CLUSTAL format seed alignment for MF_01601

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

HLDD_DECAR            --------------------MYIVVTGAAGFIGSNIVKALNE--RGITNIIAVDNLTKA-
HLDD_THIDA            ------------------MSQYTVVTGAAGFIGANIVKALNE--RGETNIIAVDNLTKA-
HLDD_NEIMB            --------------------MTIIVTGAAGFIGSNIVKALNQ--RGITDIVAVDNLSKG-
HLDD_NEIG1            --------------------MTIIVTGAAGFIGSNIVKALNQ--RGITDIVAVDNLTKG-
HLDD_CHRVO            --------------------MTIVVTGAAGFIGSNLVKGLNQ--RGITDIIAVDNLSNG-
HLDD_RALSO            --------------------MTIIVTGAAGFIGANLVKGLND--RGETDIIAVDNLTRA-
HLDD_CUPNH            --------------------MTIIVTGAAGFIGSNLVKGLND--RGETNVIAVDNLTRA-
HLDD_CUPMC            --------------------MTIIVTGAAGFIGSNIVKGLNE--RGETNIIAVDNLTRA-
HLDD_PARXL            --------------------MTLIVTGAAGFIGSNLVKALNE--RGEQRIIAVDNLTRA-
HLDD_BURPS            --------------------MTLIVTGAAGFIGANIVKALNE--RGETRIIAVDNLTRA-
HLDD_CUPPJ            --------------------MTIIVTGAAGFIGSNLVKGLNA--RGENHIVAVDNLHRA-
HLDD_PSEAE            --------------------MSIIVTGAAGFIGSNLLQALNR--RGETDIIAVDDLTDG-
HLDD_POLSJ            --------------------MKIVVTGAAGFIGSNLVKGLND--RGIDDIIAVDDLTHG-
HLDD_POLNA            --------------------MKIVVTGAAGFIGSNLVKGLNA--RGIDDIIAVDDLTQG-
HLDD_RHOFT            -------------------MTRIVVTGAAGFIGSNIIQGLNA--RGLNDIIAIDDLTQG-
HLDD_BORPE            ---------------------MIVVTGAAGFIGSNLVRGLNR--RGIQDIIAVDDLTDG-
HLDD_BORA1            ---------------------MIVVTGAAGFIGSNLVRGLNR--RGIYDIIAIDDLTEG-
B7JC62_ACIF2          ---------------------MYIVTGGAGFIGANLVQALNQ--RGITDILVVDHLSRA-
HLDD_MARHV            ---------------------MIVVTGGAGFIGANIIHALNL--RGETDILVVDDLTDG-
HLDD_CHRSD            ---------------------MIVVTGGAGFIGANLVKALNA--RGREDVLVVDDLSDG-
HLDD_HYDCU            ---------------------MIVVTGGAGFIGSNIVKALNA--QGRTDILVVDNLKNG-
HLDD_AZOSB            ---------------------MIIVTGGAGFIGSNIVQGLND--RGITDILVVDDLRDG-
HLDD_AROAE            ---------------------MIIVTGGAGFIGSNIVQGLNA--RGITDILVVDDLTDG-
HLDD_ALKEH            ---------------------MIIVTGGAGFIGSNLVHELNR--RGRTDVIVVDNLTRG-
HLDD_SHELP            ---------------------MIIVTGAAGFIGSNLVKALNN--LGRSDIIAVDDLTDG-
HLDD_SHEFN            ---------------------MIVVTGAAGFIGSNLVKQLNA--MGRNDIIAVDDLTDG-
HLDD_RHILO            ---------------------MIIVTGGAGMIGSNIVAALNA--EGHDDILVVDDLTDG-
HLDD_PELCD            ---------------------MLIVTGGAGFIGSNIVQALNA--RGREDILVVDDLTDG-
HLDD_SALAR            ---------------------MIIVTGGAGFIGSNIVKALND--KGITDILVVDNLKEG-
HLDD_SALTY            ---------------------MIIVTGGAGFIGSNIVKALND--KGITDILVVDNLKDG-
HLDD_ECOLI            ---------------------MIIVTGGAGFIGSNIVKALND--KGITDILVVDNLKDG-
HLDD_KLEP7            ---------------------MIIVTGGAGFIGSNIVKALND--KGITDILVVDNLKDG-
HLDD_CITK8            ---------------------MIIVTGGAGFIGSNIVKSLND--KGITDILVVDNLKDG-
HLDD_ENT38            ---------------------MIIVTGGAGFIGSNIIKALND--KGITDILVVDNLKDG-
HLDD_CROS8            ---------------------MIIVTGGAGFIGSNIVKALND--IGYTDILVVDNLKDG-
HLDD_PHOLL            ---------------------MIIVTGGAGFIGSNIVKALND--EGYKDILVVDNLKDG-
A0A1B8SW97_PRORE      ---------------------MIIVTGGAGFIGSNIIKALNA--IGRTDILVVDNLKDG-
HLDD_SODGM            ---------------------MIVVTGGAGFIGSNIVKALNQ--IGYNDVLVVDNLKDG-
HLDD_YERPE            ---------------------MIIVTGGAGFIGSNIVKALNN--IGYKDILVVDNLKDG-
HLDD_SERP5            ---------------------MIIVTGGAGMIGSNIIKALND--TGYRDILVVDNLKDG-
HLDD_PASMU            ---------------------MIIVTGGAGFIGSNIVKALNE--LGRTDILVVDNLKDG-
HLDD_HAEIN            ---------------------MIIVTGGAGFIGSNIVKALND--LGRKDILVVDNLKDG-
HLDD_ACTSZ            ---------------------MIIVTGGAGFIGSNIVKSLND--LGRKDILVVDNLKDG-
HLDD_ACTP2            ---------------------MIIVTGGFGMIGSNIVKALNE--IGRKDILVVDNLKNG-
HLDD_VIBPA            ---------------------MIIVTGGAGMIGSNIVKALNE--AGINDILVVDNLKNG-
HLDD_VIBVY            ---------------------MIIVTGGAGMIGSNIVKALNE--IGINDILVVDNLKNG-
HLDD_VIBCH            ---------------------MIIVTGGAGMIGSNIIKALNE--RGITDILVVDHLKNG-
HLDD_PSYIN            ---------------------MFIVTGGAGFIGSSIVKSLNE--RGITDILVVDDLTDG-
HLDD_HAMD5            ---------------------MIIVTGGAGFIGSNIVRALNK--IGYQDILVVDNLEKG-
Q7U354_BLOFL          ---------------------MIIVTGGAGFIGRNLIRRLNK--IQRTDILVVDNLRNG-
D2RLQ8_ACIFV          ---------------------MIIVTGGAGFIGSNIVKGLNE--QGRDDILVVDNLTNM-
Q1IJY8_KORVE          ---------------------MVIVTGGAGFIGSNLVHELNA--EGITDVLVVDNLANA-
HLDD_DESVH            ---------------------MYIVTGGAGFIGSAMVWKLNE--MGIEDIVVVDNLSTS-
B8J2P7_DESDA          ---------------------MYVITGGAGFLGSALLWQLNC--MNIDDIVIVDNLARS-
F0JFV9_DESDE          ---------------------MYIVTGGAGFIGSAMVWKLNT--MGIDDILVVDNLSTS-
I3ZEM0_TERRK          ---------------MTAMGKMTVVTGAAGFIGRNVVAELNR--RGQTNLLLVDDLGTD-
C1ACL5_GEMAT          MTEANSHRPLPLLSVLDTLPTRVLVTGGAGFIGSALVWALNQ--QGVDRIVIADRLGQD-
C6JQ57_FUSVA          ---------------------MIIVTGAAGMIGSAFVWKLNE--MGINDIIVVDKFRTE-
HLDD_FUSNN            ---------------------MIIVTGGAGMIGSAFVWKLNE--MGIKDILIVDKLRKE-
D2QPF1_SPILD          ---------------------MIIVTGAAGFIGSCLISKLNQ--ENFNFIIAVDDFSYP-
A0A6N4SQL2_CYTH3      ---------------------MMVVTGAAGFIGSCLIQRLNE--LNFNFIVAVDHFENP-
E4TNZ9_MARTH          ---------------------MIIVTGAAGFIASNLIKKLNS--EGFNHIIAVDKFDNP-
Q6MHK5_BDEBA          ---------------------MIIVTGANGFIGSVMVWELNQ--KGLTDIIAVDSVGLS-
I3TID4_TISMK          ---------------------MIVVTGGAGFIGSNILAGLEA--RGHDDLVVVDTLGTD-
A7ILV4_XANP2          -----------MTRSVALSRDLLLVTGGAGFIGSNIARAAAE--DGYR-VVVADWLEDG-
B6JBC5_OLICO          ---------------------MFLVTGGAGFIGSNIVAALNE--AGHADVVVSDFLGDE-
Q89HR2_BRADU          ---------------------MLLVTGGAGFIGSNVVAALND--AGRSDVAVCDFLGTD-
B4RAY4_PHEZH          -----------------MTRKIVFVTGGAGFIGSNIAAKLAE--DRSLDVVVCDRLREAE
C7JF22_ACEP3          ---------------------MIVITGGAGFIGSCLQAALAA--RGLE-TIIVDWLGQE-
L0DJS1_SINAD          ---------------------MIVVTGAAGFIGSNLAHRLAA--LGHHLWLVDHPFSAVK
E8R4T7_ISOPI          -------------------MSVVAITGAAGFIGSNLAHRMARELPDATLLLIDHPLDNRK
F8L343_SIMNZ          ------------MVVQLYDDKLIVVTGAAGFIGSGVVRYLNE--QGYSNLLLVDDFGKT-
                                              :**. *::.  .                 . .    

