CLUSTAL format seed alignment for MF_01603

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

HLDE_MAGSA      ----MTELSA---LVERVEKLRGTMVLCVGDAMLDRFVYGSVERISPEAPIPVLCIERET
HLDE_RHORT      ----MDPTPA---LAEIVASLARVRVLCVGDVMLDRFVRGDVERISPEAPIPIVRVRDER
HLDE_PARL1      ---MTVKSPD---IQSLVEGLGHARVALAGDVMLDRFVYGHVERISPEAPIPVLRVDEER
HLDE_ACICJ      --MAEHDDGD---LIAAIRGLARANVLVVGDLMLDRYAYGRVERISPEAPVPILTVTREI
HLDE_RHILO      --MIKHNPPSPEPLHRAIARFGGVTVLVVGDLILDRFVNGVIERISPEAPIPVLHGRGET
HLDE_CAUVC      ----MDDALA-----HLPRAFAGKTVLVLGDVMLDRFIYGAVDRISPEAPVPVIAVEKET
HLDE_CAUSK      ----MDDTLA-----KLPRAFSGATVLVLGDVMLDRFVYGAVDRISPEAPVPVIAVERET
HLDE_BRASB      ----MFDFDD------LSQAIARQTVLCVGDLMLDEFVYGEVSRISPEAPAPVIAVQRSE
HLDE_BRASO      ----MFDFDD------LSQAIARQTVLCVGDLMLDEFVYGEVSRISPEAPAPVIAVQRSE
HLDE_RHOPS      ----MSRFDT------LLQSIARTTVLCVGDLMLDEFVYGEVSRISPEAPTPVIAVQRSE
HLDE_RHOP2      ----MNNFDT------LLQSIARTTVVCVGDLMLDEFVYGEVSRISPEAPAPVIAVQRSE
HLDE_RHOPA      ----MFSFDA------LLQAIARQTVLCVGDLMLDEFVYGEVSRISPEAPAPVIAVQRSE
HLDE_RHOP5      ----MLDFEQ------LSPAIPLQSVLCVGDLMLDEFVYGEVSRISPEAPAPVIAAQRSE
HLDE_RHOPB      ----MLDFEA------VLPAIGRQTVLCVGDLMLDEFVYGEVSRISPEAPAPVIAVQRSE
HLDE_BRADU      MPTPILDFDA------LAQTISGRTVLCIGDIMLDEFVYGEVSRISPEAPTPVIVAQRSE
HLDE_NITHX      ----MFDFDG------LSNAFSCQTVLCVGDLMLDEFVYGEISRISPEAPAPVIAVQRSE
HLDE_NITWN      ----MIDFDG------LSNAFSGQTVLCVGDLMLDEFVYGEISRISPEAPAPVIAVQRSE
HLDE_HYPNA      ----MSSRLS-----GLLDRAAGKRVLCIGDVMLDRFIYGVVDRISPEAPVPVLRHSREA
HLDE_AZOC5      ----------------MLAETQLAPIAVIGDVMVDRYITGSVSRISPEAPVPVLVHGAER
HLDE_GLUOX      ----------------MIDDFRFGRITVIGDLLLDQYISGGVSRISPEAPVPVVLHDGLR
HLDE_GLUDA      ------------------MDFSSITVLCIGDIMLDRFVYGEMERISPEAPVPVLRLGRTR
HLDE_GRABC      ------------------MDFSSTRVLCIGDVMLDRFMHGSVERISPEAPVPVLRITSTH
HLDE_MAGMM      ----------MLHAVETAFYQKHV--LVVGDLMLDRYLWGDVTRISPEAPVPVVHMQRES
HLDE_METFK      ------MRESFLDTIQHHFGHDPVWILVVGDLMLDRYLFGDVQRISPEAPVPVVLLKSQD
HLDE_KORVE      ---MSTNVADLLHTIKNNWCDRSI--LVVGDVMLDQYIWGDVGRISPEAPVPIVRATHRT
HLDE_ARCB4      ------------------MLSKKPNILVIGDLMIDHYLWGSCDRISPEAPVQVVNVKKES
HLDE_SULDN      ---------------MKILKSFTPRILVIGDLMIDHYLWGNCERISPEAPVQIVDISKET
HLDE_NITSB      ---------------------MKPRILVLGDVMIDHYLFGKCDRISPEAPVQVVDVQKEE
HLDE_HELHP      ---------------MFGLESKSPKILVIGDLMIDHYVWGSCERISPEAPVQVVDVKDEN
HLDE_WOLSU      ---------------MILSSSLRPTILVVGDLMIDHYIWGECERISPEAPVQVIDVKRET
HLDE_HELPY      ----------------------MKKILVIGDLIADYYLWGKSERLSPEAPVPVLEVQRES
HLDE_HELPH      ----------------------MKKILVIGDLIADYYLWGKSERLSPEAPVPVLEVKKES
HLDE_HELPJ      ----------------------MKKILVIGDLIADYYLWGKSERLSPEAPVPVLEVKKES
HLDE_HELAH      ----------------------MRKILVIGDLIADYYLWGKSERLSPEAPVPILEVKKES
HLDE_CAMC1      -------------------MAKRVKILVVGDLMLDHYIWGSCERISPEAPVQVVKINNET
HLDE_CAMC5      -------------------MAKKVEILVVGDLMLDHYIWGSCDRISPEAPVQVVKIAKET
HLDE_CAMFF      ----------------------MVNVLVVGDLMIDHYVWGSCDRISPEAPVQVVNIKNET
HLDE_CAMJE      --------------MLEFLSQQKPKILIIGDFMVDNYTWCDCSRISPEAPVLIAKTLKED
HLDE_CAMJJ      --------------MLEFLSQQKPKILIIGDFMVDNYTWCDCSRISPEAPVLVAKTLKED
HLDE_CAMJ8      --------------MLEFLSQQKPKILIIGDFMVDNYTWCDCSRISPEAPVLVAKTLKED
HLDE_CAMJD      --------------MLEFLSQQKPKILIIGDFMVDNYTWCDCSRISPEAPVLVAKTLKED
HLDE_CAMJR      --------------MLEFLSQQKPKILIIGDFMVDNYTWCDCSRISPEAPVLVAKTLKED
HLDE_GEOMG      --------MERKNVESLFAHARDINALVIGDLMLDEYLWGRAERISPEAPVQVLDVTREE
HLDE_GEOSL      --------MERKNVESLFAHAGAINALVIGDLMLDQYLWGKAERISPEAPVQVVDVTREE
HLDE_GEOUR      --------MERKEIESLFTRAREIRALVIGDLMLDEYLWGKAERISPEAPVQVVDVTRED
HLDE_PELPD      --------MDRKSIESIFNRIRTANCLVIGDLMLDEYLWGKAERISPEAPVQVVDVVREE
HLDE_PELCD      --------MDRTNIENFLSRLKDLRALVIGDLMLDEYLWGRTERISPEAPVQVVDVVRED
HLDE_ECOLI      -------------MKVTLPEFERAGVMVVGDVMLDRYWYGPTSRISPEAPVPVVKVNTIE
HLDE_ECOHS      -------------MKVTLPEFERAGVMVVGDVMLDRYWYGPTSRISPEAPVPVVKVNTIE
HLDE_ECO24      -------------MKVTLPEFERAGVMVVGDVMLDRYWYGPTSRISPEAPVPVVKVNTIE
HLDE_ECOL5      -------------MKVTLPEFERAGVMVVGDVMLDRYWYGPTSRISPEAPVPVVKVNTIE
HLDE_SHIBS      -------------MKVTLSEFERAGVMVVGDVMLDRYWYGPTSRISPEAPVPVVKVNTIE
HLDE_ECO57      -------------MKVTLPEFERAGVMVVGDVMLDRYWYGPSSRISPEAPVPVVKVNTIE
HLDE_SHISS      -------------MKVTLPEFERAGVMVVGDVMLDRYWYGPSSRISPEAPVPVVKVNTIE
HLDE_SHIFL      -------------MKVTLPEFERAGVMVVGDVMLDRYWYGPTSRISPEAPVPVVKVNTIE
HLDE_SHIF8      -------------MKVTLPEFERAGVMVVGDVMLDRYWYGPTSRISPEAPVPVVKVNTIE
HLDE_SHIDS      -------------MKVTLPEFERAGVMVVGDVMLDRYWYGPTSRISPEAPVPVVKVNTIE
HLDE_ECOUT      -------------MKVTLPEFERAGVMVVGDVMLDRYWYGPTSRISPEAPVPVVKVNTIE
HLDE_ECOK1      -------------MKVTLPEFERAGVMVVGDVMLDRYWYGPTSRISPEAPVPVVKVNTIE
HLDE_ECOL6      -------------MKVTLPEFERAGVMVVGDVMLDRYWYGPTSRISPEAPVPVVKVNTIE
HLDE_SALCH      -------------MKVNLPAFERAGVMVVGDVMLDRYWYGPTCRISPEAPVPVVKVNTVE
HLDE_SALTI      -------------MKVNLPAFERAGVMVVGDVMLDRYWYGPTCRISPEAPVPVVKVNTVE
HLDE_SALTY      -------------MKVNLPAFERAGVMVVGDVMLDRYWYGPTCRISPEAPVPVVKVNTVE
HLDE_SALPA      -------------MKVNLPAFERAGVMVVGDVMLDRYWYGPTCRISPEAPVPVVKVNTVE
HLDE_CITK8      -------------MKVTLPEFERAGVMVVGDVMLDRYWYGPTSRISPEAPVPVVKVDTIE
HLDE_ENT38      -------------MKVTLPEFERAGVMVVGDVMLDRYWYGPTSRISPEAPVPVVKVDTIE
HLDE_CROS8      -------------MKVTLPDFERAGVMVVGDVMLDRYWYGPTSRISPEAPVPVVKVETIE
HLDE_KLEP7      -------------MKVTLPEFERAGVLVVGDVMLDRYWYGPTSRISPEAPVPVVKVENIE
HLDE_PECAS      -------------MKVTLPDFRQAGVLVVGDVMLDRYWYGPTSRISPEAPVPVVKVDTIE
HLDE_YERPE      -------------MKVTLPDFRRAGVLVVGDVMLDRYWYGPTCRISPEAPVPVVKVDTIE
HLDE_YERPP      -------------MKVTLPDFRRAGVLVVGDVMLDRYWYGPTCRISPEAPVPVVKVDTIE
HLDE_YERPA      -------------MKVTLPDFRRAGVLVVGDVMLDRYWYGPTCRISPEAPVPVVKVDTIE
HLDE_YERPN      -------------MKVTLPDFRRAGVLVVGDVMLDRYWYGPTCRISPEAPVPVVKVDTIE
HLDE_YERPS      -------------MKVTLPDFRRAGVLVVGDVMLDRYWYGPTSRISPEAPVPVVKVDTIE
HLDE_YERP3      -------------MKVTLPDFRRAGVLVVGDVMLDRYWYGPTSRISPEAPVPVVKVDTIE
HLDE_YERE8      -------------MKVTLPDFRRAGVLVVGDVMLDRYWYGPTSRISPEAPVPVVKVDTIE
HLDE_SERP5      -------------MKVTLPDFRRAGVLVVGDVMLDRYWYGPTSRISPEAPVPVVKVETIE
HLDE_SODGM      -------------MKVTLPDFRRAGVLVVGDVMLDRYWYGPTSRISPEAPVPIVKVDAIE
HLDE_PHOLL      -------------MKMTLPDFHCAEVLVVGDVMLDRYWYGPTSRISPEAPVPVVKVNTIE
HLDE_ACTPL      -------------MIQYSSKFNNAKVLVLGDVMLDRYWFGATNRISPEAPVPVVKVQGIE
HLDE_ACTP2      -------------MMQYSPKFNNAKVLVLGDVMLDRYWFGATNRISPEAPVPVVKVQDIE
HLDE_HAEDU      -------------MMQYSLKFNQAKVLVLGDVMLDRYWFGATNRISPEAPVPVVKVKDME
HLDE_ACTSZ      -------------MAQYSAQFPHAKVLVLGDVMLDRYWFGATNRISPEAPVPVVRVKKHE
HLDE_MANSM      -------------MAQYSAQFNQAKVLVLGDVMLDRYWFGATNRISPEAPVPVVRVQENE
HLDE_HAES1      --------------MQYSAQFNRAKVLVLGDVMLDRYWFGATNRISPEAPVPVVRVQENE
HLDE_PASMU      -------------MFQYSAEFKQAKVLVLGDVMLDRYWFGATNRISPEAPVPVVRVQDNE
HLDE_HAEI8      -------------MAQYSAEFKQAKVLVLGDVMLDRYWFGATNRISPEAPVPVVRVQENE
