAAEAYEEGQAALREG----DFAAYGEAN
Y1530_NOCSJ      --------------------TVAAQIRALLAQAQDAFDAADAALADG----NLAEYQRQI
Y6027_FRAAA      P------------------PGGTSGLQDAVNDADSAYKAGQDALRKNPP--DFNAYGQAQ
Y3781_FRACC      P------------------PPGQTALQDAVGDADRAYQAGQDALRKSPP--DFTAYGKAQ
Y2732_PAEAT      NNGQTPTSPPG-TTP---PPAGPTDAKADLKAALDEANKAIQDGQAALAKGDFAGYGAQQ
Y2749_ARTS2      NNGQTPPPAAGGSTP---PATGGTDAKAELKAALDEANAAIRAGQEALAKGDFAAYGEQQ
Y930_LEIXX       SSGGGGSSAGGSSSG---SGSSGTQSNAALQRALQQAKQALSDREAALKAGDWAAYGAAD
Y644_TROW8       NSG----------------TSDISIHPPPHSDLIAQIKAALREKVDALTNKDLVKYAQAD
Y641_BIFAA       TDGKQDTPSNTDGKTGGNNGDSSGTMSADLKKALDDAAQAMKDSDAAMKKGDWSAYGDAQ
Y1029_BIFLO      TNGGQ--SGTTDGKS---DSGSSSDRSPELQQALNDAAQAMKDSQSAMKNGDWTAYGKAQ
                                                                             

Y1037_NOSS1      ------------------------------------------------------------
Y3693_TRIV2      ------------------------------------------------------------
Y938_TRIEI       ------------------------------------------------------------
Y1193_THEEB      ------------------------------------------------------------
Y1060_SYNY3      ------------------------------------------------------------
Y2310_SYNP6      ------------------------------------------------------------
Y1783_SYNE7      ------------------------------------------------------------
Y1461_PROM3      ------------------------------------------------------------
Y755_PROMM       ------------------------------------------------------------
Y1321_SYNS3      ------------------------------------------------------------
Y1212_SYNPX      ------------------------------------------------------------
Y1151_SYNS9      ------------------------------------------------------------
Y1323_SYNSC      ------------------------------------------------------------
Y1810_SYNJA      ------------------------------------------------------------
Y372_SYNJB       ------------------------------------------------------------
Y6445_SOLUE      EAIEALVK----------------------------------------------------
Y1303_METHJ      DRIGTLVSGY--------------------------------------------------
Y4385_TRIEI      QKFEQLLQQLKKQTESN-------------------------------------------
Y086_CLOTE       KKLGNILEYMVK------------------------------------------------
Y852_CLONN       KRLGDILNKLNHPK----------------------------------------------
Y010_CLOAB       NKLGKTLDELNK------------------------------------------------
Y011_CLOPE       NKLGDVLNKISQE-----------------------------------------------
Y011_CLOP1       NKLGDILNKMSQE-----------------------------------------------
Y011_CLOPS       NKLGDVLNKMSHD-----------------------------------------------
Y1630_DESHY      EQIREMLNQLEQQFKKITGDSVDVEGGKKADEDAHDVQTDPEGSVSSEQSKTNP------
Y1421_ARCFU      KKIGEVLGYEGE------------------------------------------------
Y2689_PELPD      RRLEQILRRMAQ------------------------------------------------
Y3567_PELPD      RSLEQILKKMAR------------------------------------------------
Y2333_GEOSL      RKLQQVLKQLAR------------------------------------------------
Y1139_MOOTA      KKLEQVLQEMGQKVAE--------------------------------------------
Y1161_SYNWW      KKLNETISRLEEAAKP--------------------------------------------
Y7333_BRADU      DAMRELLEDMNRHSADR-------------------------------------------
Y1615_CUPNH      DALRPLLEALGAGAADERK-----------------------------------------
Y2225_SALRD      DELQQVLNDVPLPDTTGTVPPPTSSDTTGTMTAPTGDVSEVTGGS---------------
Y961_NITOC       ------------------------------------------------------------
Y2137_SYNFM      ------------------------------------------------------------
Y2716_METCA      ------------------------------------------------------------
Y786_CORGL       DALDRAVDSYQSAQ----------------------------------------------
Y802_COREF       DALDRAVESYQGAGTAE-------------------------------------------
Y733_CORDI       DELDKAVEEYRKVAGQ--------------------------------------------
Y1603_CORJK      DELDKAVQDLQSER----------------------------------------------
Y065_MYCBO       DRLEKAIDAAETPGG---------------------------------------------
Y095_MYCBP       DRLEKAIDAAETPGG---------------------------------------------
Y064_MYCTU       DRLEKAIDAAETPGG---------------------------------------------
Y8670_RHOJR      DRLQQAIDTYLAAGGTPH------------------------------------------
Y4526_NOCFA      EELEAAVKTYQDAGR---------------------------------------------
Y6389_RHOJR      ARVQKAVAAYEAIPK---------------------------------------------
Y3215_MYCBO      QRLDEAITKFNDAG----------------------------------------------
Y3193_MYCTU      QRLDEAITKFNDAG----------------------------------------------