HLDD_DECAR            -DKFKNLIDCDI--VDYLDKNDFIERIQAGHFD-G----EIDAILHEGACSDTMETDGRY
HLDD_THIDA            -DKFKNLTDCEI--ADYLDKTEFLSVVEEGVLD-G----SVAAIFHEGACSDTMETDGRY
HLDD_NEIMB            -EKFKNLAECEI--AHYLDKHEFIRQVREHILPYQ----NIEAVFHQGACSDTMNHDGLY
HLDD_NEIG1            -EKFKNLAECEI--AHYLDKHEFIRQVREHILPYQ----NIEAVFHQGACSDTMNHDGLY
HLDD_CHRVO            -DKFHNLVDCEI--SHYLDKHEFLHLLLDGEYE-G----ELSAILHQGACSDTMNHDGKY
HLDD_RALSO            -DKFRNLVDCEI--SDYLDKTEFVERFARGDFG------KVRAIFHEGACSDTMETDGRY
HLDD_CUPNH            -DKFHNLVDCEI--SDYLDKQDFLARFARGEFG------KVRAVFHEGACSDTMETDGRY
HLDD_CUPMC            -EKFNNLVDCEI--ADYLDKTDFVARFARGDFG------NVRAVFHEGACSDTMETDGRY
HLDD_PARXL            -DKFKNLVDCEI--DDYLDKTEFVERFRRGDFG------KVRAIFHEGACSDTMETDGRY
HLDD_BURPS            -DKFKNLVDCEI--DDYLDKTEFVERFARGDFG------KVRAVFHEGACSDTMETDGRY
HLDD_CUPPJ            -DKFHNLVDCEI--RDYLDKDDFLSRFERGEFG------RVRAVFHLGACTDTMEQDGRY
HLDD_PSEAE            -EQFRNLADADI--ADYLDQNDFLERYARGDFG------TVRALFHQGACASTLESNGRY
HLDD_POLSJ            -DKFRNLADLQI--ADYIDADDFYDLFAEGAFG------QVEAVFHEGACSDTMELDGKY
HLDD_POLNA            -DKFRNLADLRI--ADYMDAGDFYDRFAEGAFG------HVEAVFHEGACSDTMEPDGKY
HLDD_RHOFT            -DKFRNLAHLKI--SDYVDASVFYDLFANGAYG------QIEAVFHEGACSDTMESNGKY
HLDD_BORPE            -DKFRNLVDCSI--ADYLDKDEFRERVRGGNLP------ALRAVLHQGACSDTTERNGRY
HLDD_BORA1            -DKFRNLVDCRI--ADYMHHEDARALLKAGQFP------RVRAVLHQGACSDTTERNGQY
B7JC62_ACIF2          -DKFLNLTDLEI--ADYMEAEAFLRLIENKHLK------GVEAVFHEGACSDTMATDGRY
HLDD_MARHV            -TRFRNLAELDV--TDYMDKGEFLERVKANDLPMG-----IRAVFHEGACSDTTEWDGKF
HLDD_CHRSD            -TKFVNLADCTL--GDYLDKDDFLARVKAELRGEPSELPPIEAIFHEGACSDTTEWDGKF
HLDD_HYDCU            -KKFINIADCDI--ADYLDKEDFQSRIFAEEGLPD-----IDCVFHEGACSATTEWDGKY
HLDD_AZOSB            -RKCLNLADADI--RDYMDMDDFLARIQTGEDLGRVE-----AVFHEGACSSTTEWDGRF
HLDD_AROAE            -HKCLNLADADI--HDYMDKDDFLRRVEANEDFGPVE-----AIFHEGACSSTTEWDGRF
HLDD_ALKEH            -EKALNLADCVI--ADYYDKDDFITLIEADEGLGPVE-----AVFHLGACSATTEWDGRY
HLDD_SHELP            -TKMFNLADCEI--ADYLDKADFIEQIAQGQFDGKVE-----VIFHQGACSSTTEWDGKF
HLDD_SHEFN            -TQMFNLADCEI--ADYLDKDDFIKQIKAGDFDNKLE-----VIFHQGACSSTTEWDGKF
HLDD_RHILO            -HKIANLADLSI--ADYLDKDDFLTRIEAGA-LGRIE-----AVFHQGACSTTTEWNGKF
HLDD_PELCD            -TKFANIADARI--CDYLDKDEFLRRIASGDSFGDRI----EAIIHQGACSTTTEWDGRY
HLDD_SALAR            -TKFVNLVDLNI--ADYMDKEDFLIQIMSG-EELGD----IEAVFHEGACSSTTEWDGKY
HLDD_SALTY            -TKFVNLVDLNI--ADYMDKEDFLIQIMSG-EELGD----IEAIFHEGACSSTTEWDGKY
HLDD_ECOLI            -TKFVNLVDLNI--ADYMDKEDFLIQIMAG-EEFGD----VEAIFHEGACSSTTEWDGKY
HLDD_KLEP7            -TKFVNLVDLNI--ADYMDKEDFLIQIMAG-EEFGE----IEAIFHEGACSSTTEWDGKY
HLDD_CITK8            -TKFVNLVDLNI--ADYMDKEDFLIQIMAG-EEFGD----IEAVFHEGACSSTTEWDGKY
HLDD_ENT38            -TKFANLVDLNI--ADYMDKEDFLIQLMAG-EEFGE----IEAIFHEGACSSTTEWDGKY
HLDD_CROS8            -TKFVNLVDLNI--ADYMDKEDFQVQIMSG-EEFGE----VEAVFHEGACSSTTEWDGKY
HLDD_PHOLL            -TKFINLADLDI--ADYMDKEEFIASILAG-DDFGD----IDAIFHEGACSSTTEWDGKY
A0A1B8SW97_PRORE      -TKFANLVDLDI--ADYADKEDFIGSIIAG-DDFGD----VDAVFHEGACSSTTEWDGKY
HLDD_SODGM            -TKYANLVDLNI--SDYMDKEDFIASIVAG-DDFGD----IDAVFHEGACSSTTEWDGKY
HLDD_YERPE            -TKFVNLVDLDI--ADYMDKEDFVASIVAG-DDMGD----IDAIFHEGACSSTTEWDGKY
HLDD_SERP5            -TKFANLVDLDI--ADYIDKEDFIANIIAG-DDLGE----IDAIFHEGACSSTTEWDGKY
HLDD_PASMU            -TKFANLVDLDI--ADYCDKEDFIASIIAG-DDLGD----IEVIFHEGACSATTEWDGKY
HLDD_HAEIN            -TKFANLVDLDI--ADYCDKEDFIASIIAG-DEFGD----IDAVFHEGACSATTEWDGKY
HLDD_ACTSZ            -TKFINLVDLDI--ADYCDKEDFIAQIIAG-DDFGD----IDAVFHEGACSATTEWDGKY
HLDD_ACTP2            -EKFVNLVDLDI--ADYCDKEDFIASIIAG-DDFGE----IDAVFHEGACSATTEWDGKY
HLDD_VIBPA            -KKFKNLVDLDI--TDYMDRDDFLTQIMAG-DDFGP----IEAIFHEGACSATTEWDGKY
HLDD_VIBVY            -RKFKNLVDLDI--TDYMDRDDFLTQIMAG-DNFGP----IEAVFHEGACSATTEWDGKY
HLDD_VIBCH            -RKFKNLVDLQI--ADYMDRDDFLAQIMAG-DDFGF----IDAIFHEGACSATTEWDGKY
HLDD_PSYIN            -AKFVNLVDLQI--MDYMDKDEFITQIVSG-QDFGD----IEAIFHEGACSATTEWNGKF
HLDD_HAMD5            -AKFVNLVDLKI--ADYRDKDDFITSVRAK-EVLGN----IEAIFHLGACSSTMEWDGQF
Q7U354_BLOFL          -KKYKNLVGLHI--SDYIDKHCFIKRLLNNSNYLKN----IEVIFHEGACSNTYEWNGRY
D2RLQ8_ACIFV          -VKFKNIQGLKV--MDYLDKVDFIQRVRDGKFDHEP----IEVIFHEGACSDTMEYNGKY
Q1IJY8_KORVE          -AKFENLLGAKF--ADYMDKRAFRAAIRERSLGAPK----IEAILHQGACSNTLEDDGVY
HLDD_DESVH            -EKWKNLVNRRY--VDYVHRDTFMDMVLHG--DLPW---DVDAVVHMGACSATTERDADF
B8J2P7_DESDA          -DKWRNLVKRRY--VDYLHRDQFYDLMQRD--ALPW---KVSGVVHLGACSSTTEKDADF
F0JFV9_DESDE          -EKWNNLVGLKY--QDYLHRDQFLKFILEG--DDPF---ETEAVVHMGACSSTTELDADF
I3ZEM0_TERRK          -EKWKNLVGLQY--EDLLPIDEFLDRIHGVGVEELP---EIDGIVHLGACSATTEKDADY
C1ACL5_GEMAT          -EKWRNLVPLRF--EDYLEADDLFPRLES---GALG---DFDLILHLGACSATTELDATY
C6JQ57_FUSVA          -EKWLNLRKRDY--ADWVDRDDLFEWLSNP--ANAE---KITGVVHMGACSATTEKDGDY
HLDD_FUSNN            -DKWLNIRKREY--YDWIDKDNLKEWLVCK--ENAD---NIEAVIHMGACSATTETDADF
D2QPF1_SPILD          -DKEANLTGKRI--QERVDREDFFDWLD----QNYH---EVEFLFHIGARTDTTEFDRQI
A0A6N4SQL2_CYTH3      -EKKKNLENKKI--QEYVDRDDFFDWLD----KNNK---HVEFIFHIGARTDTTEFDKAI
E4TNZ9_MARTH          -EKNKNLEDLKI--QEKVERDVFFEWLDK---QDAK---KVEFIFHLGARTDTTEFDIAI
Q6MHK5_BDEBA          -ERN-LLRKQKI--TKFLLKDDLWPFLETE--EAKK---QVTWIIHMGACSSTTETNKEF
I3TID4_TISMK          -DKWRNIAKRAL--ADVVRPERIFDFLNARA----G---EIEAVVHMGAISSTEERDADV
A7ILV4_XANP2          -PKWRNISDIAL--HDVIRPETVNAFVEKEG----G---RLAAVVHMGAISATTERDADK
B6JBC5_OLICO          -GKWRNLAKRQI--SDVVPPGELMAWLRGR---------RLSGVIHMGAISATTATDGDL