HLDE_HAEIE      -------------MAQYSAEFKQAKVLVLGDVMLDRYWFGATNRISPEAPVPVVRVQENE
HLDE_HAEIG      -------------MAQYSAEFKQAKVLVLGDVMLDRYWFGATNRISPEAPVPVVRVQENE
HLDE_HAEIN      -------------MAQYSAEFKQAKVLVLGDVMLDRYWFGATNRISPEAPVPVVRVQENE
HLDE_BLOFL      -------------MTVILPDFLKSNVLVVGDIMLDRYWYGSTNKISFESPVPVVEINNVI
HLDE_BLOPB      -------------MTVIFPNFSKSSVLIVGDVMLDRYWYGPTDKIAPEAPVPIVKVNKII
HLDE_VIBCB      -------------MKPILPDYNSAGVLIIGDVMLDRYWYGPTGRISPEAPVPVVKVENNE
HLDE_VIBPA      -------------MKPILPDYNSAGVLIIGDVMLDRYWYGPTGRISPEAPVPVVKVENNE
HLDE_VIBVU      -------------MKPILPDYNNAGVLIIGDVMLDRYWYGPTSRISPEAPVPVVKVENNE
HLDE_VIBVY      -------------MKPILPDYNNAGVLIIGDVMLDRYWYGPTSRISPEAPVPVVKVENNE
HLDE_VIBC3      -------------MKPVLPDYSKAGVLIVGDVMLDRYWYGPTGRISPEAPVPVVKVEQSE
HLDE_ALIF1      -------------MKPTLPNYDQSSVLIVGDVMLDRYWGGPTSRISPEAPVPVVKVEKIE
HLDE_PHOPR      -------------MKLTLPDYDQASVLVVGDIMLDRYWYGPTGRISPEAPVPVVKVEQIE
HLDE_PSYIN      -------------MKITLPEYDKAQVLVVGDVMLDRYWHGPTARISPEAPVPVVKVEQIE
HLDE_AERHH      -------------MKITLPEFEKARVLVVGDVMLDRYWHGPTGRISPEAPVPVVKVEHIE
HLDE_AERS4      -------------MKITLPEFGKARVLVVGDVMLDRYWHGPTGRISPEAPVPVVKVEHIE
HLDE_SHEB5      -------------MKVSLPAFEKARVLVVGDVMLDRYWVGPTGRISPEAPVPVVKINQVE
HLDE_SHEB9      -------------MKVSLPAFEKARVLVVGDVMLDRYWVGPTGRISPEAPVPVVKINQVE
HLDE_SHEB8      -------------MKVSLPAFEKARVLVVGDVMLDRYWVGPTGRISPEAPVPVVKINQVE
HLDE_SHEPC      -------------MKVSLPAFEKARVLVVGDVMLDRYWVGPTGRISPEAPVPVVKINQVE
HLDE_SHESW      -------------MKVSLPAFEKARVLVVGDVMLDRYWVGPTGRISPEAPVPVVKINQVE
HLDE_SHESM      -------------MKVSLPAFEKAKVLVVGDVMLDRYWVGPTGRISPEAPVPVVKINQVE
HLDE_SHESR      -------------MKVSLPAFEKAKVLVVGDVMLDRYWVGPTGRISPEAPVPVVKINQVE
HLDE_SHESA      -------------MKVSLPAFEKAKVLVVGDVMLDRYWVGPTGRISPEAPVPVVKINQVE
HLDE_SHEON      -------------MKVSLPAFEKAKVLVVGDVMLDRYWVGPTGRISPEAPVPVVKINQVE
HLDE_SHEDO      -------------MKVTLPAFEKARVLVLGDVMLDRYWVGPTGRISPEAPVPVVKINQIE
HLDE_SHEFN      -------------MKVSLPAFENARVLVIGDVMLDRYWVGPTGRISPEAPVPVVKINQIE
HLDE_SHEAM      -------------MKVTLPAFEKARVLVVGDVMLDRYWVGPTGRISPEAPVPVVRINQIE
HLDE_SHEHH      -------------MKISLPAFEKAKVLVVGDVMLDRYWAGPTARISPEAPVPVVKVEQLE
HLDE_SHEPA      -------------MKISLPAFEKAKVLVVGDVMLDRYWAGPTARISPEAPVPVVKVEQLE
HLDE_SHELP      -------------MKISLPAFEKANVLVVGDVMLDRYWSGPTGRISPEAPVPVVRVNQIE
HLDE_SHESH      -------------MKVSLPAFEKAKVLVVGDVMLDRYWTGPTGRISPEAPVPVVKISQIE
HLDE_CHRSD      -------------MKLDLTVLEQARLLVVGDVMLDRYWHGGTSRISPEAPVPVVKVGESE
HLDE_PSEAE      -------------MKLSMPRFDQAPVLVVGDVMLDRYWHGATSRISPEAPVPVVRVEQHE
HLDE_PSEAB      -------------MKLSMPRFDQAPVLVVGDVMLDRYWHGATSRISPEAPVPVVRVEQHE
HLDE_PSEA7      -------------MKLSMPRFDQAPVLVVGDVMLDRYWHGATSRISPEAPVPVVRVEQHE
HLDE_PSEMY      -------------MKLTLPRYDQAPVLVVGDVMLDRYWHGGTSRISPEAPVPVVRVEQIE
HLDE_PSEP1      -------------MKLSMPRFDQAPVLVVGDVMLDRYWHGGTSRISPEAPVPVVKVDQIE
HLDE_PSEPK      -------------MKLSMPRFDQAPVLVVGDVMLDRYWHGGTSRISPEAPVPVVKVDQIE
HLDE_PSEPG      -------------MKLSMPRFDQAPVLVVGDVMLDRYWHGGTSRISPEAPVPVVKVDQIE
HLDE_PSEE4      -------------MKLSMPRFDQAPVLVVGDVMLDRYWHGGTSRISPEAPVPVVKVDQIE
HLDE_PSEF5      -------------MKLSMPRFDQAPVLVVGDVMLDRYWHGGTSRISPEAPVPVVKVEQIE
HLDE_PSEPF      -------------MKLSMPRFDQAPVLVVGDVMLDRYWHGGTSRISPEAPVPVVKVEQIE
HLDE_PSEU2      -------------MKLSMPRFDQAPVLVVGDVMLDRYWHGGTSRISPEAPVPVVKVDQIE
HLDE_PSESM      -------------MKLSMPRFDQAPVLVVGDVMLDRYWHGGTSRISPEAPVPVVKVDQIE
HLDE_PSE14      -------------MKLSMPRFDQAPVLVVGDVMLDRYWHGGTSRISPEAPVPVVKVDQIE
HLDE_PSEU5      -------------MKLSMPRFDQAPVLVVGDVMLDRYWHGGTSRISPEAPVPVVKVEQIE
HLDE_HAHCH      -------------MQIQLPMFQNSRVVVVGDVMLDRYWYGATSRISPEAPVPVVKVEQLE
HLDE_ALCBS      ------------MQNPHIPSFAQARVLVAGDVMLDRYWHGPTSRISPEAPVPVVRVTELE
HLDE_ALKEH      -------------MKITLPPFDQARVLVAGDLMLDRYWHGGTDRISPEAPVPVVHVRDIE
HLDE_HALHL      -------------MTPPLPGFRDVRVVVAGDLMLDRYWHGATQRISPEAPVPVVRVDGAE
HLDE_NITOC      -------------MTHGLPHFTSAQVLVIGDVILDRYWHGTTSRISPEAPVPVVQVTGRE
HLDE_COXBU      -----------MADKIDISLYEKARIVVYGDIMLDRYWYGQASRISPEAPIPVVNVDQIE
HLDE_COXBR      -----------MADKIDISLYEKARIVVYGDIMLDRYWYGQASRISPEAPIPVVNVDQIE
HLDE_COXBN      -----------MADKIDISLYEKARIVVYGDIMLDRYWYGQASRISPEAPIPVVNVDQIE
HLDE_METCA      ---------------MILPDFSLARVLVVGDLMLDRYWFGGASRISPEAPVPVVRVESSE
HLDE_MARMS      -------------MNSSYLNFKDKHILVVGDVMLDRYWHGGTSRISPEAPVQVVKVSSIE
HLDE_HYDCU      ---------------MNMHDFSKTKILVVGDVMLDQYWSGRAGRISPEAPVPVVKVADEN
HLDE_DICNV      -----------MTQFSNLPIFERARILVVGDTMLDRNWSGLAQRISPEAPVPVVNIEQQT
HLDE_MARHV      -----------MLDLARLDQLQNASVLVIGDVMLDRYFIGDTNRISPEAPVPVVRVAHTE
HLDE_PSEHT      ------------MDLSLLKNLSAARILVVGDVMLDRYWYGDSGRISPEAPVPVVKVSKLE
HLDE_STRCO      ------------MTGPMAVRTDRTPLVVVGDALLDRDLTGTADRLAPDAPVPVVQECAER
                                             ** : *        ::: ::*  :       

HLDE_MAGSA      AMLGGAGNVVRNLVAVGAEPAFVSVVGDDTAGREVTRLVGEHGEI-DPCIVVEPGRQTTI
HLDE_RHORT      AMLGGAGNVVRNIVALGGRCAFMAVIGEDRAGAEIGGLLGDEHKV-DSFIGIQPNRRTSV
HLDE_PARL1      AMPGGAGNVARNLAALGAEVTFLSAVGDDEAGADLKAALEREGGI-EAALTVVPGRTTTQ
HLDE_ACICJ      AMPGGAGNVVRNLTALDAAAAFVSVVGDDQEGSDLTALIGGQPNV-EPWLLVETGRATTV
HLDE_RHILO      SAMGGAGNVVANIVSLGARAIPVSVIGTDTAGDSLVRMLAELGAE-TAGLSQQRGRMTSS
HLDE_CAUVC      AMLGGAGNVARNVAALGAKAVLIGLVGRDDAGAALRGMIDAEAGL-EAELVVDPARRTTE
HLDE_CAUSK      TMLGGAGNVARNVAALGGRAVLVGVIGDDDAGRALTAMIDREPSL-DSALIVDAKRRTTE
HLDE_BRASB      INIGGAGNVARNIAALGARCIFVGLVGDDAAAAQLEAELAREPGI-ETVLVRDASRPTTR
HLDE_BRASO      TNIGGAGNVARNIAALGARGIFVGLVGQDAAGDQLEAELAKVDGI-ESVLVRDPSRPTTR
HLDE_RHOPS      INVGGAGNVARNIAAIGARCIFVGLIGDDEAGRTLSAEIARESRI-EPLLVCDPARPTTR
HLDE_RHOP2      INVGGAGNVARNIAALGARCIFVGLIGDDEAGRTLNAELASEARI-EPLLVCDPARPTTR
HLDE_RHOPA      TNIGGAGNVARNIAAIGARCIFVGLIGDDATGRFLESELGSESRI-EPVLVCDGSRPTTR
HLDE_RHOP5      IDVGGAGNVARNIASLGARCVFIGLVGDDDAGRTLQTTLAKDALI-TPVLVCDPSRPTTR
HLDE_RHOPB      INVGGAGNVARNIAALGARCIFVGLIGDDAAGRTLSAALAAEPLI-EPVLVCDESRPTTR
HLDE_BRADU      IHIGGAGNVARNVASLGARCIFVGLVGEDDAGKRLAAALADQAAI-ESVLVCDPSRPTTR
HLDE_NITHX      INVGGAGNVARNIAALGARCIFVGLAGEDEAGVRLRTTLSREGLI-EPLLISDPARPTTR
HLDE_NITWN      TNVGGAGNVARNIAALGARCIFVGLAGEDDAGARLRDTLSRERLI-EPLLISDPARSTTR
HLDE_HYPNA      SMPGGAANVARNLASLGLEPVLIGACGDDDAGRELLSIFDQDLSL-SVRLVTAKGRPTTL
HLDE_AZOC5      IVPGGAANVAANAAALGAPVLLVGLVGEDEAASQLADALATYPGISLAHMVVDAKRPTIT
HLDE_GLUOX      CVPGGAANVAVNAAALGAQVHLVGLVGEDDSAARLKETLKLWPTIETDGIVSSPDWTTIT
HLDE_GLUDA      EMPGGVGNVANNILSLGGRAILVGLVGRDTPGQALRGLLGQRPGL-TDALVETGARPTIC
HLDE_GRABC      SMLGGAGNVAHNIADLGGTAILVGLIGHDDTAIALRTHLERVPGI-VNALVESPHRPTIC
HLDE_MAGMM      HRCGGAANVASNLAKLGLHTSIVGFVGEDSDGQVLISALQ-ESGIDTHGILPLAGWSTIT
HLDE_METFK      ERAGGAANVAANLAGLGIKTRIAGVIGQDAEAETLLGLMH-DIGADTQHIHCSACRPTIT
HLDE_KORVE      EQPGGAANVALNIARLGARATIVGFTGTDDNERALKDYLS-SNRVEADFVSC-EGFPTIT
HLDE_ARCB4      SVLGGAGNVINNLFTLGTTVDVISVIGDDNVANELKSLLE-KIKISTSNLIVENNRKTSK