Y3215_MYCBP      QRLDEAITKFNDAG----------------------------------------------
Y3291_MYCPA      QRLDDAITKYNNTK----------------------------------------------
Y4137_MYCA1      QRLDDAITKYNNTK----------------------------------------------
Y2505_MYCUA      QRLDDAITKFNNTQ----------------------------------------------
Y644_MYCLE       QRLDDAITKFNSTK----------------------------------------------
Y1433_MYCSK      QRLDDAMNRYSEAR----------------------------------------------
Y1415_MYCSS      QRLDDAMNRYSEAR----------------------------------------------
Y1469_MYCSJ      QRLDDAMNRYSEAR----------------------------------------------
Y1814_MYCVP      QRLDDAVNKYQATN----------------------------------------------
Y1102_SACEN      QQLDEALKRFEQLGGTGG------------------------------------------
Y3055_STRAW      KDLEDALKRAEDAQAEADKASGGSKSGDSGKGSGPTSSPSGSASSSPSSSPSSDKSPSSD
Y5204_STRCO      KDLEEALQRAEDAQAKADQGAGGKNGDDKNAGDKNSGDKAGSDKAGPDATPTGDAGGGAD
Y541_THEFY       ERLKEALDRAKAASGSNEEKDE--------------------------------------
Y1530_NOCSJ      GIAQANVEAAMELGQKRGSAGQ------------PSGSPSGSASSSPSESPSPSS-----
Y6027_FRAAA      TDLADALSRLRTLASPPTTPPAASPTPSRSAAPTTRGTAAGSAPPGTTPAVAAPAGPSGP
Y3781_FRACC      SELADALGRLRTLSSPAATPPAATATRA--------GASVPASPVPASPAAKPPAPSPSA
Y2732_PAEAT      TKLSEALKKAIDAQARLDA-----TPAPTATPGATPSATPSPSPSS--------------
Y2749_ARTS2      KKLSAALQKAIDAEAKLGSEGASPTPGATTAPTATPSAAATPSPSPSN------------
Y930_LEIXX       SRLQQALQAAIAAEGR--------------------------------------------
Y644_TROW8       SKLNELLSRYLDANRG--------------------------------------------
Y641_BIFAA       KQLQEALNKAIELEQ---------------------------------------------
Y1029_BIFLO      QELEDALNKAIELDK---------------------------------------------
                                                                             

Y1037_NOSS1      ---------------------
Y3693_TRIV2      ---------------------
Y938_TRIEI       ---------------------
Y1193_THEEB      ---------------------
Y1060_SYNY3      ---------------------
Y2310_SYNP6      ---------------------
Y1783_SYNE7      ---------------------
Y1461_PROM3      ---------------------
Y755_PROMM       ---------------------
Y1321_SYNS3      ---------------------
Y1212_SYNPX      ---------------------
Y1151_SYNS9      ---------------------
Y1323_SYNSC      ---------------------
Y1810_SYNJA      ---------------------
Y372_SYNJB       ---------------------
Y6445_SOLUE      ---------------------
Y1303_METHJ      ---------------------
Y4385_TRIEI      ---------------------
Y086_CLOTE       ---------------------
Y852_CLONN       ---------------------
Y010_CLOAB       ---------------------
Y011_CLOPE       ---------------------
Y011_CLOP1       ---------------------
Y011_CLOPS       ---------------------
Y1630_DESHY      ---------------------
Y1421_ARCFU      ---------------------
Y2689_PELPD      ---------------------
Y3567_PELPD      ---------------------
Y2333_GEOSL      ---------------------
Y1139_MOOTA      ---------------------
Y1161_SYNWW      ---------------------
Y7333_BRADU      ---------------------
Y1615_CUPNH      ---------------------
Y2225_SALRD      ---------------------
Y961_NITOC       ---------------------
Y2137_SYNFM      ---------------------
Y2716_METCA      ---------------------
Y786_CORGL       ---------------------
Y802_COREF       ---------------------
Y733_CORDI       ---------------------
Y1603_CORJK      ---------------------
Y065_MYCBO       ---------------------
Y095_MYCBP       ---------------------
Y064_MYCTU       ---------------------
Y8670_RHOJR      ---------------------
Y4526_NOCFA      ---------------------
Y6389_RHOJR      ---------------------
Y3215_MYCBO      ---------------------
Y3193_MYCTU      ---------------------
Y3215_MYCBP      ---------------------
Y3291_MYCPA      ---------------------
Y4137_MYCA1      ---------------------
Y2505_MYCUA      ---------------------
Y644_MYCLE       ---------------------
Y1433_MYCSK      ---------------------
Y1415_MYCSS      ---------------------
Y1469_MYCSJ      ---------------------
Y1814_MYCVP      ---------------------
Y1102_SACEN      ---------------------
Y3055_STRAW      KSPGSD---------------
Y5204_STRCO      TG-------------------
Y541_THEFY       ---------------------
Y1530_NOCSJ      ---------------------
Y6027_FRAAA      PSPAGATAGPPQQPRAAPPPG
Y3781_FRACC      TVAGGDTPGPPG-ARAAPAPG
Y2732_PAEAT      ---------------------
Y2749_ARTS2      ---------------------
Y930_LEIXX       ---------------------
Y644_TROW8       ---------------------
Y641_BIFAA       ---------------------
Y1029_BIFLO      ---------------------