Q89HR2_BRADU          -GKWRNLAKRQL--VDIAPPAELPDWLNGR---------RLDAVIHLGAISATTATDGDL
B4RAY4_PHEZH          LGKWRNIAKHPI--GDFVAPEDMFDWLEKRW----R---DVEMVVHMAAVSSTTEPDADK
C7JF22_ACEP3          -GKWRNVSQHAP--TRLIAPENLEAFLATT-----P---KIDTIFHMGAISETTATDGDL
L0DJS1_SINAD          TANWVGL-SRFCFTTEEIFLQALR-SRD-------L---PIEAVFHLGACSRTTETDWGY
E8R4T7_ISOPI          IAHWQGLPSRYVYISRDVLRDSLIHDRDFWP----Q---PLDVVFHLGACSSTTERNWSY
F8L343_SIMNZ          -EKWKNLRHKRF--IDFISRHELFEYLMGRE----T---EIEAFIHLGACSSTVEDDGDL
                        .   :                                    ..* .* : *   :   

HLDD_DECAR            MMENNYRYSMILLDWCLDQDVQFLYASSAATYGSS--GTFKEERQY------EGPLNVYG
HLDD_THIDA            MMDNNYRYSGALLKFCQDEGAQFLYASSASVYGSG--RVFSESREC------ESPLNVYG
HLDD_NEIMB            MMDNNYQYTLDLLDWCQDERIPFLYASSAAVYGKG--EIFREEREL------EKPLNVYG
HLDD_NEIG1            MMENNYQYTLDLLDWCQDERIPFLYASSAAVYGKG--EIFREEREL------EKPLNVYG
HLDD_CHRVO            MMDNNYQYTLALFDYCQHEEIQFLYASSAATYGKG--TVFKEERQH------EGPLNVYG
HLDD_RALSO            MMENNYRYTLALMKACLDQGVQFLYASSAATYGAS--DTFREDREF------EKPLNVYG
HLDD_CUPNH            MMENNYRYTLSLMESCLEQGTQFLYASSAATYGAS--QVFREDREF------ERPLNVYG
HLDD_CUPMC            MMENNYRYTLALLEACLEQGAQFLYASSAATYGAS--TMFREDRDY------EKPLNVYG
HLDD_PARXL            MMDNNFRYSREVLDVCLAQNIQFLYASSAATYGGS--SRFVEEREV------EQPLNVYG
HLDD_BURPS            MMDNNFRYSRAVLDACLAQGTQFLYASSAAIYGGS--SRFVEAREF------EAPLNVYG
HLDD_CUPPJ            LMENNYRYSKTLMELCLAQDTQFIYASSAAVYGES--HSFREAREY------ERPLSVYG
HLDD_PSEAE            MMENNYRYSCRLLESSLELGVPFLYASSAAVYGSG--RTFREARQY------ERPLNVYG
HLDD_POLSJ            MMDNNYTLSCELFHACQEQGTRLLYASSAATYGGS--DTFSESPEF------ERPLNVYG
HLDD_POLNA            MMANNYTLSCNLFRACQNQNTRLLYASSAATYGGS--DTFSESPEF------EKPLNVYG
HLDD_RHOFT            MMDNNYATSVNLFQACQKRGARLLYASSAATYGGS--DTFREDPAF------ERPLNVYG
HLDD_BORPE            MLDNNYRVTLELFEYCQAERVPFLYASSAAVYGGS--SVYVEDPAN------EHPLNVYG
HLDD_BORA1            MMDNNYRVTLEWFEYCQANRVPLIYASSAAVYGAS--TVYVEDPAN------EGPLNVYG
B7JC62_ACIF2          VMENNFTFSKVLLHWCQHHDVPFLYASSASVYGMT--GIFVEERYA------ESPLNVYG
HLDD_MARHV            MMENNYTYSKVLLHWCLDRKVPFLYASSAAVYGAS--DEFREEREC------ERPLNVYG
HLDD_CHRSD            MLENNFEYSKVLLHFCQYKRIPFLYASSAATYGGS--EVFVEAPEH------EKPLNVYG
HLDD_HYDCU            MMDNNYEYSKDLLNYCLNRKIPFLYASSAAVYGDG--PTFIEERQY------EKPLNVYG
HLDD_AZOSB            VMRVNYEYTKALLAWCTQRKIPLIYASSASVYGMG--PTFREAREF------EQPLNMYA
HLDD_AROAE            VMAVNYEYTKSLLGWAVARKVPLLYASSASVYGMG--PTFRESREF------EHPLNMYA
HLDD_ALKEH            MMRNNFEYSRALFHWCQDRRIPFIYASSAAVYGGN--SVFTEHPEH------ERPLNVYG
HLDD_SHELP            MMANNYEYSKTLLHFCERNGSQFIYASSASVYGGS--DKFIEQREL------EKPLNVYA
HLDD_SHEFN            MMANNFEYSKTLLHYSQANNCQFIYASSASVYGGS--EKFIEQREL------EKPLNVYA
HLDD_RHILO            MMEVNFAYSKRLLHACQAPRVPFLYASSASVYGGG--SEFREEPAL------ERPLNVYA
HLDD_PELCD            MMENNYAYSKTLLHYCLERRIPFLYASSAATYGGG--QVFCEEPQY------ERPLNVYG
HLDD_SALAR            MMDNNYQYSKELLHYCLEREIPFLYASSAATYGGRT-SDFIESREY------EKPLNVYG
HLDD_SALTY            MMDNNYQYSKELLHYCLEREIPFLYASSAATYGGRT-SDFIESREY------EKPLNVYG
HLDD_ECOLI            MMDNNYQYSKELLHYCLEREIPFLYASSAATYGGRT-SDFIESREY------EKPLNVYG
HLDD_KLEP7            MMDNNYQYSKELLHYCLEREIPFLYASSAATYGGRT-SDFIESREY------EQPLNVYG
HLDD_CITK8            MMDNNYQYSKELLHYCLERDIPFLYASSAATYGGRT-SDFIESREY------EKPLNVYG
HLDD_ENT38            MMDNNYQYSKEVLHYCLEHEIPFLYASSAATYGGRT-SDFIESREY------EQPLNVYG
HLDD_CROS8            MMDNNYQYSKELLHYCLEREIPFLYASSAATYGGRT-SDFIESREY------EKPLNVYG
HLDD_PHOLL            MMDNNYQYSKELLHYCLERRTPFLYASSAATYGGRT-DNFIEERQY------EKPLNVYG
A0A1B8SW97_PRORE      MMDNNYQYSKELLHYCLDREIPFLYASSAATYGGRS-DNFIEERQF------EKPLNVYG
HLDD_SODGM            MMDNNYQYSKELLHYCMERTIPFLYASSAATYGGRT-EHFIEDRQY------EQPLNVYG
HLDD_YERPE            MMDNNYQYSKDILHFCLDRSIPFLYASSAATYGGRT-DNFIEDRQY------EQPLNVYG
HLDD_SERP5            MMDNNYQYSKDLLHYCLDREIPFLYASSAATYGGR--EEFIEERQF------EAPLNVYG
HLDD_PASMU            IMHNNYEYSKELLHYCLDREIPFFYASSAATYGDKT-E-FREEREF------EAPLNVYG
HLDD_HAEIN            IMHNNYEYSKELLHYCLDREIPFFYASSAATYGDTK-V-FREEREF------EGPLNVYG
HLDD_ACTSZ            IMHNNYEYSKELLHYCLDREIPFFYASSAATYGDKT-E-FVEERQF------EGPLNVYG
HLDD_ACTP2            LMHNNYEYSKELLHFCLDHQIPFFYASSAATYGGRS-DNFIEERKF------EQPLNAYG
HLDD_VIBPA            MMLNNYEYSKELLHYCLDREIPFLYASSAATYGET--ETFVEEREY------EGALNVYG
HLDD_VIBVY            MMLNNYEYSKELLHYCLEREIPFLYASSAATYGET--TVFKEEREY------EGALNVYG
HLDD_VIBCH            VMLNNYEYSKELLHYCLDREIPFLYASSAATYGET--DTFIEEPQY------EGALNVYG
HLDD_PSYIN            MMENNYEYSKDLLHYCIERDIPFLYASSAATYGGN--DTFKEELKY------EKPLNVYG
HLDD_HAMD5            MMKNNYEYSKTLLHFCLKACIPFLYASSAAVYGGRT-DCFIEEPQY------EKPLNIYG
Q7U354_BLOFL          LMNNNYQYSKSLLNYSVENSIPFIYASSASVYGKNI-YSSNTFDNN------ENPLNIYG
D2RLQ8_ACIFV          MMENNFEYTKTLMHFALDRRIQFLYASSASTYGSGK-NGFREEPAC------EEALNVYA
Q1IJY8_KORVE          MMDNNYQCTKELLHFAIEQGARFVFASTAAVYGLAGPGHFAPIPGN------ERPLNIYG
HLDD_DESVH            LMENNLRYSRMLCELCMETGARFINASSAATYGDGS-LGFSDDD---TTMLRLKPLNMYG
B8J2P7_DESDA          LMENNFHYSRDLCRYTLDKGGRFINASSAATYGDGS-LGFSDDE---QLVPRLRPLNMYG
F0JFV9_DESDE          LMENNYRYTQYVCRFCLGHNARFVNASSAATYGNGE-FGFDDNE---AEIGRLRPLNMYG
I3ZEM0_TERRK          LLTNNYAYTRTLCQWAQAHGARFVYASSAATYGDGA-LGYDDSD---AVTPRLKPLNMYG
C1ACL5_GEMAT          LARNNFEFTKQLAHRALARGSRFVYASSAATYGDGA-HGMDDIDNSSAALSRLRPLNAYG
C6JQ57_FUSVA          LMSNNYGYSKKLWEFCAARQINYVYASSAATYGAGE-LGYNDDVTP-EELKKLMPLNKYG
HLDD_FUSNN            LMDNNFGYTKFLWNFCAEKNIKYIYASSAATYGMGE-LGYNDDVSP-EELQKLMPLNKYG