HLDE_SULDN      TVLGGGGNVVNNLVALGAKVSVSGVIGNDENGVELLKLLR-EIDVNVDNIVIQEGRKTSK
HLDE_NITSB      LVLGGAGNVVNNLLAFGAEVGIISVVGEDANGIWLEQRFQ-E--KGVQTYLLKENRPTTK
HLDE_HELHP      NRLGGACNVVHNLIALNAQVFVCGVVGNDEAGFWLGEKLE-SMGVDISYLFVDTSRPTTK
HLDE_WOLSU      KTLGGACNVMSNLIALEASVLSCGVVGEDLAGRELLGFLQ-ELGMESKGIITQKGRPTTQ
HLDE_HELPY      KNLGGAANVANNLISLKAKVFLCGVVGDDLEGEHFISALK-ARGIDASGILIDKTRCTTL
HLDE_HELPH      KNLGGAANVANNLISLKAKVFLCGVVGDDLEGKHFISALK-AREIDTSGILTDKTRCTTL
HLDE_HELPJ      KNLGGAANVANNLTSLKAKVFLCGVVGDDLEGKHFISTLK-TRGIDTSGVLIDKTRCTTL
HLDE_HELAH      KSLGGAANVANNLISLGAQVFLCGVVGDDLEGKHFINALK-IREVDTSGVLIDKTRCTTL
HLDE_CAMC1      YTLGGAGNVVRNLLSLGANVSVASVLGDDEAGKKIKEKLA-ELNVKDELILTEKGRESSI
HLDE_CAMC5      HRLGGAGNVVQNLLALGAKVSVASVVGDDEVGLRIKNMLS-ELGAGGGLILSEKGRESSI
HLDE_CAMFF      KRLGGLGNVVSNLKTLGSEVGVISVVGDDDVGDEILELLK-DRGAKTELIIKEKGRKSSQ
HLDE_CAMJE      KRLGGAANVYANLKSLGADVFALGVVGDDESGKFLQENL------KGEFLIQ-KGRKTPF
HLDE_CAMJJ      KRLGGAANVYANLKNLGADVFALGVVGDDESGKFLQENL------KGEFLIQ-KGRKTPF
HLDE_CAMJ8      KRLGGAANVYANLKSLGADVFALGVVGDDKSGKFLQENL------KGEFLIQ-KGRKTPF
HLDE_CAMJD      KRLGGAANVYANLKSLGADVFALGVVGDDESGKFLQENL------KGEFLIQ-KGRKTPF
HLDE_CAMJR      KRLGGAANVYANLKSLGADVFALGVVGDDKSGKFLQENL------KGEFLIQ-KGRKTPF
HLDE_GEOMG      VRIGGAGNVANNLVALGCRVSVASVVGGDENGTILLHAFS-GKGVDVSGVFEDPQRTTSR
HLDE_GEOSL      IRIGGAGNVANNLVALGCRVSVASVVGGDENGTILLHAFS-GKGIDVTGIVEDPSRTTSR
HLDE_GEOUR      LRLGGAGNVVNNLVALGCQVAVCSVIGGDENGSHLRHAFT-GKGVDLTGVFEDPLRLTSK
HLDE_PELPD      MRLGGAGNVVNNLVELGAEVTVCSVVGDDDNGQALLEAFG-RRGVATDAIFLDATRRTSR
HLDE_PELCD      LRLGGAGNVINNLVTLGCQVHVASVLGEGHDGLLLRRRLE-EKQVGIEGLQFDAKRTTSR
HLDE_ECOLI      ERPGGAANVAMNIASLGANARLVGLTGIDDAARALSKSLA--DVNVKCDFVSVPTHPTIT
HLDE_ECOHS      ERPGGAANVAMNIASLGANARLVGLTGIDDAARALSKSLA--DVNVKCDFVSVPTHPTIT
HLDE_ECO24      ERPGGAANVAMNIASLGANARLVGLTGIDDAARALSKSLA--DVNVKCDFVSVPTHPTIT
HLDE_ECOL5      ERPGGAANVAMNIASLGANARLVGLTGIDDAARALSKSLA--DVNVKCDFVSVPTHPTIT
HLDE_SHIBS      ERPGGAANVAMNIASLGANARLVGLTGIDDAARALSKSLA--DVNVKCDFVSVPTHPTIT
HLDE_ECO57      ERPGGAANVAMNIASLGANARLVGLTGIDDAARALSKSLA--DVNVKCDFVSVPTHPTIT
HLDE_SHISS      ERPGGAANVAMNIASLGANARLVGLTGIDDAARALSKSLA--DVNVKCDFVSVPTHPTIT
HLDE_SHIFL      ERPGGAANVAMNIASLGANARLVGLTGIDDAARALSKSLA--DVNVKCDFVSVPTHPTIT
HLDE_SHIF8      ERPGGAANVAMNIASLGANARLVGLTGIDDAARALSKSLA--DVNVKCDFVSVPTHPTIT
HLDE_SHIDS      ERPGGAANVAMNITSLGANARLVGLTGIDDAARALSKSLA--DVNVKCDFVSVPTHPTIT
HLDE_ECOUT      ERPGGAANVAMNIASLGANARLVGLTGIDDAARALSKSLA--DVNVKCDFVSVPTHPTIT
HLDE_ECOK1      ERPGGAANVAMNIASLGANARLVGLTGIDDAARALSKSLA--DVNVKCDFVSVPTHPTIT
HLDE_ECOL6      ERPGGAANVAMNIASLGANARLVGLTGIDDAARALSKSLA--DVNVKCDFVSVPTHPTIT
HLDE_SALCH      ERPGGAANVAMNIASLGANARLVGLTGIDDAARALSKTLA--EVNVKCDFVSVPTHPTIT
HLDE_SALTI      ERPGGAANVAMNIASLGANARLVGLTGIDDAARALSKTLA--EVNVKCDFVSVPTHPTIT
HLDE_SALTY      ERPGGAANVAMNIASLGANARLVGLTGIDDAARALSKTLA--EVNVKCDFVSVPTHPTIT
HLDE_SALPA      ERPGGAANVAMNIASLGANARLVGLTGIDDAARALSKTLA--EVNVKCDFVSVPTHPTIT
HLDE_CITK8      ERPGGAANVAMNIASLGANSRLVGLTGIDDAARALSKTLA--DVNVKCDFVSVPTHPTIT
HLDE_ENT38      ERPGGAANVAMNIASLGAHSRLVGLTGIDDAARALSKTLA--DVNVKCDFVSVPTHPTIT
HLDE_CROS8      ERPGGAANVAMNIASLGASSRLVGLTGIDDAARALSQSLA--QVNVKCDFVSVPTHPTIT
HLDE_KLEP7      ERPGGAANVAMNIASLGATSRLVGLTGIDDAARALSQALA--NVNVKCDFVSVPTHPTIT
HLDE_PECAS      ERPGGAANVAMNIAALGAGSRLVGLTGVDDAARALNAKLG--EVNVKCDFVSVPTHPTIT
HLDE_YERPE      ERPGGAANVAMNIASLGAVARLVGLTGIDDAARALICKLS--EVRVRCDFVSVPTHPTIT
HLDE_YERPP      ERPGGAANVAMNIASLGAVARLVGLTGIDDAARALICKLS--EVRVRCDFVSVPTHPTIT
HLDE_YERPA      ERPGGAANVAMNIASLGAVARLVGLTGIDDAARALICKLS--EVRVRCDFVSVPTHPTIT
HLDE_YERPN      ERPGGAANVAMNIASLGAVARLVGLTGIDDAARALICKLS--EVRVRCDFVSVPTHPTIT
HLDE_YERPS      ERPGGAANVAMNIASLGAVARLVGLTGIDDAARALICKLS--EVRVRCDFVSVPTHPTIT
HLDE_YERP3      ERPGGAANVAMNIASLGAVARLVGLTGIDDAARALICKLS--EVRVRCDFVSVPTHPTIT
HLDE_YERE8      ERPGGAANVAMNIASLGAISRLVGLTGIDDAARALTSKLN--EVQVRCDFVSVPTHPTIT
HLDE_SERP5      ERPGGAANVAMNIASLGANSRLVGLTGIDDAARALSAKLN--EVNVRCDFVSVPTHPTIT
HLDE_SODGM      ERPGGAANVAMNIAALGCHSRLVGLTGIDDAARALGARLS--EVDVTCDFVAVATHPTVT
HLDE_PHOLL      ERPGGAANVAMNIAALGANSHLIGLTGIDDAAHALSEKLR--SVKVRCDFVSVPTHPTVT
HLDE_ACTPL      ERAGGAANVAMNIASLSVPVALHGLIGQDDAGRALDKLLN--SHNIQNHCVALDSHPTIT
HLDE_ACTP2      ERAGGAANVAMNIASLSVPVALHGLIGQDDAGRALDKLLN--SHNIQNHCVALDSHPTIT
HLDE_HAEDU      ERAGGAANVAMNIASLNATVALHGLVGHDDAGCVLDMLLK--NHHIQNHCITLDSHPTIT
HLDE_ACTSZ      ERAGGAANVAMNIASLNVPVRLLGLTGDDEAGNALTGLLE--KQKICCDFVKLSSHPTIT
HLDE_MANSM      ERAGGAANVAMNIASLNVPVQLLGLTGLDETGKALTTLLQ--TQKIDCDFVRLATHPTIT
HLDE_HAES1      ERAGGAANVAMNIASLNVPVRLLGLTGKDEAARALMQLLE--KQSIHCDFTQLDSHPTIT
HLDE_PASMU      ERAGGAANVAMNIAALNVPVKLLGLTGRDETGLALESLLA--KSRIECDFVQLHTHPTIT
HLDE_HAEI8      ERAGGAANVAMNIASLNVSVQLMGLIGQDETGSALSLLLE--KQKIDCNFVALETHPTIT
HLDE_HAEIE      ERAGGAANVAMNIASLNVSVQLMGLIGQDETGSALSLLLE--KQKIDCNFVALETHPTIT
HLDE_HAEIG      ERAGGAANVAMNIASLNVPVQLMGLIGQDETGSALSLLLE--KQKIDCNFVALETHPTIT
HLDE_HAEIN      ERAGGAANVAMNIASLNVPVQLMGLIGQDETGSALSLLLE--KQKIDCNFVALETHPTIT
HLDE_BLOFL      DIPGGAANVAMNIASLGGRVRLIGLVGVDDAAQRLKKRLT--ECKIKWNFISVDTHPTIM
HLDE_BLOPB      DRPGGAANVAMNIASLGARSRLLGLTGVDEAAKILKKQLN--ESNIKWNFISVRTCPTII
HLDE_VIBCB      ERPGGAANVAMNIASLGGHAHIVGLTGMDEPAKVLTETLN--SLKVKCDFVALPEYPTIT
HLDE_VIBPA      ERPGGAANVAMNIASLGGHAHIVGLTGEDEPAKVLTETLS--ALNVKCDFVALPDYPTIT
HLDE_VIBVU      ERPGGAANVAMNIASLGGHARIVGLTGMDEPAKVLTETLN--SLKVKCDFVALPEYPTIT
HLDE_VIBVY      ERPGGAANVAMNIASLGGHARIVGLTGMDEPAKVLTETLN--SLKVKCDFVALPEYPTIT
HLDE_VIBC3      ERPGGAANVAMNIASLGGHAHIIGLTGQDEPANVLANKLT--SLKVHCDFVALPDYPTIT
HLDE_ALIF1      ERPGGAANVAMNIAALGGDAHLVGLVGEDEPAQALTTTLE--SLKVHCDFVALPEFPTIT
HLDE_PHOPR      ERPGGAANVAMNIAALGGHVHLVGLTGIDEPAKALNEKLT--SLDVRCDFVSLPDYPTIT
HLDE_PSYIN      ERPGGAANVALNVAALGGKVNLIGLVGDDEAANVLVKNLK--SVHVNTDFVSVPNFPTIT
HLDE_AERHH      ERPGGAANVALNSAALGAHAVLLGLTGQDEAADALAGQMA--GVKVACDFVRLADYPTIT
HLDE_AERS4      ERPGGAANVALNSAALGAHAVLLGLTGQDEAADALAGQMA--GVKVACDFVRLADYPTIT
HLDE_SHEB5      DRPGGAANVALNIATLGGQVQLAGLVGQDDTAHALTLGVQ--TLGVEPQWLTIADKPTIT
HLDE_SHEB9      DRPGGAANVALNIATLGGQVQLAGLVGQDDTAHALTLGVQ--TLGVEPQWLTIADKPTIT
HLDE_SHEB8      DRPGGAANVALNIATLGGQVQLAGLVGQDDTAHALTLGVQ--TLGVEPQWLTIADKPTIT
HLDE_SHEPC      DRPGGAANVALNIATLGGQVQLAGLVGQDDTAVALTLGVQ--TLGVEPQWLSIADKPTIT
HLDE_SHESW      DRPGGAANVALNIATLGGQVQLAGLVGQDDTAIALTLGVQ--TLGVEPQWLSIADKPTIT
HLDE_SHESM      DRPGGAANVALNIATLGGQVQLAGLVGEDDTAKALTLGVQ--ALGVEPQWLKIADKPTIT
HLDE_SHESR      DRPGGAANVALNIATLGGQVQLAGLVGEDDTAKALTLGVQ--ALGVEPQWLKIADKPTIT
HLDE_SHESA      DRPGGAANVALNIATLGGQVQLAGLVGEDDTAKALTLGVQ--ALGVEPQWLNIADKPTIT
HLDE_SHEON      DRPGGAANVALNIATLGGQVQLAGLVGEDDTAKALTLGVQ--ALGVEPQWLNIADKPTIT
HLDE_SHEDO      DRPGGAANVALNIATLGGQVQLAGLVGDDETAKALTLGVQ--TLGVEPQWLVVNDKPTIT
HLDE_SHEFN      DRPGGAANVALNIATLGGHVQLAGIVGQDETAQALTQGVK--VFGVEPQWLTVADKPTIT
HLDE_SHEAM      DRPGGAANVALNIAALGGKVQLSGLVGQDDTADALTRGVQ--ALGVEPHWLVVEDKPTIT