D2QPF1_SPILD          FEHLNVEYSKQIWNRCIQYQIPLVYASSAATYGLGE-LGYDDNESL---IPQLKPLNPYG
A0A6N4SQL2_CYTH3      FDRLNVAYSKNMWNACIKYQIPLVYASSAATYGNGE-FGYDDNEQK---IPQLKPLNPYG
E4TNZ9_MARTH          LTKLNTDYTKKMWKKCIDMQIPLIYASSAATYGLGE-LGYDDDESK---IPDLKPLNPYG
Q6MHK5_BDEBA          LWENNTYYTQRIFEWCAEHGKSMIYASSAATYGAGE-LGFDDTTD----PEKLRPLNLYG
I3TID4_TISMK          IVANNIRLTLDLVDWCARHGVRLIYASSAATYGDGA-LGFDDDGEAGA-LAGLQPLNAYG
A7ILV4_XANP2          IVARNIRSTLDLWELCARKALGLVFASSAATYGDGT-SGFVDSEEAAD-LGALAPLNPYG
B6JBC5_OLICO          VFETNYRLSMRLLDWCTVNPTPFIYASSAATYGDGT-QGFRDDNSLEA-LKALRPMNLYG
Q89HR2_BRADU          VFETNFRLSMRLLDWCTANAVPLIYASSAATYGDGE-AGFDDDASLPA-LKKLRPMNLYG
B4RAY4_PHEZH          IVHSNFTLSRDLFRWCADRQRRFVYASSAATYGAGE-HGFSDDNDYEA-LARLRPLNTYG
C7JF22_ACEP3          VWRTNVELSQTLWDWCTRNRARFIYASSAATYGAAD-RPELFNDDPGN-LSQLRPLNLYG
L0DJS1_SINAD          LLRNNVEFSQMLWTWCSEAGKPFYYASSAATYGDGS-NGFDDRLPP----SELRPLNLYG
E8R4T7_ISOPI          LADNNLGDTQRLWTYCARRGIPFYYASSAATYGDGS-QGFSDRTHP----RDLKPLNLYG
F8L343_SIMNZ          FMETNYRYSVHLAEYALENDHRFIYASSAATYGDGS-LGFSDDENK---LDELRPLNIYG
                      .   *   :                **:*: **                     .:. *.

HLDD_DECAR            YSKFLFDQIVRQ----RLAQNPSS-----QIVGFRYFNVYGPRETHKGRMASVAFHNFNQ
HLDD_THIDA            YSKFLFDQSVRR----LWAER-TA-----QIAGFRYFNVYGPREQHKGRMASVAFHFFNQ
HLDD_NEIMB            YSKFLFDQVLRR----RMKEGLTA-----QVVGFRYFNVYGQHEQHKGRMASVAFHHFHQ
HLDD_NEIG1            YSKFLFDQVLRR----RMKEGLTA-----QVVGFRYFNVYGQHEQHKGRMASVAFHHFHQ
HLDD_CHRVO            YSKFLFDQVLRQ----RIKEGLSA-----QAVGFRYFNVYGPREQHKGRMASVAFHHFNQ
HLDD_RALSO            YSKFLFDQIVRR----TLPGALS------QIVGFRYFNVYGPREQHKGRMASVAFHNFNQ
HLDD_CUPNH            YSKFLFDQIVRR----RLPSALS------QIVGFRYFNVYGPRETHKGRMASVAFHNFNQ
HLDD_CUPMC            YSKFLFDQVVRR----RLPSAHS------QIVGFRYFNVYGPREFHKGRMASVAFHHFNQ
HLDD_PARXL            YSKFLFDQVIRR----VLPTAKS------QIAGFRYFNVYGPRETHKARMASVAFHNFNQ
HLDD_BURPS            YSKFLFDQVIRR----VMPSAKS------QIAGFRYFNVYGPRESHKGRMASVAFHNFNQ
HLDD_CUPPJ            YSKFLFDQAVRN----RLDGALS------QVVGLRYFNVYGPGEAHKARMASIVCQQFEQ
HLDD_PSEAE            YSKFLFDQRVRR----ALPQARS------QVVGLRYFNVYGPREEHKGRMASVAYHCYQQ
HLDD_POLSJ            YSKLLFDQRMRRELGARFENAAT------QVAGFRYFNVYGPREQHKGRMASVAFHQFNQ
HLDD_POLNA            YSKLLFDQHMRRELGMRFENAQT------QVAGFRYFNVYGPREQHKGRMASVAFHQFNQ
HLDD_RHOFT            YSKLLFDQRMRRECGNDFRRSVAGKT--GQVVGFRYFNVYGPHEQHKGRMASVAFHQFHQ
HLDD_BORPE            YSKLLFDQVLR----TRMDSLTA------QVVGLRYFNVYGPHEQHKGRMASVAFHNMNQ
HLDD_BORA1            YSKLLFDQVLR----TRMDKLTA------QVVGLRYFNVYGPHEQHKGRMASVAFHNMNQ
B7JC62_ACIF2          FSKFQFDQYLRQ----IWTDLRA------PVHGFRYFNVYGPREFHKNRMASVALHFYNQ
HLDD_MARHV            YSKWQFDQYVRKI----LPSARS------QIVGFRYFNVYGPREQHKGKMASVAYHLHEQ
HLDD_CHRSD            YSKLLFDQYVRVH----WESFDA------QVVGFRYFNVYGPREQHKGKMASVAYHHHSQ
HLDD_HYDCU            YSKFQFDQYVRRI----LPLAES------QVAGFRYFNVYGPREQHKGDMASVAFKLHNQ
HLDD_AZOSB            YSKFLFDCHLRA-----QQGIES------QVVGLRYFNVYGPREQHKGSMASVAYHFNNQ
HLDD_AROAE            YSKFLFDCHLRRF----APGIDS------QVVGLRYFNVYGPREQHKGSMASVAYHFHNQ
HLDD_ALKEH            YSKLAFDQYLRRY----LDDLSA------QVVGLRYFNVYGPREQHKGGMASVVHHFSRQ
HLDD_SHELP            YSKFLFDQYVRQ------HNFTT------QVAGLRYFNVYGPREQHKGGMASVAFHFNNQ
HLDD_SHEFN            YSKFLFDQYVRQ------QKLTG------QVAGLRYFNVYGPREQHKGGMASVAFHFNNQ
HLDD_RHILO            YSKKLFDDYVRRTV---FDTDHS------QVAGLRYFNVYGPREAHKGAMASVAFHLFNQ
HLDD_PELCD            YSKALFDQYVRRV----LPTADS------QVAGFRYFNVYGPREQHKGSMASVAFHLRNQ
HLDD_SALAR            YSKFLFDEYVRQI----LPEAN------SQIVGFRYFNVYGPREGHKGSMASVAFHLNTQ
HLDD_SALTY            YSKFLFDEYVRQI----LPEAN------SQIVGFRYFNVYGPREGHKGSMASVAFHLNTQ
HLDD_ECOLI            YSKFLFDEYVRQI----LPEAN------SQIVGFRYFNVYGPREGHKGSMASVAFHLNTQ
HLDD_KLEP7            YSKFLFDEYVRQI----LPEAN------SQIVGFRYFNVYGPREGHKGSMASVAFHLNTQ
HLDD_CITK8            YSKFLFDEYVRQI----LPEAS------SQIVGFRYFNVYGPREGHKGSMASVAFHLNTQ
HLDD_ENT38            YSKFLFDEYVRQI----LPEAN------SQIVGFRYFNVYGPREGHKGSMASVAFHLNTQ
HLDD_CROS8            YSKFLFDEYVRQI----LPEAN------SQITGFRYFNVYGPREGHKGSMASVAFHLNTQ
HLDD_PHOLL            YSKFLFDQYVREI----LPQAD------SQICGFRYFNVYGPREGHKGSMASVAFHLNNQ
A0A1B8SW97_PRORE      YSKFQFDQYVREI----LPEAN------SQICGFRYFNVYGPNEDHKGSMASVAYHLNKQ
HLDD_SODGM            YSKFLFDQYVRAL----LPQAE------SQICGFRYFNVYGPREGHKGGMASVAFHLNNQ
HLDD_YERPE            YSKFLFDQYVREI----LPQAD------SQICGFRYFNVYGPREGHKGSMASVAFHLNNQ
HLDD_SERP5            YSKFLFDQYVREI----LPEAE------SQICGFRYFNVYGPREGHKGSMASVAFHLNGQ
HLDD_PASMU            YSKFLFDQYVRAI----LPEAN------SPVCGFRYFNVYGPRENHKGAMASVAFHLNNQ
HLDD_HAEIN            YSKFLFDQYVRNI----LPEAK------SPVCGFRYFNVYGPRENHKGSMASVAFHLNNQ
HLDD_ACTSZ            YSKFLFDQYVREI----LPNAS------SPVCGFKYFNVYGPREQHKGSMSSVAFHLNNQ
HLDD_ACTP2            YSKFLFDEYVRQV----LPEAD------SPVCGFKYFNVYGPREQHKGSMASVAFHLNNQ
HLDD_VIBPA            YSKQQFDNYVRRL----WKDAEEHGEQLSQITGFRYFNVYGPREDHKGSMASVAFHLNNQ
HLDD_VIBVY            YSKQQFDNYVRRL----WQDAEEHGETLSQITGFRYFNVYGPREQHKGSMASVAFHLNNQ
HLDD_VIBCH            YSKQQFDNYVRRL----WLDAKQHDETLSQITGFRYFNVYGPREQHKGSMASVAFHLNNQ
HLDD_PSYIN            YSKFQFDQYVRRI----WEDAAAHDETLPQIVGFRYFNVYGPREQHKGSMASVAFHLNNQ
HLDD_HAMD5            YSKFLFDQYVRKI----WPKAR------APICGFRYFNVYGPRETHKGSMASVVFHLDKQ
Q7U354_BLOFL          YSKFLFDQYVRSV----LTKVS------SQVCGLRYFNVYGPYENHKGAMASIIFNIYQK
D2RLQ8_ACIFV          FSKLFFDNYARRY----FDKAES------QIAGFRYFNVFGPQENHKGKMASMVRQMFLQ
Q1IJY8_KORVE          YSKLMFDNYLRHKI--AADEVSI------TAVGLRYFNVYGPRERHKGRMSSVIHHFTGQ
HLDD_DESVH            YSKQLFDLWAYRE-------GRL-----DGIASLKFFNVYGPNEYHKGDMRSVICKAYAQ
B8J2P7_DESDA          YSKQLFDLWLLRE-------GLQ-----AETASLKFFNVYGPNEYHKGDMQSVAAKAHRQ
F0JFV9_DESDE          YSKQLFDLWSRDA-------GIL-----DQIVSLKFFNVFGPNEYHKDDMKSVICKAHAQ
I3ZEM0_TERRK          YSKHMFDLWALRN-------NLYSGA--NPIAGLKYFNVYGPHEDHKDDMRSVVHKSFGQ
C1ACL5_GEMAT          YSKHLFDQYAAQA-------GLL-----HRIVGLKYFNVYGPNEAHKGDMRSLVHKAFGQ
C6JQ57_FUSVA          YSKKIFDDWAFKQ-------KITP----KQWAGTKFFNVYGPQEYHKGRMASMVFHTFNQ
HLDD_FUSNN            YSKKFFDDWAFKQ-------KNQP----KQWNGLKFFNVYGPQEYHKGRMASMVFHTYNQ
D2QPF1_SPILD          DSKNEFDIWALEQ-------ERKP----FFWAGLKFFNVYGPNEYHKGRMASVIFHTFKQ
A0A6N4SQL2_CYTH3      DSKNDFDIWALQQ-------EKQP----FFWAGLKFFNVYGPNEYHKSRMASVIFHAFHQ
E4TNZ9_MARTH          ISKNEFDKWALQQ-------EKRP----FYWAGLKFFNVYGPREYHKGRMASVILHAYRQ
Q6MHK5_BDEBA          ESKVLFDRWAVKQ-------TKTP----PHWYGLKFFNVFGPNEYHKGAMSSVAFKAYNQ
I3TID4_TISMK          WSKHMVDRRITAL-------RARGAALPPQWAGLKFFNVYGPNEYHKGGQRSVAHQVFCR
A7ILV4_XANP2          WSKLFVDRRIMAD-------VAEGRPRPPQFAGLRFFNVYGPGEGHKGDMRSVVHKIYPA
B6JBC5_OLICO          WSKYLFDVAVATR-------VAKNETLPPQWAGLKFFNVFGPNEYHKGSMMSVLTRRFDD
Q89HR2_BRADU          WSKHMFDLAVAER-------VARGEKLPPQWAGLKFFNVFGPNEYHKGSMMSVLARRFDD
B4RAY4_PHEZH          WSKALFDLFAVRQ-------AGRDYA-PPQWVGLKFFNVYGPNEEHKHSMKSVAAQIWPQ
C7JF22_ACEP3          WSKHVFDQHVTTT-------LDQHTPRPPQWAGLKFFNVYGPNEYHKGKMISVVKVKYDE
L0DJS1_SINAD          KSKNTFDLWVWRW-------VAEGLPTPPGWAGLKFFNVYGPREDHKGSMASVVWQTCRQ
E8R4T7_ISOPI          KSKNDFDLWALDQ-------IDRGAAHPPAWAGLKFFNVFGPREGHKGPMMSMVWKARRQ
F8L343_SIMNZ          FSKQMFDKWLQEQ-------GVLD-----KVVGLKYFNIYGPNEYEKGRMASMVMHMTRQ
                       **  .*                         . ::**::*  * .*    *:       

HLDD_DECAR            FRA-DGKVKLFEGSHGY--PDGDQQRDFVFVGDVAKVNLFFLDHP-----------EKSG
HLDD_THIDA            YRA-EGRVKLFEGCDGY--PNGEQRRDFVSVEDVVRVNMWFLDHP-----------EVSG
HLDD_NEIMB            YRE-HGYVNLFGSNDGY--GNGEQTRDFVSVEDVAKVNLYFFDHP-----------ELSG
HLDD_NEIG1            YRE-HGYVNLFGSNDGY--GNGEQTRDFVSVEDVAKINLYFFDHP-----------ELSG
HLDD_CHRVO            YRE-HGKVKLFGGWDGW--ENGMQSRDFVSVEDVVKVNLFFLDNP-----------GKSG
HLDD_RALSO            FRT-EGTVKLFGEYNGY--PQGGQMRDFVSVEDVVKVNLFFFDHP-----------DKSG
HLDD_CUPNH            FRA-DGTVKLFGEYGGY--APGMQSRDFISVEDVVKVNLHFFDHP-----------DKSG
HLDD_CUPMC            FRA-EGTVKLFGEYNGY--APGTQSRDFVSVEDVVKVNLYFLDHP-----------EKSG
HLDD_PARXL            FRA-EGKVKLFGEYNGY--AAGEQTRDFVSVEDVVKVNLFFFDNP-----------DKSG
HLDD_BURPS            FRA-EGKVKLFGEYNGY--GPGEQTRDFVSVEDVAKVNLHFFDHP-----------QKSG
HLDD_CUPPJ            FRA-EGTVKLFGEHGGH--GPGCQSHDFVSIDDVVKVNLFFLDHP-----------RRSG
HLDD_PSEAE            LRR-DGRVELFGEHGGF--PPGGHLRDFVAVEDVARVNLHFFDHP-----------QRSG
HLDD_POLSJ            FQA-EGKVKLFGDYGGY--QAGGQMRDFVFIDDVVAVNLWFLDHP-----------EKSG
HLDD_POLNA            FQA-DGKVKLFGDYGGY--GPGGQMRDFVFIDDVVAVNLWFFDHP-----------EKSG
HLDD_RHOFT            FQA-EGKVKLFADYGGY--AAGAQMRDFIFIDDVVAVNLWFFDHP-----------GVSG
HLDD_BORPE            FLA-EGHVRLFAGWDGY--EDGGQSRDFISVEDVVAVNLHFLDNP-----------DQSG
HLDD_BORA1            FLA-EGHVRLFSGWDGY--ADGGQSRDFISVEDVVDVNLHFLDHP-----------GTSG
B7JC62_ACIF2          YRL-DNHVRLFAGSGSY--ADGEQRRDFIYIDDVVSVNMHFLDHP-----------H-SG
HLDD_MARHV            IKA-GQNPKLFEGWDGY--SDGGQQRDFVYVDDVCKVNLWFYDNP-----------EQSG
HLDD_CHRSD            VKR-GENPKLFGAWDGY--EAGMQSRDFVYVGDVVDVNLWCLDHP-----------EVSG
HLDD_HYDCU            VLA-GEKLKLFGAYDGY--EAGMQTRDFVFIEDVVNVNLWFMENP-----------EQSG
HLDD_AZOSB            LNE-SGRVRLFEGSDGY--GPGEQRRDFIHVDDVVAVNLWLFDNP-----------QVSG
HLDD_AROAE            LND-SGRLRLFEGADGY--GPGEQQRDFIHVDDVVAVNLWLLDNP-----------GVRG
HLDD_ALKEH            LRE-SGQVRLFEGSDGY--ADGEQRRDFVDVSDCVRLKLWLLDHP-----------EVSG
HLDD_SHELP            IKA-SGICRLFQGHDGF--EDGKQLRDFVYVEDVVKVNLWLWQNP-----------GISG
HLDD_SHEFN            INT-NGVCRLFEGVDGY--ENGQQLRDFVFVEDVVKVNLWLWQNP-----------SVSG
HLDD_RHILO            VER-GENPRLFGAYDGF--GPGEQSRDFIHVGDVADVNLWLWKR------------GSSG
HLDD_PELCD            LLK-DGSVNLFEGCDGY--GDGEQRRDFIYVGDVVDVNLWFLDHP-----------EVSG
HLDD_SALAR            LNN-GESPKLFEGSE-------NFKRDFVYVGDVADVNLWFLES------------GKSG
HLDD_SALTY            LNN-GESPKLFEGSE-------NFKRDFVYVGDVAAVNLWFLES------------GKSG
HLDD_ECOLI            LNN-GESPKLFEGSE-------NFKRDFVYVGDVADVNLWFLEN------------GVSG
HLDD_KLEP7            LNN-GESPKLFEGSD-------GFKRDFVYVGDVADVNLWFWEN------------GVSG
HLDD_CITK8            LNN-GETPKLFEGSE-------NFKRDFVYVGDVADVNLWFWEN------------GVSG
HLDD_ENT38            LNN-GETPKLFEGSD-------GFKRDFVYVGDVAAVNLWFWEN------------GVSG
HLDD_CROS8            LNN-GESPKLFEGSE-------NFKRDFIYVGDVAAVNLWFWQN------------GVSG
HLDD_PHOLL            INQ-RQNPKLFAGSE-------GFQRDFIYVGDAAAVNLWFWKN------------GVSG
A0A1B8SW97_PRORE      INE-GQSPKLFEGSD-------TFRRDFIYVGDVAAVNLWFWEN------------NVSG
HLDD_SODGM            INA-GENPKLFAGSE-------GFKRDFIYVGDVAAVNLWFWQN------------NVSG
HLDD_YERPE            INA-GERPKLFAGSE-------NFKRDFIYVGDVADVNLWFWQN------------GVSG
HLDD_SERP5            INR-GENPKLFDGSQ-------DFKRDFIYVGDVAAVNLWFLKS------------GVSG
HLDD_PASMU            ILK-GEKPKLFAGSE-------HFRRDFVYVGDVAAVNIWCWQN------------NISG
HLDD_HAEIN            ILK-GENPKLFAGSE-------HFRRDFVYVGDVAAVNIWCWQN------------GISG
HLDD_ACTSZ            ILK-GENPKLFAGSE-------HFLRDFVYVGDVAAVNIWAWQN------------KISG
HLDD_ACTP2            MLK-GENPKLFEGSE-------TFLRDFVYVEDVAKVNIWAWQN------------GISG
HLDD_VIBPA            INA-GENPKLFEGSG-------HFKRDFVYVGDVCKVNLWFLEN------------GVSG