HLDE_SHEHH      DRPGGAANVAINIATLGGSASLAGIVGEDETADALTLGIQ--TLGVEPNWHKVAGKPTIT
HLDE_SHEPA      DRPGGAANVAINIATLGGSASLAGIVGVDETADALTVGVR--ALGVEPNWHKVADKPTIT
HLDE_SHELP      DRPGGAANVALNIATLGGQVSLAGIVGEDETAAALTQGIE--ALGVVPKWHTVAELPTIT
HLDE_SHESH      DRPGGAANVALNVATLGGQVSLAGIVGKDEAADALTTGIQ--ALGVEPKWHCVEGKPTIT
HLDE_CHRSD      DRPGGAANVALNIAALGAHAALAGVVGEDENADLLAARLE--ACDVSTYFYRSPEIPTIT
HLDE_PSEAE      DRPGGAANVALNIAALGAQALLVGVTGRDEAADSLANSLK--AAGVDARFQRIDSQPTIV
HLDE_PSEAB      DRPGGAANVALNIAALGAQALLVGVTGRDEAADSLANSLK--AAGVDARFQRIDSQPTIV
HLDE_PSEA7      DRPGGAANVALNIAALGAQALLVGVTGRDEAADSLANSLK--AAGVDARFQRIDSQPTIV
HLDE_PSEMY      DRPGGAANVALNIAALGAPALLVGVTGEDEAADSLTDSLA--AAGVEAHFQRIEDQPTIV
HLDE_PSEP1      DRPGGAANVALNIAALGAPASLIGVTGQDEAADSLANSLQ--AAGVRSVFQRIAHQPTIV
HLDE_PSEPK      DRPGGAANVALNIAALGAPASLIGVTGQDEAADSLANSLQ--AAGVRSVFQRIAHQPTIV
HLDE_PSEPG      DRPGGAANVALNIAALGAPASLIGVTGQDEAADSLANSLQ--AAGVRSVFQRIAHQPTIV
HLDE_PSEE4      DRPGGAANVALNIAALGAPASLVGVTGQDEAADSLANSLQ--AAGVRSIFQRIAHQPTIV
HLDE_PSEF5      DRPGGAANVALNIAALGAPASLVGVTGDDEAADSLANSLQ--GAGVRALFQRIKHQPTIV
HLDE_PSEPF      DRPGGAANVALNIAALGAPASLVGVTGDDEAADSLSNSLK--GAGVRALFQRIAHQPTIV
HLDE_PSEU2      DRPGGAANVALNIAALGAPASLVGVTGDDEAAESLTNSLK--AAGVLARFQRIADQPTIV
HLDE_PSESM      DRPGGAANVALNIAALGAPASLVGVTGDDEAAESLTNSLK--AAGVVARFQRIADQPTIV
HLDE_PSE14      DRPGGAANVALNIAALGAPASLVGVTGDDEAAESLANSLK--AAGVLARFQRIANQPTIV
HLDE_PSEU5      DRPGGAANVALNIAALGAPAALVGVTGEDEARQSLVDSLA--AAGVRAHFQCLEHQPTIV
HLDE_HAHCH      DRPGGAANVALNIAALGSAAVILGVTGKDEAAQSLAARME--SAGILADFQEHETLPTIT
HLDE_ALCBS      DRPGGAANVALNMAALGARAELVGVTGRDEAASILEERLA--AAEVGCHFQKVDGLPTIT
HLDE_ALKEH      QRPGGAGNVALNVAALGGQPELVGITGQDEAANELASLLE--NAGVACHFRRQPGAATIT
HLDE_HALHL      ERPGGAANVALNVAALGGEAQVVGPTGSDEAADRLAELLE--AAGVGQRFHRIAGADTIT
HLDE_NITOC      DRPGGAGNVAVNVAALGAEVTLLGLIGADEAAAALRSLLA--HRGVHCCLEGLPNIATLT
HLDE_COXBU      ARPGGAANVALNVAALGASVELMGVVGDDQESRELETLLN--KKSINCHFHRLNDHPTVT
HLDE_COXBR      ARPGGAANVALNVAALGASVELMGVVGDDQESRELETLLN--KKSINCHFHRLNDHPTVT
HLDE_COXBN      ARPGGAANVALNVVALGASVELMGVVGDDQESRELETLLN--KKSINCHFHRLNDHPTVT
HLDE_METCA      ERIGGAGNVALNLAALGGEVDLLGYAGEDEAAAALERLLA--VAGIRSHIERCPAVATIT
HLDE_MARMS      DRPGGAANVALGLAKLGVSVTLVGVVGNDENADVLARCLE--DAGVICRFVRSETLPTIT
HLDE_HYDCU      VRAGGAANVALNIADLGADVNLMGVIGQDSFGQQLNQVLE--QAGVASNWVYSES-GTIC
HLDE_DICNV      ATAGGAANVAMNIAALGGQVYLCGLIGDDDAGAVLRQIMR--EHAIGDAL-SVCALPTIT
HLDE_MARHV      DRAGGAANVARNIAHLDGQAAILGIIGNDTDGRLLKDLLI--KEKVHSELLELDDARTIS
HLDE_PSEHT      DKAGGAANVAKNIARLDGKVGLLGLIGEDEGGQILEGILE--GEKINSQLVSVCDLPTIS
HLDE_STRCO      IRPGGAALAAYLAARDGREVTLIAGVGEDPAGLALRELLA----PWLKLIPLPLTGTVPE
                   **   .              .  * .     .   .                     

HLDE_MAGSA      KTRFFAS--HQQLLRADRESRSPVGEAIRAQLLTRIERLLP---KAGVMVLSDYGKGVLA
HLDE_RHORT      KTRFFAG--SQQLLRADDETIAPLDPYDADRLLGDVRSQIT---TVGALVLSDYGKGVLD
HLDE_PARL1      KTRFVAM--SQQILRADRETTQPLDAASAERLLAALTSALK---DRQVLVLSDYGKGVLT
HLDE_ACICJ      KTRYIAA--GQHLIRADRELVMPLTDKLGERLLKIASDAMA---ATSVTVLSDYRKGVLA
HLDE_RHILO      KSRFSAL--NQQVLRFDEEEIKPLDETERAGLIRHFRAALA---GAEIVILSDYGKGILL
HLDE_CAUVC      KVRYISG--SHQMLRVDREDR---SPGDGAALLAAFETRLA---SADVVVLSDYAKGVLT
HLDE_CAUSK      KTRYISG--SHQMLRADREDR---GEADGVALLAAFNAHLR---EVDVVVLSDYAKGVLT
HLDE_BRASB      KVRFVSEHFSAHMLRADWERAAPASGEIEQRLIDAIVPRLA---RADIVLLSDYAKGVLT
HLDE_BRASO      KVRFVSEHFSTHMLRADWERAAPASEDIEQKLIAAILPLIA---RADIVLLSDYAKGVLT
HLDE_RHOPS      KVRFVSEHFSTHMLRADWETASAASSEIEQRLLDAILPQLQ---RADIVLLSDYAKGVLT
HLDE_RHOP2      KVRFVSEHFSTHMLRADWETAAAASAEIEQRLLDAILSQLE---RADIVLLSDYAKGVLT
HLDE_RHOPA      KVRFVSEHFSTHMLRADWETASPAAADIEQRLLDAILPQLA---RADIVLLSDYAKGVLT
HLDE_RHOP5      KVRFVSEHFSTHMLRADWEVAAPASAAVEQQLIDAVLKQLP---AADIVLLSDYAKGVLT
HLDE_RHOPB      KVRFVSAHFSTHMLRADWEIAAPASLMVEQQLIDAILQQLP---AADIVLLSDYAKGVLT
HLDE_BRADU      KVRFVSEHFSTHMLRADWEQAQPASDEVEAKLIEAILPQIA---RADIVLLSDYAKGVLT
HLDE_NITHX      KVRFVSDHFSTHMLRADWETPAPASGVVEQALIDAILPQLP---RADIVLLSDYAKGVLT
HLDE_NITWN      KVRFVSEHFSTHMLRADWETLAPASGEVEQALIDAILPQLP---CADIVLLSDYAKGVLT
HLDE_HYPNA      KCRFVAG--GHQLLRVDTENVAPVSEATEEELIGILSREAP---GSAAILISDYAKGLLT
HLDE_AZOC5      KTRVMSG--RQQIVRIDAEVTRACDAAEEAALIGAAEAAIA---KAGVVVLSDYAKGVLS
HLDE_GLUOX      KTRVVSG--RQQIVRIDVEKLTPLSETLQQRLVEEACRAIA---VSDVLVCSDYAKGVLT
HLDE_GLUDA      KTRFIAA--NQQVVRADEESRLALQPDEATSLIAAIDAHIG---AADIVVLSDYAKGTCA
HLDE_GRABC      KTRFLAA--QQQVVRTDDESHLPTQPAEEMLLQTMVATHIT---ECGAVILSDYGKGVLS
HLDE_MAGMM      KTRVIGG--HQQILRMDRETPLADTAHASQLLHQQVMPMLEGEQRPHVIILSDYAKGVLS
HLDE_METFK      KTRILGG--HQQMMRLDQEDAAALSAEEQLALQTAIAAAL--TDRPAAIILSDYAKGVLS
HLDE_KORVE      KLRILSG--RQQMLRLDNERAESRPSTAYQKLIERALHHLP---QSDALILSDYAKGVLL
HLDE_ARCB4      KSRLIAS--QQQVLRYDMESIDDINEESHKKIISNLEKNIK---KYSSIILSDYGKGVLT
HLDE_SULDN      KSRVIAA--SQQILRYDKESKEEISKSSIEVILNSLAKDIS---RYDAVVLSDYSKGVLT
HLDE_NITSB      KSRIIAS--NQQIVRVDREEKKEIESLTQQKILNVFDRVIK---EYDLVLLSDYDKGVLT
HLDE_HELHP      KTRVIIA--NQQVLRVDRESKTPIDSHIHNNIVQHLHAVLD---EVDCIIISDYGKGLLN
HLDE_WOLSU      KSRIIAS--NQQVVRVDWENKSPISEESEEAMIAYIRSKLS---LCDAVILSDYGKGVLT
HLDE_HELPY      KTRIIAQ--NQQIARVDKEIKDPLNADLRKKLLDFFTEKIQ---EIDGVILSDYNKGVLD
HLDE_HELPH      KTRIIAQ--NQQIVRVDKEIKDPLNADLRKKLLDFFTEKIQ---EIDGVILSDYNKGVLD
HLDE_HELPJ      KTRIIAQ--NQQIVRVDKEIKDPLNADLRKNLLDFIAEKIQ---EIDGVILSDYNKGVLD
HLDE_HELAH      KTRIIVQ--NQQIVRVDKEIKDPLNADLRKNLLDFVAEKIQ---EMDGIILSDYNKGVLD
HLDE_CAMC1      KSRIMAS--HQQVVRIDKESVVKIN--LEDELVLKVKENLA---NFKAVLLSDYGKGVLS
HLDE_CAMC5      KSRVMAS--HQQVVRIDKESAVKIN--LESELVQKVTENLK---NFSVVLLSDYGKGVLS
HLDE_CAMFF      KSRIMVA--HQQVLRLDTESVCEIG--VSDDIISKFENILS---GYDIVLLSDYGKGVLS
HLDE_CAMJE      KNRIMAH--NQQVLRLDEEDISEIL--LENELIALFDEKIK---DFKAVVLSDYAKGVLT
HLDE_CAMJJ      KNRIMAH--NQQVLRLDEEDTSAIL--LENELIALFDEKIK---DFKAVVLSDYAKGVLT
HLDE_CAMJ8      KNRIMAH--NQQVLRLDEEDISAIL--LENELIALFDEKIK---DFKAVVLSDYAKGVLT
HLDE_CAMJD      KNRIMAH--NQQVLRLDEEDTSEIL--LENELIALFDEKIK---DFKAVVLSDYAKGILT
HLDE_CAMJR      KNRIMAH--NQQVLRLDEEDISEIL--LENELIALFDEKIK---DFKAVVLSDYAKGILT
HLDE_GEOMG      KTRVVAA--NQQIVRIDRESRDPIGAGYEEKIVGFLREQGS---RFNVILISDYLKGVLT
HLDE_GEOSL      KTRVLAS--NQQIVRIDRESRDEIGPDNERRIVDYLNAHGD---RFNVILVSDYLKGVLT
HLDE_GEOUR      KTRVIAA--NQQIVRIDRESRDEISLEFEEKVLDFIAAEAA---RFNVILVSDYLKGVLT
HLDE_PELPD      KTRVVAA--HQQIVRIDRESRVPLSAEVERRVSDWITANAG---GFDVILLSDYQKGVLT
HLDE_PELCD      KTRILAS--GQQMMRFDRESRCPIDATQEAVLAEFVSNSAD---RFDVILVSDYLKGVLT
HLDE_ECOLI      KLRVLSR--NQQLIRLDFEEG--FEGVDPQPLHERINQALS---SIGALVLSDYAKGALA
HLDE_ECOHS      KLRVLSR--NQQLIRLDFEEG--FEGVDPQPLHERINQALS---SIGALVLSDYAKGALA
HLDE_ECO24      KLRVLSR--NQQLIRLDFEEG--FEGVDPQPLHERINQALS---SIGALVLSDYAKGALA
HLDE_ECOL5      KLRVLSR--NQQLIRLDFEEG--FEGVDPQPLHERINQALS---SIGALVLSDYAKGALA
HLDE_SHIBS      KLRVLSR--NQQLIRLDFEEG--FEGVDPQPLHERINQALS---SIGALVLSDYAKGALA
HLDE_ECO57      KLRVLSR--NQQLIRLDFEEG--FEGVDPQPLHERINQALS---SIGALVLSDYAKGALA