HLDD_VIBVY            ILA-GENPKLFAGSE-------QFKRDFIYVGDVCKVNLWFMQN------------GVSG
HLDD_VIBCH            MNA-GENPKLFAGSE-------NFKRDFVYVGDVAAVNLWFLDH------------GVSG
HLDD_PSYIN            LNA-GENAKLFEG---------EHKRDFVYIGDVCKVNLWFFDN------------NVSG
HLDD_HAMD5            IKA-GKPPQLFLGSE-------QFKRDFIFVDDVAQINLWCWQN------------QISG
Q7U354_BLOFL          IIH-RKIPVLFIGSR-------DFKRDFIYIDDVVNINIWMWVN------------KISG
D2RLQ8_ACIFV          WQG-EHKVKLFGEYDGY--GPGEQTRDFIYVKDVVKVLFYFWQHP-----------ELKG
Q1IJY8_KORVE          MKK-EQKLRMFQGSGGY--GDGEQRRDFVYVRDLARMNLFFAQLGRFEAAKGEPERTYRG
HLDD_DESVH            IGQ-EGVMRLFRSCHPD-YADGGQMRDFIYVKDCVEVMWWLLQNP-----------GVNG
B8J2P7_DESDA          IGQ-EGLLRLFRSDRPD-VADGEQKRDFVYVKDCTALMAWLLERN-----------DVCG
F0JFV9_DESDE          ILE-TGKLKLFKSYREE-YPHGGQKRDFVYIKDCVDIMAWFLEHR-----------DKGG
I3ZEM0_TERRK          VGTGEGKVKLFKSHRSD-YKDGEQMRDFVYVRDAVAVTLWLLENP-----------GIGG
C1ACL5_GEMAT          IRD-TGRVRLFRSHRVD-YKDGEQQRDFLYVKDAVAMTLHLAMSP-----------AAGG
C6JQ57_FUSVA          YKE-NGGVKLFKSHKEG-YKDGEQLRDFVYLKDVVDVLYFLLTEK-----------IESG
HLDD_FUSNN            YKE-NGYVKLFKSYKEG-FKDGEQLRDFVYVKDVVDIMYFMLVND-----------VKSG
D2QPF1_SPILD          IEA-SGSMKLFRSHNPD-YADGEQMRDFVYVKDVVEVCSFLMHHR-----------RNSG
A0A6N4SQL2_CYTH3      IKN-SGKMKLFRSHKAE-YTDGGQMRDFVYVKDVCNVIIFLMNHR-----------KNSG
E4TNZ9_MARTH          ISE-TGKMKLFRSHNPE-FKDGEQMRDFVFVDDVVKVMIWLMHHR-----------KNSG
Q6MHK5_BDEBA          IKD-TGALGLFKSADPN-YKDGEFMRDFVYVKDVTGWMAELMEKK-----------PTNG
I3TID4_TISMK          IRD-GGHARLFRSHRPD-YPHGGQLRDFVWVGDCVAVVEWLLETP-----------EASG
A7ILV4_XANP2          AAA-GEDVTLFKSHDPR-YEDGGQLRDFVHVGDCVEVVRWLLESP-----------DVSG
B6JBC5_OLICO          IKH-GKTIQLFKSHREG-IADGDQRRDFIYVDDVLRVVMWLVDNP-----------RVSG
Q89HR2_BRADU          VKA-GRVVQLFKSHREG-IADGDQRRDFIYVDDVVRVIMWLLATP-----------SVSG
B4RAY4_PHEZH          VRE-GHAVQLFKSYRPD-VPDGGQKRDFVYVRDAADVTRWLLDSP-----------QVSG
C7JF22_ACEP3          VKS-GQPARLFRSDRPD-IADGMQARDFIWVGDVVNVMLWLYDNP-----------EVSD
L0DJS1_SINAD          ILA-TGEMHLFKSNDPR-YPDGGQRRDFVFVEDCIDHLLWLWENP-----------GVCG
E8R4T7_ISOPI          IEE-TGIVRLFRSNTPS-QPDGGQTRDFVYVEDCLDHLLWLWRHP-----------EVHG
F8L343_SIMNZ          IQE-TGKVRLFQSSEPEKFKDGDQCRDFYYVKDAAKMTCFFLDH------------DLSG
                               :*              :**  : *                          .

HLDD_DECAR            IFNLGSGRAQSFNDVAVAAVNGCRKARSESALSLEELRAQGLLEYVAFPEALKGKYQAFT
HLDD_THIDA            IFNVGTGRCQSFNDVAVATVNACRAAEGQDALTLDEMQAQGLIGYVAFPEALKGKYQSYT
HLDD_NEIMB            IYNLGTGRSQQFNELAAATVNACRAAEGKPEMSLKELVEEELIRYIPFPDALKGKYQSFT
HLDD_NEIG1            IYNLGTGRSQQFNELAAAAVNACRAAEGKSELSLKELVEEELIRYIPFPDALKGKYQGFT
HLDD_CHRVO            IYNLGSGRSQPFNDVAEATVNACRRHEGKPALTLAEMIQQGIVEYIDFPDALKGKYQSFT
HLDD_RALSO            IFNLGTGRAQPFNDIATTVVNTLREAEGKPALSTEELAQEGLVEYVKFPDALRGKYQCFT
HLDD_CUPNH            IFNLGTGRAQPFNDIAATVVNTLREAEGKPRLSLDELVQEGLLEYVKFPDALRGKYQCFT
HLDD_CUPMC            IFNLGTGRSQPFNDIAVSVVNALRESEGKPALSLDEMVQEGLVEYVKFPDALRGKYQCFT
HLDD_PARXL            IFNLGSGRAQPFNDIASTVVNTLRSLNNEPALSLAEQVQRGLIEYISFPDALRGKYQCFT
HLDD_BURPS            IFNLGTGRAQPFNDIATTVVNTLRALEGQPALTLAEQVEQGLVEYVPFPDALRGKYQCFT
HLDD_CUPPJ            IFNVGSGHARSFNDVACVVVNTLRAAEDKPPLALEELVQEGLLEYLRFPDALRGRYQSFT
HLDD_PSEAE            IFNLGSGQARTFNEVALAVINSVRANADQPPLSLQQAVESGLLGYREFPESLRARYQSHT
HLDD_POLSJ            IFNLGTGRAQPFNDVALAVVNTLRQSQNAAAMSLEDAVRGGLIDYITFPPALVGKYQSYT
HLDD_POLNA            IFNLGTGRAQPFNDVAIAVVNTLRQSQNAAPLSLEDAVRGGMIDYVGFPEALVGKYQSYT
HLDD_RHOFT            IFNLGTGRAQPFNDVASSVVNALRGLSGQTALGLEALTEAGLIEYIPFPDALRGKYQSYT
HLDD_BORPE            VFNCGTGRAQPFNDVAAAVVNTLRAERGEAALPLAELVKKGLLRYIPFPDDLKGRYQSYT
HLDD_BORA1            IFNCGTGRAQPFNDVAAAVVNTLRAEQGEAPLSLDELVSQGLIRYIPFPDDLKGRYQSFT
B7JC62_ACIF2          IYNVGTGQAQSFNEMAVAVINSLEHRANRPTLTLPALQKTQAIRYVNMPEALNGKYQSFT
HLDD_MARHV            IFNLGTGRAQSFLDVAQAVIRYHG---------------KGSVEFIPFPDELKGRYQSFT
HLDD_CHRSD            IFNLGTGRAEPFKAIAETVIDYYA---------------TGKIDYIDFPEELKGRYQSYT
HLDD_HYDCU            IFNLGPAAAEPFKHIADAVIDFHG---------------QGEIEYIPFPDRLKGAYQSFT
HLDD_AZOSB            IYNLGTGRAQSFNDVARAAIKWFRA------QGEDGGRERGGIDYIPFPDHLKGRYQSFT
HLDD_AROAE            IFNVGTGRAQSFNEVAHAALSWHK-----------GSTAGGGIDYIAFPEHLRGRYQSYT
HLDD_ALKEH            IYNCGTGRARTFNAMAHAVIDWFG---------------HGEIEYIPFPEHLKGRYQSYT
HLDD_SHELP            VYNCGTGQAQSFNDVANAVIAYHG---------------KGEIEYIPFPDKLKGAYQSYT
HLDD_SHEFN            IYNCGTGQAQSFNDVANAVIAYHG---------------KGHIEYIPFPDKLKGAYQSYT
HLDD_RHILO            IFNCGTGRAQPFRAIAETVIDTLG---------------KGEIEFIPFPDHLKGSYQSFT
HLDD_PELCD            IYNVGTGRSQTFNDVAHAVLKAHE---------------GGELQYVPFPEHLKGRYQSFT
HLDD_SALAR            IFNLGTGRAESFQAVADATLAYHKKG---------------SIEYIPFPDKLKGRYQAFT
HLDD_SALTY            IFNLGTGRAESFQAVADATLAYHKKG---------------SIEYIPFPDKLKGRYQAFT
HLDD_ECOLI            IFNLGTGRAESFQAVADATLAYHKKG---------------QIEYIPFPDKLKGRYQAFT
HLDD_KLEP7            IFNLGTGRAESFQAVADATLAYHKKG---------------SIEYIPFPDKLKGRYQAFT
HLDD_CITK8            IFNLGTGRAESFQAVADAALAYHKKS---------------DLEYIPFPEKLKGRYQAFT
HLDD_ENT38            IFNLGTGRAESFQAVADAALAFHKKD---------------SLEYIPFPEKLKGRYQAFT
HLDD_CROS8            IFNCGTGRAESFQAVADAALAFHKKG---------------SIEYIPFPEKLKGRYQAFT
HLDD_PHOLL            IYNCGTGRAESFQAVADAVVECHKDKSL-------------TVEHIDFPEHLKGRYQRFT
A0A1B8SW97_PRORE      IFNCGTGRAESFQAVADAVTEFHKDKNV-------------AIEYIEFPEKLKGRYQSFT
HLDD_SODGM            IFNCGTGRAESFQAVSDAVLDYHKKG---------------QLEYIPFPEKLKGRYQAYT