HLDE_SHISS      KLRVLSR--NQQLIRLDFEEG--FEGVDPQPLHERINQALS---SIGALVLSDYAKGALA
HLDE_SHIFL      KLRVLSR--NQQLIRLDFEEG--FEGVDPQPMHERINQALS---SIGALVLSDYAKGALA
HLDE_SHIF8      KLRVLSR--NQQLIRLDFEEG--FEGVDPQPLHERINQALS---SIGALVLSDYAKGALA
HLDE_SHIDS      KLRVLSR--NQQLIRLDFEEG--FEGVDPQPLHERINQALS---SIGALVLSDYAKGALA
HLDE_ECOUT      KLRVLSR--NQQLIRLDFEEG--FEGVDPQPLHERINQALS---SIGALVLSDYAKGALA
HLDE_ECOK1      KLRVLSR--NQQLIRLDFEEG--FEGVDPQPLHERINQALS---SIGALVLSDYAKGALA
HLDE_ECOL6      KLRVLSR--NQQLIRLDFEEG--FEGVDPQPLHERINQALS---SIGALVLSDYAKGALA
HLDE_SALCH      KLRVLSR--NQQLIRLDFEEG--FEGVDPQPLHERINQALG---SIGALVLSDYAKGALT
HLDE_SALTI      KLRVLSR--NQQLIRLDFEEG--FEGVDPQPLHERINQALG---SIGALVLSDYAKGALT
HLDE_SALTY      KLRVLSR--NQQLIRLDFEEG--FEGVDPQPLHERINQALG---SIGALVLSDYAKGALT
HLDE_SALPA      KLRVLSR--NQQLIRLDFEEG--FEGVDPQPLHERINQALG---SIGALVLSDYAKGALT
HLDE_CITK8      KLRVLSR--NQQLIRLDFEEG--FEGVDPLPLHERINQALG---SIGALVLSDYAKGALA
HLDE_ENT38      KLRVLSR--NQQLIRLDFEEG--FEGVDPEPMHERIAQALG---SIGALVLSDYAKGALA
HLDE_CROS8      KLRVLSR--NQQLIRLDFEEG--FDGVDPEPLHERINQALG---QIGALVLSDYAKGALA
HLDE_KLEP7      KLRVLSR--NQQLIRLDFEEG--FSGVDPQPMHERIQQALG---SIGALVLSDYAKGALT
HLDE_PECAS      KLRVLSR--NQQLIRLDFEEG--FEGIDPQPIIERIQQALP---EIGALVLSDYAKGALA
HLDE_YERPE      KLRVLSR--NQQLIRLDFEEG--FDGVDPTPIFERIQLALP---QIGALVLSDYAKGALN
HLDE_YERPP      KLRVLSR--NQQLIRLDFEEG--FDGVDPTPIFERIQLALP---QIGALVLSDYAKGALN
HLDE_YERPA      KLRVLSR--NQQLIRLDFEEG--FDGVDPTPIFERIQLALP---QIGALVLSDYAKGALN
HLDE_YERPN      KLRVLSR--NQQLIRLDFEEG--FDGVDPTPIFERIQLALP---QIGALVLSDYAKGALN
HLDE_YERPS      KLRVLSR--NQQLIRLDFEEG--FDGVDPTPIFERIQLALP---QIGALVLSDYAKGALN
HLDE_YERP3      KLRVLSR--NQQLIRLDFEEG--FDGVDPTPIFERIQLALP---QIGALVLSDYAKGALN
HLDE_YERE8      KLRVLSR--NQQLIRLDFEEG--FDGVDPQPIFERIQQALP---QIGALVLSDYAKGALN
HLDE_SERP5      KLRVLSR--NQQLIRLDFEEG--FSNVDPQPLLERIQQALP---QIGALVLSDYAKGALS
HLDE_SODGM      KLRVLSR--NQQLIRLDFEQG--FDDVDAAPMIERIQLALP---KTGALVLSDYAKGALA
HLDE_PHOLL      KLRVLSR--NQQLIRLDFEEG--FDNVDAQPMFERIEQALP---HIGALVLSDYAKGALS
HLDE_ACTPL      KLRILSR--HQQLLRLDFEEG--FHHVASDSLLAKLEQEIT---AYGALILSDYGKGTLE
HLDE_ACTP2      KLRILSR--HQQLLRLDFEEG--FHHVASDSLLAKLEQEIT---AYGALILSDYGKGTLE
HLDE_HAEDU      KLRILSR--HQQLLRLDFEES--FHNVESSPLLAKLQQQIT---GYGALILSDYGKGTLA
HLDE_ACTSZ      KLRILSR--HQQLLRLDFEEN--FNNVHSDNLLTKLESAVK---NVGALILSDYGKGTLN
HLDE_MANSM      KLRILSR--HQQLLRLDFEED--FKNVQSTELLTKLENAVK---NFGALILSDYGKGTLN
HLDE_HAES1      KLRILSR--HQQLLRLDFEED--FNNITSADLLRKLESAVQ---NYGALILSDYGKGTLN
HLDE_PASMU      KLRILSR--HQQLLRLDFEED--FQNVTSDALLQKLDSALQ---NYGALVLSDYGKGTLN
HLDE_HAEI8      KLRILSR--HQQLLRLDFEED--FNNVDCKDLLAKLESAVK---NYGALILSDYGKGTLK
HLDE_HAEIE      KLRILSR--HQQLLRLDFEED--FNNVDCKDLLAKLESAVK---NYGALILSDYGKGTLK
HLDE_HAEIG      KLRILSR--HQQLLRLDFEED--FNNVDCKDLLAKLESAVK---NYGALILSDYGKGTLK
HLDE_HAEIN      KLRILSR--HQQLLRLDFEED--FNNVDCKDLLAKLESAVK---NYGALILSDYGKGTLK
HLDE_BLOFL      KLRVMSR--NQQMIRLDFEKK--FNNVNTDQLMNVIKVYLP---QYKVLALSDYAKGTLD
HLDE_BLOPB      KLRVMSR--NQQLIRLDFEQY--FNNVDTTKLLKQVELYLP---KYKVLVLSDYAKGSLN
HLDE_VIBCB      KLRVMSR--GQQLIRLDFEDK--FENTDAEPVLSRMETALP---SVKAVIMSDYAKGSLE
HLDE_VIBPA      KLRVMSR--GQQLIRLDFEDK--FENTDATPVLSRMDAALP---NVKAVIMSDYAKGSLE
HLDE_VIBVU      KLRVMSR--GQQLIRLDFEDK--FEGTDPELVLTRMERALP---HVQAVILSDYAKGALE
HLDE_VIBVY      KLRVMSR--GQQLIRLDFEDK--FEGTNPELVLTRMERALP---HVQAVILSDYAKGALE
HLDE_VIBC3      KLRVLSR--GQQLIRLDFEDK--FENTDAQLILSRMESALP---KVRAVILSDYAKGALE
HLDE_ALIF1      KLRVMSR--GQQLIRLDFEDS--FHDVAAEPIISRMQQALS---SVKAVVLSDYAKGALE
HLDE_PHOPR      KLRVMSR--GQQMIRLDFEEG--FHGVDKGLILPRLEQSLT---HVKTVILSDYAKGALE
HLDE_PSYIN      KLRVLSR--HQQLLRLDFEEG--FEGIDSTDILEKMHASLTR--QPSVVILSDYNKGSLA
HLDE_AERHH      KLRVLSR--NQQLLRLDFEEA--FHDVDSTLLMGKVEQALP---HSDVMILSDYGKGALN
HLDE_AERS4      KLRVLSR--NQQLLRLDFEEA--FHDVDSTLLMNKVEQALP---SSDVMILSDYGKGALN
HLDE_SHEB5      KLRVLSR--NQQLIRLDFEEA--FDKADSVRLLKQSEALLD---SVDVVVLSDYAKGAID
HLDE_SHEB9      KLRVLSR--NQQLIRLDFEEA--FDKADSVRLLKQSEALLD---SVDVVVLSDYAKGAID
HLDE_SHEB8      KLRVLSR--NQQLIRLDFEEA--FDKADSVRLLKQSEALLD---SVDVVVLSDYAKGAID
HLDE_SHEPC      KLRVLSR--NQQLIRLDFEEA--FDKADSVRLLKQSEALLD---SVDVVVLSDYAKGAID
HLDE_SHESW      KLRVLSR--NQQLIRLDFEEA--FDKADSVRLLKQSEALLD---SIDVVVLSDYAKGAID
HLDE_SHESM      KLRVLSR--NQQLIRLDFEES--FDKQDSARLLKQSEALLD---SVDVVVLSDYAKGAID
HLDE_SHESR      KLRVLSR--NQQLIRLDFEES--FDKQDSARLLKQSEALLD---SVDVVVLSDYAKGAID
HLDE_SHESA      KLRVLSR--NQQLIRLDFEES--FDKQDSARLLKQSEALLD---SVDVVVLSDYAKGAID
HLDE_SHEON      KLRVLSR--NQQLIRLDFEES--FDKQDSARLLKQSEALLD---SVDVVVLSDYAKGAID
HLDE_SHEDO      KLRVLSR--NQQLIRLDFEEE--FDSASSQALFKQSEAMLD---NVDVLVLSDYAKGAIA
HLDE_SHEFN      KLRVLSR--NQQLIRLDFEEQ--FDKATSQALFAQSEAILD---NVDVLVLSDYAKGAID
HLDE_SHEAM      KLRVLSR--NQQLIRLDFEEA--FDKHSSDALLNQAQARLD---DVDVVILSDYAKGAVG
HLDE_SHEHH      KLRVMSR--NQQLLRLDFEES--YTQAESEALLAKTLPELD---KVDVAVLSDYAKGAII
HLDE_SHEPA      KLRVMSR--NQQLLRLDFEES--YSQAESDALLAQSLSELD---KVDVAVLSDYAKGALI
HLDE_SHELP      KLRVMSR--NQQLIRLDFEEA--YPAEQSLALLASAEKELD---KVAVVVLSDYAKGAID
HLDE_SHESH      KLRVMSR--NQQLIRLDFEEA--YPEDESKALLTLSESALD---NVAVVVLSDYAKGAIT
HLDE_CHRSD      KLRVMSR--NQQLLRLDFEES--LWEIDTQGLTERVEAALP---EADVVILSDYGKGSLN
HLDE_PSEAE      KLRVMSR--HQQLLRVDFEEP--FRTDAAA-LAVDVESLLA---KVKVLVLSDYGKGALQ
HLDE_PSEAB      KLRVMSR--HQQLLRVDFEEP--FRTDAAA-LAVDVESLLA---KVKVLVLSDYGKGALQ
HLDE_PSEA7      KLRVMSR--HQQLLRVDFEEP--FRTDAAA-LALDVEALLD---QVKVLVLSDYGKGALQ
HLDE_PSEMY      KLRVMSR--HQQLLRMDFEEP--FNTDAAA-MAREVEALLA---GVKVLVLSDYGKGALQ
HLDE_PSEP1      KLRVMSR--HQQLLRIDFEEP--FATDPLS-LGAEVDSLLE---GVKVLVLSDYGKGALK
HLDE_PSEPK      KLRVMSR--HQQLLRIDFEEP--FATDPLS-LGAEVDSLLE---GVKVLVLSDYGKGALK
HLDE_PSEPG      KLRVMSR--HQQLLRIDFEEP--FATDPLS-LATEVDSLLE---GVKVLVLSDYGKGALK
HLDE_PSEE4      KLRVMSR--HQQLLRIDFEEP--FATDPLS-LGEEVEGLLE---GVKVLVLSDYGKGALR
HLDE_PSEF5      KLRVMSR--HQQLLRIDFEEP--FATDALA-LAAEVDALLD---GIKVLVLSDYGKGALR
HLDE_PSEPF      KLRVMSR--HQQLLRIDFEEP--FATDALA-LGAQVDDLLE---GIKVLVLSDYGKGALK
HLDE_PSEU2      KLRVMSR--HQQLLRIDFEEP--FRTDPLA-LSAEVYSLLD---GIKVLVLSDYGKGALK
HLDE_PSESM      KLRVMSR--HQQLLRIDFEEP--FNTDPLA-LSAEVYSLLD---GIKVLVLSDYGKGALK
HLDE_PSE14      KLRVISR--HQQLLRIDFEEA--FNTDPLA-LSAEVYSLLD---GIKVLVLSDYGKGALR
HLDE_PSEU5      KLRVMSR--HQQLLRMDFEEP--FDTDPAA-LLTDVESLLA---GVKVLVLSDYGKGALK
HLDE_HAHCH      KLRVISR--HQQLIRMDFEES--FAGVPQEQLEKKVAGQLA---GAGALVLSDYGKGALR
HLDE_ALCBS      KLRVISR--QQQLLRLDFEEA--FHSQDPAPFAEQVKQQLV---HCGALVLSDYAKGALR
HLDE_ALKEH      KLRVISR--HQQLIRLDFEDG--FPGAHARDLLPQYRPLLA---GCGAVVLSDYAKGALR
HLDE_HALHL      KLRVISR--HQQLIRLDFERG--FPGFDHAAMLALLEPALA---DAAVLVLSDYAKGALP
HLDE_NITOC      KLRVISR--HQQLIRLDFEDD--FIPAHGEALLPAYSTALR---GKSVVILSDYGKGTLQ
HLDE_COXBU      KLRVLGQ--NQQLLRLDFEKT--LKHYEDKGLLQRYQHSLS---HAQAVILSDYAKGALF
HLDE_COXBR      KLRVLGQ--NQQLLRLDFEKT--LKHYEDKGLLQRYQHSLS---HAQAVILSDYAKGALF
HLDE_COXBN      KLRVLGQ--NQQLLRLDFEKT--LKHYEDKGLLQRYQHSLS---HAQAVILSDYAKGALF
HLDE_METCA      KLRVVSR--QQQLIRLDFEDG--FAHLDPAPLVTRFRALLE---ETGVVVLSDYAKGTLA
HLDE_MARMS      KLRVMSR--HQQLIRLDFEER--EDSLSQNEALAKVVEECLP--KSDAVIFSDYAKGCLA
HLDE_HYDCU      KLRVLSH--HQQLIRMDFENA--VPELSA-KSLAKLVAEKVA--DYDVLVISDYAKGALQ
HLDE_DICNV      KLRVLSQ--HQQLIRLDFESN--RYAECAHLMAVPFNRALP---EHDLVIFSDYGKGSLH
HLDE_MARHV      KTRIISR--HQQMVRLDMEDT--FPVAQAESVKQRYAELIE---QYNTVIISDYAKGTLA
HLDE_PSEHT      KMRVISR--HQQVVRLDLEET--FTEQHSQLLLNRLELVLD---EYDFIVFSDYNKGSLS
HLDE_STRCO      KTRVLAQ--DRPVVRLDRGGG------RVREATDEARDALG---CARAVLVSDYGRGAAD
                * *         : * *                                  *** :*   

HLDE_MAGSA      EPIAIELIRRAKAAGKQVIVDPKGTDYTIYAGATVVTPNRKELHEATGQAVDSDEQVVAA
HLDE_RHORT      GPVAASLIAMGRTQNLPVIVDPKGRDFTRYRGATVLTPNRKELAEATGLPTGTDDEVVTA
HLDE_PARL1      PAFARGAIAAARAAGIPVIVDPKGRDYSLYAGASVVTPNRKELGEATGAAVDTDEEIVAA
HLDE_ACICJ      PTIARNLIASARSIGRTVIVDPKGADWSHYAEADVITPNRRELAEAVGRDLPDEAAIVGA
HLDE_RHILO      DGVAAELIAICREAGKPVLVDPKGRDYARYAGATAITPNRKELGEAVGHAVFADDEIVAA
HLDE_CAUVC      PAVVRGAIDAAKAAGKPVIVDPKSRDFARYDGATLIKPNRKEAAEATGIVETSDAASEDA
HLDE_CAUSK      PVVLRAAIAAANAAGKPVIVDPKSRDFSRYDGATLIKPNRREAAEATGVTGAGDEVAAEA
HLDE_BRASB      ARVLRNVIDAARRAGKRVIVDPKSANLAIYRGASVLTPNRKEFSEATRSRAETEQEIAAA
HLDE_BRASO      ARVLRNVIDATRRAGKRVIVDPKSANLAIYRGASVLTPNRKEFSEATRSRAETEQEIAAA
HLDE_RHOPS      ERVIVSVIEAARKLGKRVIVDPKSANFAIYRGATLLTPNRKEFVSATRSAAETVDDIAAA
HLDE_RHOP2      VRVIATVIEAARKLGKRVIVDPKSANFAIYRGATLLTPNRKEFVTATRCAADSMDEIATA
HLDE_RHOPA      ARVIRDTIDAAKKLGKRVIVDPKSANFAIYRGATLLTPNRKEFTAATRSAAATDDEIAAA
HLDE_RHOP5      ARLIRETIDAAKKLGKRVIVDPKSPNFALYRGATLLTPNRKEFCEATRSRADSAAEIATA
HLDE_RHOPB      ARLIREVIDAARKLNKRVIVDPKSPNFALYRGATLLTPNRKEFAEATRSRADSQAEIAAS
HLDE_BRADU      ARVIRHTIDAARKLGKPVIVDPKSLNWAIYRGATLLTPNRKEFAEATRSRADTPQSIVDA
HLDE_NITHX      ARVIRDVIDAARGLGKRVIVDPKSANFGIYSGATLLTPNRKEFADATRSRADDQASIAAA
HLDE_NITWN      TRVIRSVIDGARRLGKRVIVDPKSADFGIYRGATLLTPNSKEFTDATGRRADDQASLAKA
HLDE_HYPNA      DRLLKAVTKLAADLNIPLIADPKGRDFARYGAVDILKPNAFELSAAVHRSISTDEEAALA
HLDE_AZOC5      DAVIAAAMAAAKARNVPVIVDPKRRTFEAYRGATLVTPNRRELAEATGLPDETDADAARA
HLDE_GLUOX      DEVLRAIIAAGREKGIPVIVDPKRHTFEAYAGATLVTPNRIEAQQASGLPARTDGEVLKV
HLDE_GLUDA      DPVIAHAIATARARGIAVFVDPKSRDFARYRGASCITPNARELAQATGLPIDTDAEIEQA
HLDE_GRABC      PAVIKHVIGLARQAGIPVFVDPKRLDFSVYAGATCITPNVKELSAAAHQRADDEASVIAA
HLDE_MAGMM      FELCQALIVRARNLGIPVLVDPKGRDYARYRHATALSPNRGELRGVTGVEDGDLNTLLDA
HLDE_METFK      ETLCQSIIAQATASGIPVLVDPKGRDYSKYHGATGLTPNKRETAEACHVAPHDDQALLAA
HLDE_KORVE      PEVCQTLIQAAAQRKIPVLVDPKNVDFSRYRGATTISPNLGELALAARVDLENLNDLLYA
HLDE_ARCB4      TKLTQDIINIANKNSVKVLVDPKGKDYSKYKGSYTLTPNKKEAQEATNIDIKDENSLINA
HLDE_SULDN      KELCQGVISTCSKNGIKVLVDPKGSDYSKYSGAYLLTPNKKEAIQATKIDIKDKQSLKEA
HLDE_NITSB      KEVTQTVIQRSS---VPVFVDPK-NDFEKYRGATLIKPNKKEASKAVGFLIKNEEDLKRA
HLDE_HELHP      DELTHFVIDYAKSKSKLVLCDPKGKDYSKYTGATLLTPNKKEAELATGITICDKDSLIKA
HLDE_WOLSU      PRVCQTIIQMAKTLQKRVLVDPKGRDYSKYRGASLLTPNKKEAKEATGIEINDEASLKKA
HLDE_HELPY      FELTQAMIALANQHHKLILCDPKGKDYSKYSHASLITPNRTELEHALHLKLDSHANLSKA
HLDE_HELPH      FELTQKMITLANQHHKLILCDPKGKDYSKYSHASLITPNRAELEHALHLKLDSHANLSKA
HLDE_HELPJ      FELTQTIITLANKHHKLILCDPKGKDYSKYSHASLITPNRAELEQALHLKLDSHANLSKA
HLDE_HELAH      FKITQTIIALANKHYKLILCDPKGKDYSKYSHASLITPNRFELEQALHLKLDGDANLLKA
HLDE_CAMC1      EKVCQEIINECVKLKIPVLIDPKGSDYSKYKNATLLTPNKKEASEATNLKIKDKAELEKA
HLDE_CAMC5      DKVCRDIINECVRLDIPVLIDPKGNDYSKYKNATLLTPNRKEASEATGIAIKNTIDLRAA
HLDE_CAMFF      PYLTKEIIRITKKSGKMVLIDPKGKDYSKYSGATLLTPNKKEASEALGFGINDEDDLKHA
HLDE_CAMJE      PKVCKAVIEKAKVLNIPVLVDPKGSDFNKYSGATLLTPNKKEALEALKFENLEGENLEKG
HLDE_CAMJJ      PKVCKAVIEKAKALNIPVLVDPKGSDFSKYSGATLLTPNKKEALEALKFENLEGKNLEKG
HLDE_CAMJ8      PKVCKAVIKKAKALNIPVLVDPKGSDFSKYSGATLLTPNKKEALEALKFENLEGENLEKG
HLDE_CAMJD      PKVCKALIKKAKALNIPVLVDPKGSDFSKYSGATLLTPNKKEALEALKFENLEGENLEKG
HLDE_CAMJR      PKVCKAVIKKAKALNIPVLVDPKGSDFSKYSGATLLTPNKKEALEALKFENLEGENLEKG
HLDE_GEOMG      PTLLAAVIAVARERKIPVVVDPKGNDYTKYRGATLLTPNRKEAEAASGIAIRDEASLCRA
HLDE_GEOSL      PTLLAEVIAFARKREIPVVVDPKGSDYAKYRGATVLTPNRKEAEAASGIAIRDDESLCRA
HLDE_GEOUR      PRVLEAVCAAGRRLGIPVVVDPKGSDYGKYRGATILTPNRKEAETASRMSIRTEEGLTRA
HLDE_PELPD      PGVISATLAAARPGAIPVLVDPKGTDFSRYSGATLLTPNRREAEAASGIAIHDIESLVRA
HLDE_PELCD      EDLLQSVIAVGKQKGIPVVIDPKGNDYAKYRGATLLTPNRKETEVASGISIVDEESLRLA
HLDE_ECOLI      S--VQQMIQLARKAGVPVLIDPKGTDFERYRGATLLTPNLSEFEAVVGKCKTEEEIVERG
HLDE_ECOHS      S--VQQMIQLARKAGVPVLIDPKSTDFERYRGATLLTPNLSEFEAVVGKCKTEEEIVERG
HLDE_ECO24      S--VQQMIQLARKAGVPVLIDPKGTDFERYRGATLLTPNLSEFEAVVGKCKTEEEIVERG
HLDE_ECOL5      S--VQQMIQLARKAGVPVLIDPKGTDFERYRGATLLTPNLSEFEAVVGKCKTEEEIVERG
HLDE_SHIBS      S--VQQMIQLARKAGVPVLIDPKGTDFERYRGATLLTPNLSEFEAVVGKCKTEEEIVERG
HLDE_ECO57      S--VQQMIQLARKAGVPVLIDPKGTDFERYRGATLLTPNLSEFEAVVGKCKTEEEIVERG
HLDE_SHISS      S--VQQMIQLARKAGVPVLIDPKGTDFERYRGATLLTPNLSEFEAVVGKCKTEEEIVERG
HLDE_SHIFL      S--VQQMIQLARKAGVPVLIDPKGTDFERYRGATLLTPNLSEFEAVVGKCKTEEEIVERG
HLDE_SHIF8      S--VQQMIQLARKAGVPVLIDPKGTDFERYRGATLLTPNLSEFEAVVGKCKTEEEIVERG
HLDE_SHIDS      S--VQQMIQLARKAGVPVLIDPKGTDFERYRGATLLTPNLSEFEAVVGKCKTEEEIVERG
HLDE_ECOUT      S--VQQMIQLARKAGVPVLIDPKGTDFERYRGATLLTPNLSEFEAVVGKCKTEEEIVERG
HLDE_ECOK1      S--VQQMIQLARKAGVPVLIDPKGTDFERYRGATLLTPNLSEFEAVVGKCKTEEEIVERG
HLDE_ECOL6      S--VQQMIQLARKAGVPVLIDPKGTDFERYRGATLLTPNLSEFEAVVGKCKTEEEIVERG
HLDE_SALCH      S--VQTMISLARQAGVPVLIDPKGTDFERYRGATLLTPNLSEFEAVAGKCKSEDELVERG
HLDE_SALTI      S--VQTMISLARQAGVPVLIDPKGTDFERYRGATLLTPNLSEFEAVAGKCKSEDELVERG
HLDE_SALTY      S--VQTMISLARQAGVPVLIDPKGTDFERYRGATLLTPNLSEFEAVAGKCKSEDELVERG
HLDE_SALPA      S--VQTMISLARQAGVPVLIDPKGTDFERYRGATLLTPNLSEFEAVAGKCKSEDELVERG
HLDE_CITK8      S--VQQMIQLARKAGVPVLIDPKGTDFERYRGATLLTPNLSEFEAVAGKCKSEEEIVERG
HLDE_ENT38      S--VQQMIQLARKAGVPVLIDPKGTEFERYRGATLLTPNLSEFEAVAGKCKNEEEIVERG
HLDE_CROS8      S--VQQMIQLARKAGVPVLIDPKGTDFERYRGATLLTPNLSEFEAVAGKCKTEQDIVERG
HLDE_KLEP7      S--VQTMIRLAREAGVPVLIDPKGTDFERYRGATLLTPNLSEFEAVVGKCQDEAQIVERG
HLDE_PECAS      H--VQTMIQTAKAAGVPVLIDPKGTDFSRYRGATLLTPNLSEFEAVAGRSKTEEELVERG
HLDE_YERPE      S--VQPMIQLARKANVPVLIDPKGSDFERYRGATLLTPNLSEFEAVVGRCKNEEELVNRG
HLDE_YERPP      S--VQPMIQLARKANVPVLIDPKGSDFERYRGATLLTPNLSEFEAVVGRCKNEEELVNRG
HLDE_YERPA      S--VQPMIQLARKANVPVLIDPKGSDFERYRGATLLTPNLSEFEAVVGRCKNEEELVNRG
HLDE_YERPN      S--VQPMIQLARKANVPVLIDPKGSDFERYRGATLLTPNLSEFEAVVGRCKNEEELVNRG
HLDE_YERPS      S--VQPMIQLARKANVPVLIDPKGSDFERYRGATLLTPNLSEFEAVVGRCKNEEELVNRG
HLDE_YERP3      S--VQPMIQLARKANVPVLIDPKGSDFERYRGATLLTPNLSEFEAVVGRCKNEEELVNRG
HLDE_YERE8      S--VQTMIQLARKAKVPVLIDPKGSDFERYRGATLLTPNLSEFEAVVGHCKNEEELVSRG
HLDE_SERP5      Q--VQSMIQLARAAKVPVLIDPKGSDFERYRGATLLTPNLSEFEAVVGHCKDEAELVERG
HLDE_SODGM      R--VREMITLARAAGVPVLVDPKGTDFDRYRGATLLTPNLSEFEAVAGPCKDEETLVSRG
HLDE_PHOLL      Q--VQEMIKLANAAKVPVLIDPKGNDFERYRGATLLTPNLSEFEAVVGHCKDDNELVEKG
HLDE_ACTPL      S--VQQMIQVARKAGVPTLIDPKGTDFERYRGATLLTPNMSEFEAVVGHCKDDDEIVEKG
HLDE_ACTP2      S--VQQMIQVARKAGVPTLIDPKGTDFERYRGATLLTPNMSEFEAVVGHCKDDDEIVEKG