HLDD_YERPE            IFNCGTGRAESFQAVADAVVDYHQSG---------------PVEYIEFPEKLKGRYQAYT
HLDD_SERP5            IFNCGTGRAETFQAVADAVVDFHQKG---------------AVENIPFPEKLKGRYQAFT
HLDD_PASMU            IYNLGTGNAESFLEVAKAVVKFHGKTEA-------------DIEIIPFPEHLKSRYQEYT
HLDD_HAEIN            IYNLGTGNAESFRAVADAVVKFHGKGE---------------IETIPFPEHLKSRYQEYT
HLDD_ACTSZ            IFNCGTGHAESFKAVAEAVIKHHGKGA---------------IETIPFPDHLKSRYQEYT
HLDD_ACTP2            IYNLGTGKAESFQAVAQAVIDFHGKGE---------------IEKIPFPDHLKSRYQTFT
HLDD_VIBPA            IFNCGTGRAESFEEVAKAVVKHHNKG---------------EIQTIPFPDHLKGAYQEFT
HLDD_VIBVY            IFNCGTGNAESFEEVAKAVIKHHGKG---------------EIETIPFPEHLKGAYQEFT
HLDD_VIBCH            IFNCGTGKAESFNEVAKAVIAFHGRG---------------EVETIPFPDHLKGAYQEFT
HLDD_PSYIN            IYNLGTGQAESFLEVGQAVVAYHQKG---------------EVERIPFPEHLKGRYQSFT
HLDD_HAMD5            IFNCGTGHAASFQTLADTVVAYHNSK---------------PVQYVDFPENLKGCYQTFT
Q7U354_BLOFL          IFDCGTGVSESFTLLADIVLKFLNYD---------------SIQYVPMPYKIRQHYQTFT
D2RLQ8_ACIFV          VYNLGTGHAHTFNDMARAVLEFFGSG---------------ELVYVPFPEVLKGKYQSYT
Q1IJY8_KORVE          IVNAGTGLSRSFNDVAAALMTIHGKV---------------PVEYMPFPSDLIGRYQHFT
HLDD_DESVH            VFNVGTGKARTWNDLVTAVFRAMD--------------REPVIEYIDMPEQLRGKYQSFT
B8J2P7_DESDA          IHNVGTGTARSFNDLAQAVFAALN--------------RPCHIEYVDMPDSLRGRYQHYT
F0JFV9_DESDE          IFNVGTGTARTWNDLANAVFAAMN--------------REPEIEYIPMPEVIRDKYQYFT
I3ZEM0_TERRK          LFNCGTGISRTWRDLVTAVYAAMG--------------KEPKIEYIDMPEGLRDKYQYYT
C1ACL5_GEMAT          LYNIGSGQAHSWLELTGALFAALG--------------REPEIEFIDIPESIRAKYQYHT
C6JQ57_FUSVA          VYNIGTGEARSFLDLSMATMRAASNNPKLA--------QEDVIEFIPMPEDLRGRYQYFT
HLDD_FUSNN            IYNIGTGKARSFMDLSMATMRAASHNDNLD--------KNEVVKLIEMPEDLQGRYQYFT
D2QPF1_SPILD          IYNLGSGKARTFLDLAKNTFHALD--------------LEPNISFVDTPADIRDKYQYFT
A0A6N4SQL2_CYTH3      IYNLGSGTARTFLDLAKNTFKNME--------------VTENISFIDTPIDIRDKYQYFT
E4TNZ9_MARTH          IYNLGSGKARTFLDLVKAVFKSMK--------------KEEDISFIDTPADIRDKYQYFT
Q6MHK5_BDEBA          VYNMGFGKPRTWLDLAGGVFKAMG--------------KDMKINWLEMPENIRGQYQYFT
I3TID4_TISMK          LFNVGSGKARSFADLARAVYAAMN--------------LKPEIEFVDMPEHLREKYQYFT
A7ILV4_XANP2          IFNVGTGEARSFADLARAVFSALG--------------EEPRIAYVDMPESLQKAYQYFT
B6JBC5_OLICO          IFNVGTGKARSFRDLIVAVYAALG--------------AKEKIAYIDMPEEIRGSYQYFT
Q89HR2_BRADU          LFNVGTGKARSFKDLMLAAYAALG--------------ARPNIEYIDMPEQIRNSYQYFT
B4RAY4_PHEZH          VFNLGSGQARTFEEMARNVFEAAG--------------KNAQIEYTPMPPAIRDKYQYFT
C7JF22_ACEP3          LFNCGTGTARTYLDMVHAVCDALG--------------CERRVEFIDMPQSLHGQYQSYT
L0DJS1_SINAD          LFNSGTGVARTFEDLARAVFGALG--------------REPRIGYIDMPAELCKQYQNFT
E8R4T7_ISOPI          LFNSGTGQPRTFLDLVHGVFSALE--------------RPPRIEFIPMPSELVGQYQNFT
F8L343_SIMNZ          IFNAGSGEANTWNKMAEIIFKAIG--------------KKTNIEYIPMPKDLIGKYQNYT
                      : : * .    :  :                           :     *  :   ** .*

HLDD_DECAR            QADLGKLRAAGYDAPMA-----TVEEGVSQYIEWLQRNV---------------------
HLDD_THIDA            EADTAALRRAGYDGSFY-----SVEEGTARYIERLLQS----------------------
HLDD_NEIMB            QADITKLREAGYKEEFF-----DVKSGVDRYVKWMLENLA--------------------
HLDD_NEIG1            QADITKLREAGYKEEFF-----DVKAGVNRYVKWMLENLA--------------------
HLDD_CHRVO            QADIAKLREAGYAEAML-----SVAEGVDRYVDWLIGRQG--------------------
HLDD_RALSO            QADQGKLRAAGYSAPFL-----TVQEGVARYCRWLMAQPA--------------------
HLDD_CUPNH            QSDVSKLRSAGYSEPFL-----SVEEGVARYCRWLIERAG--------------------
HLDD_CUPMC            QSDVSRLRGAGYSDQFL-----TVQEGVSRYCKWLLERSA--------------------
HLDD_PARXL            QADQSKLRAAGYDAPFL-----SVQEGVDRYVRWLFGQV---------------------
HLDD_BURPS            QADQTTLRAAGYDAPFL-----TVQEGVDRYVRWLFGQL---------------------
HLDD_CUPPJ            QSDSSRLREAGYTAPFV-----AMEEGVARYCQWLLERGQ--------------------
HLDD_PSEAE            CADLELLREAGYRDDFQ-----SLEEGVAGYCRWLARSA---------------------
HLDD_POLSJ            QADLQALRAAGCQHAFA-----DVQTGVAAYMQWLASAKI--------------------
HLDD_POLNA            QADLGALRAAGCQHVFA-----DVQSGVTAYMQWLSNAKN--------------------
HLDD_RHOFT            QADLSALRATGCDHPFA-----DVQTGVSNYVQWLAQQDS--------------------
HLDD_BORPE            QADVSRLRATGFSAPMR-----DVQTGVSEYVRYWRALK---------------------
HLDD_BORA1            QANVDALRAAGYTAVMR-----DVQTGVSEYVRYWRSRKSLA------------------
B7JC62_ACIF2          QAEISKLRGAGYDRTFL-----TVGQGVDRYVQWLTERTT--------------------
HLDD_MARHV            QADITALRDVGYTAEFA-----DVASGVESYLAWLDR-----------------------
HLDD_CHRSD            RADISRLREAGYKAEFK-----TVREGVSAYLDWLNG-----------------------
HLDD_HYDCU            QADNTRLRDAGYDKPFH-----TVSEGVQKYLRWLSDNPRVLDFTKK-------------
HLDD_AZOSB            EADMGALRAAGYDRPFM-----DVETGVPAYLSWLASQDKR-------------------
HLDD_AROAE            QADITALRQAGYEGEFM-----PVEVGVPRYLEWLALRD---------------------
HLDD_ALKEH            QADLSQLRAAGCDLAFN-----DIETGVRNYLDAVADAPAVMPS----------------
HLDD_SHELP            QADLTQLRAAGYTQAFK-----TVEEGVPEYLDWLAAQHFIGQ-----------------
HLDD_SHEFN            QADLTQLRAAGYQGEFK-----TVEQAVPEYLDWLKTQHFIGQ-----------------
HLDD_RHILO            QADMSRLRAAGYNGQFR-----TVETGVRDYVEWLKAQRSS-------------------
HLDD_PELCD            EADLTRLRGAGFDGSFL-----TVEEGVARYMEWLQQN----------------------
HLDD_SALAR            QADLTNLRNAGYDKPFK-----TVAEGVTEYMAWLNRDA---------------------
HLDD_SALTY            QADLTNLRNAGYDKPFK-----TVAEGVTEYMAWLNRDA---------------------