HLDE_HAEDU      A--VQQMIQIARQAKVPVLIDPKGTDFERYRGATLLTPNMAEFEAVVGACLNDNDIVSKG
HLDE_ACTSZ      D--VQHMIRIARQAKVPVLIDPKGTDFERYRGATLLTPNMSEFEAVAGVCQSDEDIVEKG
HLDE_MANSM      D--VQQMIQIARKAKVPVLIDPKGTDFERYRGATLLTPNMSEFEAVVGKCDTEEDIIEKG
HLDE_HAES1      D--VQKMIQIARKVNIPVLIDPKGTDFARYRSATLLTPNMSEFEAVVGKCHSEEEIAEKG
HLDE_PASMU      Q--VQKMIQLARQANIPVLIDPKGTDFERYRGATLLTPNMSEFEAVVGKCDSEEEIIEKG
HLDE_HAEI8      D--VQKMIQIARKANVPVLIDPKGTDFERYRGATLLTPNMSEFEAVVGKCNTEEEIIKKG
HLDE_HAEIE      D--VQKMIQIARKANVPVLIDPKGTDFERYRGATLLTPNMSEFEAVVGKCNTEEEIIKKG
HLDE_HAEIG      D--VQKMIQIARKANVPVLIDPKGTDFERYCGATLLTPNMSEFEAVVGKCNTEEEIIKKG
HLDE_HAEIN      D--VQKMIQIARKANVPVLIDPKGTDFERYRGATLLTPNMSEFEAVVGKCNTEEEIIEKG
HLDE_BLOFL      C--VEEIIKIARFFKIPIIIDPKGVQFSKYKGATILTPNMSEFEAIVGFCSNEEIIIKRA
HLDE_BLOPB      C--IEEIIKLARYMNVPVIVDPKGIQFSRYKGATLLTPNISEFESIVGSCRNEKILINRA
HLDE_VIBCB      H--VQAYIQKARAANIPVFIDPKGADFERYRGATLLTPNMKEFEDVVGKVKSDQELVEKA
HLDE_VIBPA      H--VQAYIQKARAANIPVFIDPKGADFERYRGATLLTPNMKEFEDVVGKVKSDQELVEKA
HLDE_VIBVU      H--VEALIAKARAANVPVFIDPKGTNFEPYRGATLLTPNMSEFEAVVGKVTSDDDLVEKA
HLDE_VIBVY      H--VEALIAKARAANVPVFIDPKGTNFEPYRGATLLTPNMSEFEAVVGKVTSDDDLVEKA
HLDE_VIBC3      H--VQQFIQKAKAAGVPVFIDPKGSDFERYRGASLLTPNMSEFEAVVGKVKSEQELVEKG
HLDE_ALIF1      H--VQLMIQEARKVNVPVFIDPKGADFERYRGATLLTPNMLEFETVVGKVKDEDDLVAKG
HLDE_PHOPR      H--VSAMIKLARDAGKPVFIDPKGTDFERYRGATLLTPNLSEFELVAGKVTSDDELVEKG
HLDE_PSYIN      D--VQKMIQLAKKFNSVVLVDPKGSEFEKYRGATLLTPNLAEFEAVVGKCHSEKELVERG
HLDE_AERHH      D--VPSMIQRARAAGIPVLVDPKGTDFEKYRGATLLTPNMSEFEAVVGKVKSEEELVAKG
HLDE_AERS4      D--VPGMIQRARAAGIPVLVDPKGTEFEKYRGATLLTPNMSEFEAVVGKVKGEEDLVAKG
HLDE_SHEB5      Q--PRDFIALARAKGVMVLVDPKGSDFGRYQGASLITPNMSEFEAVVGTVTSEADLLEKA
HLDE_SHEB9      Q--PRDFIALARAKGVMVLVDPKGSDFGRYQGASLITPNMSEFEAVVGTVTSEADLLEKA
HLDE_SHEB8      Q--PRDFIALARAKGVMVLVDPKGSDFGRYQGASLITPNMSEFEAVVGTVTSEADLLEKA
HLDE_SHEPC      Q--PRDFIALARSKGVMVLVDPKGSDFGRYHGASLITPNMSEFEAVVGTVTSEADLLEKA
HLDE_SHESW      Q--PRDFIALARSKGVMVLVDPKGSDFGRYHGASLITPNMSEFEAVVGTVTSEADLLEKA
HLDE_SHESM      K--PQDFIALARAKGVKVLVDPKGSDFSRYHGASLITPNMSEFEAVVGAVTSEADLLEKA
HLDE_SHESR      K--PQDFIALARAKGVKVLVDPKGSDFSRYHGASLITPNMSEFEAVVGAVTSEADLLEKA
HLDE_SHESA      K--PQDFIALARAKGVKVLVDPKGSDFSRYHGASLITPNMSEFEAVVGAVTSEADLLEKA
HLDE_SHEON      N--PRDFIALARSKGVKVLVDPKGSDFSRYHGASLITPNMSEFEAVVGAVTSEADLLEKA
HLDE_SHEDO      D--PRAFIAKARAKGVTVLVDPKGSDFARYHGASLITPNMSEFEAVVGPVKDEADLIEKA
HLDE_SHEFN      E--PKDFIAKARAKGVKVLVDPKGHDFARYHGASLITPNMSEFEAVVGTVTSEDDLIEKA
HLDE_SHEAM      E--PADFIASARAKGVKVLVDPKGSDFARYRGATLLTPNMSEFEAVVGTVTSEADLVDKA
HLDE_SHEHH      S--PQSFIQAANAKGVKVLVDPKGSDFSKYRGAYLLTPNMSEFEVVVGKVESEADLVAKA
HLDE_SHEPA      S--PQSFIEAANAKGVKVLVDPKGSDFSKYRGAYLLTPNMSEFEVVVGKVESEADLVAKA
HLDE_SHELP      K--PEAFIAKAKAKGVKVLVDPKGSDFSRYRGATLLTPNMSEFEQVVGKVADEADLVTKA
HLDE_SHESH      Q--PQEFIQKAIAKGVKVLVDPKGSDFSRYRGASLITPNMGEFEEVVGSVSSEAELVEKA
HLDE_CHRSD      R--VETLIATARGAGKRVLVDPKGHDFAKYRGASIITPNLGEFEAVVGPCPDDATLAEKG
HLDE_PSEAE      N--HQVLIQAARARNIPVLADPKGKDFAIYRGASLITPNLSEFETIVGRCADEAELVAKG
HLDE_PSEAB      N--HQVLIQAARARNIPVLADPKGKDFAIYRGASLITPNLSEFETIVGRCADEAELVAKG
HLDE_PSEA7      N--HQVLIQAARARNIPVLADPKGKDFAIYRGASLITPNLSEFETIVGRCADEAELVAKG
HLDE_PSEMY      N--HQVLIQAARKKGIPVLADPKGKDFSIYRGASLITPNLHEFETIVGGCADEAELVSKG
HLDE_PSEP1      N--HQNLIQAARAKGIPVLADPKGKDFSIYRGASLITPNLSEFETIVGRCVDEAELVAKG
HLDE_PSEPK      N--HQNLIQAARAKGIPVLADPKGKDFSIYRGASLITPNLSEFETIVGRCVDEAELVAKG
HLDE_PSEPG      N--HQSLIQAARAKGIPVLADPKGKDFSIYRGASLITPNLSEFETIVGRCTDEADLVAKG
HLDE_PSEE4      N--HQALIQAARQKQIPVLADPKGKDFSIYRGASLITPNLSEFEAIVGRCADEAELVAKG
HLDE_PSEF5      N--HQVLIAAARARGIPVLADPKGKDFSIYRGASLITPNLSEFETIVGGCADEHELVSKG
HLDE_PSEPF      N--HQALIQAARAKGIPVLADPKGKDFSIYRGASLITPNLSEFEAIVGGCADEHELVTKG
HLDE_PSEU2      N--HQALIQAARKRGIPVLADPKGKDFAIYRGASLITPNLSEFEAIVGHCVDEAQLVTKG
HLDE_PSESM      N--HQALIQAARKRGIPVLADPKGKDFAIYRGASLITPNLSEFEAIVGHCEDEAQLVTKG
HLDE_PSE14      N--HQALIQAARKRGIPVLADPKGKDFTIYRGASLITPNLSEFEAIVGHCEDEAQLVTKG
HLDE_PSEU5      N--HQALIQAARRHGIPVLADPKGKDFEIYRGASLITPNLGEFEAIVGHCADEAELVAKG
HLDE_HAHCH      D--PQAFIQLARSKQIPVLVDPKGSDFEKYRGATLITPNLSEFEAVVGHCTSEAELVQRG
HLDE_ALCBS      D--CPGLIALAREAGVPVLVDPKGTDFEPYRGATLLTPNLSEFEAVVGVVKDEQDLIAKG
HLDE_ALKEH      D--PRPLIEAAREAGVPVLADPKGRDFSIYRGATLITPNLAEFEAVVGRCADEDTLVRRG
HLDE_HALHL      D--PAGLIEAARRAGRPVLVDPKGADYRRYRGASLLTPNLAEFEAVVGPCADGDEIAKRA
HLDE_NITOC      E--PQRLIALGREVGVPILIDPKGADFSHYHGATIITPNLAEFEMVVGPCPDEASLVWKG
HLDE_COXBU      N--VTAPIQRAREKGLPVLVDPKSVDFSRYAGATLLTPNLKEFEAVVGHCRTDQELEFKA
HLDE_COXBR      N--VTAPIQRAREKGLPVLVDPKSVDFSRYAGATLLTPNLKEFEAVVGHCRTDQELEFKA
HLDE_COXBN      N--VTALIQRAREKGLPVLVDPKSVDFSRYAGATLLTPNLKEFEAVVGHCRTDQELESKA
HLDE_METCA      C--VEEFIAASRRAGKPVLVDPKGVDFDRYRGATLLTPNLSEFEAVVGACCDDAEIERKG
HLDE_MARMS      D--VQSLIKLSNAAKVPSFVDPKGNDFSIYQGATLVKPNLLEFETIVGKCSSTKELEEKA
HLDE_HYDCU      F--VEEMIQAAKSQQVPVLIDPKGNDFSRYAGATLVKPNQGEFELIVGVCADQDDLIEKA
HLDE_DICNV      N--VSALIAQAKAAGKWVLVDPKGTDFQRYRGADIVTPNVAELTAVVGHFADEKTMIAKA
HLDE_MARHV      C--VGDLIQAARKAGKQVLVDPKSKDFSLYRGATVITPNLSEFKAAGGDASSDDAMLSSA
HLDE_PSEHT      L--IENMISLAKKAGKTVLVDPKSSDLHLYRGADYITPNLNEFKLAGGQTDSEEGLATSA
HLDE_STRCO      A------LRDVLAARPPLVWDPHPRGGPPVPGTRLVTPAEKEAHGFAPSEGRPGGGLRAA
                                  . **:            :.*   *                  

HLDE_MAGSA      ARQLID-SCGFEAVLVTRSQDGMTLVRADG------QIDHLPAEAREVFDVSGAGDTVVA
HLDE_RHORT      CRQVIA-RCGVDTVLATRSQDGMTLVGADG------SVLHLPAEAREVYDVSGAGDTVVA
HLDE_PARL1      ARALMK-AHDIGAVVVTRAQAGMSVITADG------AVTHLKAEAREVFDVSGAGDTVVS
HLDE_ACICJ      AREVIG-RFGFGAVLCTRSEDGMSLVTVD-------TVRHYPAEAAEVYDVSGAGDTVVA
HLDE_RHILO      ARELIS-AHGFDFVVATRSEKGMSVVGPD-------EARHIATQAREVFDVSGAGDTVIA
HLDE_CAUVC      GAAILAMAPGLQAALITRGGAGMTLAVRNQ------PPIHLPATAIEVFDVSGAGDTVAA
HLDE_CAUSK      ADAILSTAPNLAAALITRGRAGMTLAVRGE------APVHLPATALEVFDVSGAGDTVAA
HLDE_BRASB      AQDAIY-LADCEAILVTQSERGMTLVPRQG------DAIHVPAYPVKVRDVSGAGDTVVA
HLDE_BRASO      AQDAIY-LADCEAILVTQSERGMTLVPRQG------DPIHVPAYPVKVRDVSGAGDTVVA
HLDE_RHOPS      AQDAMA-LADCEAMLVTQSEHGMTLVPRVG------EPIHVPAMPVKVRDVSGAGDTVAA
HLDE_RHOP2      AQEAIA-FADCEAMLVTQSEHGMTLVPRAG------EPIHVPAMPAKVRDVSGAGDTVAA
HLDE_RHOPA      AQDAMA-LAECEAMLVTKSEHGMTLVPRGG------EPIHVPALPVKVRDVSGAGDTVAA
HLDE_RHOP5      AREAMD-VADCEALLVTQSERGMTLVVREG------EAIHVPAHPVKVRDVSGAGDTVAA
HLDE_RHOPB      AREAIA-VADCEAILVTQSEQGMTLVPRDG------EAIHVPAHPVKVRDVSGAGDTVAA
HLDE_BRADU      SEDVMR-LADCEAILVTQGEHGMTLVPRNG------AAVHVPAVPVKVRDVSGAGDTVAA
HLDE_NITHX      AREVMR-LVDGEALLVTQSEHGMTLVPREG------EVIHVPAHTVKVRDVTGAGDTVVA
HLDE_NITWN      ARDLMR-IAECEALLVTQSERGMTLVPGEG------EVIHVPAHTVKVRDVTGAGDTVVA
HLDE_HYPNA      LREALD-TLPAKAIIVTRAARGISYIGQDG------NVHHEAGRAREVFDVSGAGDTSLA
HLDE_AZOC5      AEAAGR-QFGG-DVLVTRAEKGMTLWRQDG------RVLHVPAEAREVFDVSGAGDTALA
HLDE_GLUOX      AETLSG-QFGG-NVLVTRSEDGMTLWQHDA------KPLHVASRKSEVFDVSGAGDTVVA