HLDD_ECOLI            QADLTNLRAAGYDKPFK-----TVAEGVTEYMAWLNRDA---------------------
HLDD_KLEP7            QADLTNLRKAGYDKPFK-----TVAEGVTEYMAWLNRDA---------------------
HLDD_CITK8            QADLTNLRAAGYDKPFK-----TVAEGVTEYMAWLNRDA---------------------
HLDD_ENT38            QADLTNLRAAGYDKPFK-----TVAEGVAEYMAWLNRN----------------------
HLDD_CROS8            QADLTNLRAAGYDKPFK-----TVAEGVAEYMAWLNRDA---------------------
HLDD_PHOLL            QADLTKLRAAGYDKPFK-----TVAEGVTEYMHWLNQDK---------------------
A0A1B8SW97_PRORE      QADLTKLRAAGYTAPFK-----TVAEGVTEYMHLLNKDA---------------------
HLDD_SODGM            QADLTQLRAAGYTQPFK-----TVAEGVAEYLRWLNHNY---------------------
HLDD_YERPE            QADLTKLRAAGYGKPFK-----TVAEGVKEYLAWLNRSV---------------------
HLDD_SERP5            QADLTKLRAAGYDAPFK-----TVAEGVKEYMAWLNRTA---------------------
HLDD_PASMU            QANLDKLRATGYDKPFK-----TVAQGVAEYMAWLNRK----------------------
HLDD_HAEIN            QADLTKLRSTGYDKPFK-----TVAEGVTEYMAWLNRK----------------------
HLDD_ACTSZ            QADLTKLRAAGCNLKFK-----SVAEGVAEYMAWLNRK----------------------
HLDD_ACTP2            QADLTKLRAAGYTGTFK-----TVAEGTKEYMAWLNR-----------------------
HLDD_VIBPA            QADLTKLRAAGCDVEFK-----TVAEGVAEYLTIQNS-----------------------
HLDD_VIBVY            QADLTKLRAAGCDVEFK-----NVAEGVAEYMAIVNG-----------------------
HLDD_VIBCH            EADLTKLRAAGCDVQFK-----SVAEGVAEYMALINRK----------------------
HLDD_PSYIN            EADLTNLRAAGYKDTFK-----SVAQGTAEYMAWLNR-----------------------
HLDD_HAMD5            QADITKLRTIGYDKPFK-----PLDEGVTHYLDWLNHQ----------------------
Q7U354_BLOFL          KANISYLRNIGYDFSFI-----KLSEGIHRYLNWLIHNN---------------------
D2RLQ8_ACIFV          QADATKLLATGYDGGFT-----DFAQAVKEYCQVLRDSDGYYKA----------------
Q1IJY8_KORVE          EADISGLRKLGWIEEPT-----TLEAGIDETYATLRQLGRES------------------
HLDD_DESVH            EATMGKLRDAGCPVRFT-----ELEDGVTEYVRRYLAAADPHL-----------------
B8J2P7_DESDA          QADMAWLGQVDCPLAFT-----PLEEGVADYVKGYLEKEDPYL-----------------
F0JFV9_DESDE          QANMDKLRAAGCTVKMT-----SLEDGAKDYVQNYLDKDDKYLRSR--------------
I3ZEM0_TERRK          EAKPDKLRAAGYDKPFT-----TLEDGIRDYVKNYLQAQKA-------------------
C1ACL5_GEMAT          KAEIAKLRAAGYAALVT-----PLADAVRDYVQGYLTDDRRLGD----------------
C6JQ57_FUSVA          QATMEKLKRAGYTKEFH-----SLEDGIKDYVQNYMAKEDPYL-----------------
HLDD_FUSNN            EAKINKLREIGYTKEMH-----SLEEGVKDYVQNYLAKEDSYL-----------------
D2QPF1_SPILD          QANMAKLRSIGYDRPFS-----SLEDGISDYVKNYLSKGDYM------------------
A0A6N4SQL2_CYTH3      EANMGKLKSIGYTDTFH-----TLEEGIKDYVKNYLIPNKYW------------------
E4TNZ9_MARTH          EAKMEKLKTIGYPYEFT-----DLESGVDAYIKEMKL-----------------------
Q6MHK5_BDEBA          EAKTDKWLAAGMSPAKW-----PLEKAVADYIQNYLSKDDKDL-----------------
I3TID4_TISMK          EAKIGRLRAAGFTRPTT-----ELEDGIASYVRDYLLNADPYV-----------------
A7ILV4_XANP2          QADVSKLRAAGFTRPFT-----SLEDGVASYVNGHLKPRNAA------------------
B6JBC5_OLICO          EADGEHLRRAGYNGGFT-----PLEDSVASYVKNFLDRPDRYR-----------------
Q89HR2_BRADU          QSEVDRLCRAGYNGGFT-----TLEDAVKAYVGDYLDRPDRFR-----------------
B4RAY4_PHEZH          QAQMDRLFEAGYPAAMT-----PLEEGIGDYVGNYLSQPDPYR-----------------
C7JF22_ACEP3          QADLSRLRAAGYTGQFT-----PLEEGVKRYVQDYLATDNPYL-----------------
L0DJS1_SINAD          RADMTKLQAAGFSRPAT-----TLEAGVASAITITTSVDPTE---------NPK------
E8R4T7_ISOPI          QADMSKLIAAGYPLNPT-----PLEVGIQRAFETETAGVSSDPAMPSTLVVTPQPVHGQP
F8L343_SIMNZ          CAEMSKFRKGIEENDWTFENDYSFESGVHDYVSEYLLKDERW------------------
                       :                     .  .                                 

HLDD_DECAR            ----
HLDD_THIDA            ----
HLDD_NEIMB            ----
HLDD_NEIG1            ----
HLDD_CHRVO            ----
HLDD_RALSO            ----
HLDD_CUPNH            ----
HLDD_CUPMC            ----
HLDD_PARXL            ----
HLDD_BURPS            ----
HLDD_CUPPJ            ----
HLDD_PSEAE            ----
HLDD_POLSJ            ----
HLDD_POLNA            ----
HLDD_RHOFT            ----
HLDD_BORPE            ----
HLDD_BORA1            ----
B7JC62_ACIF2          ----
HLDD_MARHV            ----
HLDD_CHRSD            ----
HLDD_HYDCU            ----
HLDD_AZOSB            ----
HLDD_AROAE            ----
HLDD_ALKEH            ----
HLDD_SHELP            ----
HLDD_SHEFN            ----
HLDD_RHILO            ----
HLDD_PELCD            ----
HLDD_SALAR            ----
HLDD_SALTY            ----
HLDD_ECOLI            ----
HLDD_KLEP7            ----
HLDD_CITK8            ----
HLDD_ENT38            ----
HLDD_CROS8            ----
HLDD_PHOLL            ----
A0A1B8SW97_PRORE      ----
HLDD_SODGM            ----
HLDD_YERPE            ----
HLDD_SERP5            ----
HLDD_PASMU            ----
HLDD_HAEIN            ----
HLDD_ACTSZ            ----
HLDD_ACTP2            ----
HLDD_VIBPA            ----
HLDD_VIBVY            ----
HLDD_VIBCH            ----
HLDD_PSYIN            ----
HLDD_HAMD5            ----
Q7U354_BLOFL          ----
D2RLQ8_ACIFV          ----
Q1IJY8_KORVE          ----
HLDD_DESVH            ----
B8J2P7_DESDA          ----
F0JFV9_DESDE          ----
I3ZEM0_TERRK          ----
C1ACL5_GEMAT          ----
C6JQ57_FUSVA          ----
HLDD_FUSNN            ----
D2QPF1_SPILD          ----
A0A6N4SQL2_CYTH3      ----
E4TNZ9_MARTH          ----
Q6MHK5_BDEBA          ----
I3TID4_TISMK          ----
A7ILV4_XANP2          ----
B6JBC5_OLICO          ----
Q89HR2_BRADU          ----
B4RAY4_PHEZH          ----
C7JF22_ACEP3          ----
L0DJS1_SINAD          ----
E8R4T7_ISOPI          TLSQ
F8L343_SIMNZ          ----