HLDE_GLUDA      ARAAMA-RADAVAILATRSEKGMALVEREG------GVQIVPARAREVFDVSGAGDTVIA
HLDE_GRABC      ARIVMQ-QAEGASILATRSEKGMMLIEAPAEGRDDIAIHTVPARAREVFDVSGAGDTVIA
HLDE_MAGMM      GESLRQ-SLDVAFLAVTLSEQGIALVDGSE------HPRRIPAMAQEVYDVSGAGDTVIA
HLDE_METFK      AEQLRH-TLKLDFLAVTRGEEGITVLD-RQ------GSAHLAATARQVYDVSGAGDTVIA
HLDE_KORVE      AQQMVR-NLGLSFLTATLGEKGIALVT-RD------KTTISAAVARQVFDVSGAGDAVIA
HLDE_ARCB4      LKDLKE-KCDLEVSLITLSEQGIAIFDE--------NLTIKPTVAREVYDVTGAGDTVIA
HLDE_SULDN      LLKMKK-DANLAISLITLSEDGVAIYDD--------EMKIFPTVAKEVFDVTGAGDTVIA
HLDE_NITSB      GWKLKK-ELDLQSLIVTLSEEGMAIFEE--------EMMRIPTVAKEVYDVTGAGDTVLA
HLDE_HELHP      GMTLKT-QCQLDISLITLSEDGIGIFDNN-------QIHIIPTRAKEVYDVTGAGDTVIA
HLDE_WOLSU      LECLKK-ECELEFSVITLSEDGIGIFDQ--------ALERIPTIAQEVYDVTGAGDTVIA
HLDE_HELPY      LQILKE-TYHIAMPLVTLSEQGIAFLEKG-------ELVNCPTIAKEVYDVTGAGDTVIA
HLDE_HELPH      LQILKE-TYQIAMPLVTLSEQGIAFLEKG-------ELVNCPTIAKEVYDVTGAGDTVIA
HLDE_HELPJ      LQILQE-TYHIAMPLVTLSEQGIAFLEKG-------ELVNCPTIAKEVYDVTGAGDTVIA
HLDE_HELAH      LQILQE-TYHIAMPLVTLSEQGIAFLEKN-------ELINCPTIAKEVYDVTGAGDTVIA
HLDE_CAMC1      IKQLKE-ELNLTYSIITISEEGIALYDD--------KLHIFAAKAKEVFDVTGAGDTVLA
HLDE_CAMC5      IMKLKN-ELNLKYSIVTLSEEGIALFDK--------ELEIFPAEAKEVFDVTGAGDTVLA
HLDE_CAMFF      LKMLKD-KFKLNYSLITLSEDGIALLDE--------DVKKFPALAKEVFDVTGAGDSVLA
HLDE_CAMJE      IKKLKE-DFSLRYSIITLSEAGIALFDE--------GLKIAPAKALEVYDVTGAGDSVIA
HLDE_CAMJJ      IKKLKE-DFALRYSIITLSEAGIALFDE--------NLKIAPAKALEVYDVTGAGDSVIA
HLDE_CAMJ8      IKKLKE-DFALRYSIITLSEAGIALFDE--------GLKIAPAKALEVYDVTGAGDSVIA
HLDE_CAMJD      IKKLKE-DFALRYSIITLSEAGIALFDK--------SLKIAPAKALEVYDVTGAGDSVIA
HLDE_CAMJR      IKKLKE-DFSLRYSIITLSEAGIALFNE--------GLKIAPAKALEVYDVTGAGDSVIA
HLDE_GEOMG      GERLLA-TADLTALVITRSEEGMSLFLRDG------GVVHIPTFAREVFDVTGAGDTVLA
HLDE_GEOSL      GERLLE-TADLTALVITRSEEGMSLFLRGG------QVVHIPTYAREVFDVTGAGDTVLA
HLDE_GEOUR      AETLLA-GLELDALLITRSEEGMSLFMQDG------RTVHIPTVAREVYDVTGAGDTVLS
HLDE_PELPD      AGVIME-RVGLEHLLITRSEEGMSLFSRSA------APMHIPTVAREVFDVSGAGDTVLA
HLDE_PELCD      ARTLMQ-RIDLETLMVTRSEEGISIFFRNG------EEVHLPTQAREVYDVTGAGDTVLS
HLDE_ECOLI      MKLIAD--YELSALLVTRSEQGMSLLQPG------KAPLHMPTQAQEVYDVTGAGDTVIG
HLDE_ECOHS      MKLIAD--YELSALLVTRSEQGMSLLQPG------KAPLHMPTQAQEVYDVTGAGDTVIG
HLDE_ECO24      MKLIAD--YELSALLVTRSEQGMSLLQPG------KAPLHMPTQAQEVYDVTGAGDTVIG
HLDE_ECOL5      MKLIAD--YELSALLVTRSEQGMSLLQPG------KAPLHMPTQAQEVYDVTGAGDTVIG
HLDE_SHIBS      MKLIAD--YELSALLVTRSEQGMSLLQPG------KAPLHMPTQAQEVYDVTGAGDTVIG
HLDE_ECO57      MKLIAD--YELSALLVTRSEQGMSLLQPG------KAPLHMPTQAQEVYDVTGAGDTVIG
HLDE_SHISS      MKLIAD--YELSALLVTRSEQGMSLLQPG------KAPLHMPTQAQEVYDVTGAGDTVIG
HLDE_SHIFL      MKLIAD--YELSALLVTRSEQGMSLLQPG------KAPLHMPTQAQEVYDVTGAGDTVIG
HLDE_SHIF8      MKLIAD--YELSALLVTRSEQGMSLLQPG------KAPLHMPTQAQEVYDVTGAGDTVIG
HLDE_SHIDS      MKLIAD--YELSALLVTRSEQGMSLLQPG------KAPLHMPTQAQEVYDVTGAGDTVIG
HLDE_ECOUT      MKLIAD--YELSALLVTRSEQGMSLLQPG------KAPLHMPTQAQEVYDVTGAGDTVIG
HLDE_ECOK1      MKLIAD--YELSALLVTRSEQGMSLLQPG------KAPLHMPTQAQEVYDVTGAGDTVIG
HLDE_ECOL6      MKLIAD--YELSALLVTRSEQGMSLLQPG------KAPLHMPTQAQEVYDVTGAGDTVIG
HLDE_SALCH      MKLIAD--YDLSALLVTRSEQGMTLLQPN------KAPLHMPTQAQEVYDVTGAGDTVIG
HLDE_SALTI      MKLIAD--YDLSALLVTRSEQGMTLLQPN------KAPLHMPTQAQEVYDVTGAGDTVIG
HLDE_SALTY      MKLIAD--YDLSALLVTRSEQGMTLLQPN------KAPLHMPTQAQEVYDVTGAGDTVIG
HLDE_SALPA      MKLIAD--YDLSALLVTRSEQGMTLLQPN------KAPLHMPTQAQEVYDVTGAGDTVIG
HLDE_CITK8      MKLIAD--FEFSALLVTRSEQGMTLLQPG------KAPLHMPTQAQEVYDVTGAGDTVIG
HLDE_ENT38      MKIIAD--FDFSALLVTRSEQGMTLLQPG------KPPLHMPTQAQEVYDVTGAGDTVIG
HLDE_CROS8      MKIIAD--FDLSALLVTRSEQGMTLLQPG------KAPFHLPTQAQEVYDVTGAGDTVIG
HLDE_KLEP7      MKLIAE--FELSALLVTRSEQGMTLLQPG------RPPLHMPTQAQEVYDVTGAGDTVIG
HLDE_PECAS      MQLVAD--YELSALLITRSEQGMTLLQPG------KAPLHLPTLAQEVYDVTGAGDTVIG
HLDE_YERPE      MQLVAD--FELSALLVTRSEQGMTLLQLG------KPPLHLPTQAKEVFDVTGAGDTVIG
HLDE_YERPP      MQLVAD--FELSALLVTRSEQGMTLLQLG------KPPLHLPTQAKEVFDVTGAGDTVIG
HLDE_YERPA      MQLVAD--FELSALLVTRSEQGMTLLQLG------KPPLHLPTQAKEVFDVTGAGDTVIG
HLDE_YERPN      MQLVAD--FELSALLVTRSEQGMTLLQLG------KPPLHLPTQAKEVFDVTGAGDTVIG
HLDE_YERPS      MQLVAD--FELSALLVTRSEQGMTLLQLG------KPPLHLPTQAKEVFDVTGAGDTVIG
HLDE_YERP3      MQLVAD--FELSALLVTRSEQGMTLLQLG------KPPLHLPTQAKEVFDVTGAGDTVIG
HLDE_YERE8      MKLVAD--FELSALLVTRSEQGMTLLQPG------KPPLHLPTQAQEVFDVTGAGDTVIG
HLDE_SERP5      MKLVAD--FELSALLVTRSEHGMTLLQPG------IAPLHLPTLAQEVFDVTGAGDTVIG
HLDE_SODGM      MKLIAD--YQLSALLITRSEQGMTLLQPG------KDPLHLPTQAQEVYDVTGAGDTVIG
HLDE_PHOLL      TRLVKG--LDLQALLITRSEQGMSLLSVD------QPPLHLPTQAQEVFDVTGAGDTVIG
HLDE_ACTPL      LKLIAD--FELTALLVTRSEKGMTLLRPN------QAPFHLPTQAKEVYDVTGAGDTVIS
HLDE_ACTP2      LKLIAD--FELTALLVTRSEKGMTLLRPN------QAPFHLPTQAKEVYDVTGAGDTVIS
HLDE_HAEDU      LKLIND--LELSALLVTRSEKGMTLLRPN------HPPFHLPTQAKEVYDVTGAGDTVIS
HLDE_ACTSZ      LKMIAD--YDLTALLITRSEKGMTLLRPN------QPAFHLPTEAKEVYDVTGAGDTVIS
HLDE_MANSM      LKLIAD--IELSALLVTRSEKGMTLLRPG------QEAYHLPTEAKEVFDVTGAGDTVIS
HLDE_HAES1      LQLIKD--LDLSALLVTRSEKGMTLLRPN------NAPFHLPTEAKEVFDVTGAGDTVIS
HLDE_PASMU      LKLIEQ--IDLSALLVTRSEKGMTLLRPN------QPAFHLATEAKEVFDVTGAGDTVIS
HLDE_HAEI8      LKLISD--IELTALLVTRSEKGMTLLRPN------QEPYHLPTVAKEVFDVTGAGDTVIS
HLDE_HAEIE      LKLISD--IELTALLVTRSEKGMTLLRPN------QEPYHLPTVAKEVFDVTGAGDTVIS
HLDE_HAEIG      LKLISD--IELTALLVTRSEKGMTLLRPN------QEPYHLPTVAKEVFDVTGAGDTVIS
HLDE_HAEIN      LKLISD--IELTALLVTRSEKGMTLLRPN------QEPYHLPTVAKEVFDVTGAGDTVIS
HLDE_BLOFL      KELMNE--YDLLALLITRSDQGMTLLQRS------LDPLYFSAQSKEVYDVTGAGDTVVG
HLDE_BLOPB      QEIIID--YNLSALLITRSERGMTLCTRY------AAPLYFSTQKKKVYHVTGAGDTVVG
HLDE_VIBCB      LALVEE--FEFEALLVTRSENGMTLIRRG------QEPFHLPTQAKEVYDVTGAGDTVIS
HLDE_VIBPA      LALVKE--FDFEALLVTRSEHGMTLIRRG------QEPFHLPTQAKEVYDVTGAGDTVIS
HLDE_VIBVU      LGLIEK--FELGALLVTRSEHGMTLVRPD------QKPFHLPTQAKEVYDVTGAGDTVIS
HLDE_VIBVY      LGLIEK--FELGALLVTRSEHGMTLVRPD------QKPFHLPTQAKEVYDVTGAGDTVIS
HLDE_VIBC3      FALIEK--FDLGALLVTRSEHGMTLLRRG------LEPFHLPTQAKEVYDVTGAGDTVIS
HLDE_ALIF1      QQIIEE--FDFEALLVTRSEHGMTLLRRN------MEPLHLPTQAREVFDVTGAGDTVIS
HLDE_PHOPR      FELIER--FDFEALLVTRSEHGMTLLQKG------QAPLHLPTLAQEVYDVTGAGDTVIS
HLDE_PSYIN      LALIKE--LDLDALLVTRSEHGMTLLREG------QEPLHLPTQAQEVYDVTGAGDTVIS
HLDE_AERHH      LELVKR--FELEALLVTRSENGMTLIREG------QPELHLPAQAHEVYDVTGAGDTVIS
HLDE_AERS4      LALVKR--FELEALLVTRSENGMTLIREG------QPELHLPAQAHEVYDVTGAGDTVIS
HLDE_SHEB5      RGLLKQ--HHFDAILVTRSEKGMTLVTTN------APELHIPTVAREVYDVTGAGDTVIS
HLDE_SHEB9      RGLLKQ--HHFDAILVTRSEKGMTLVTAN------APELHIPTVAREVYDVTGAGDTVIS
HLDE_SHEB8      RGLLKQ--HNFDAILVTRSEKGMTLVTAN------APELHIPTVAREVYDVTGAGDTVIS
HLDE_SHEPC      RGLLKE--HHFDAILVTRSEKGMTLVTAN------APELHIPTVAREVYDVTGAGDTVIS
HLDE_SHESW      RGLLKE--HHFDAILVTRSEKGMTLVTAN------APELHIPTVAREVYDVTGAGDTVIS
HLDE_SHESM      RGLLNK--HQFDAILVTRSEKGMTLVTAN------APELHIPTVAREVYDVTGAGDTVIS
HLDE_SHESR      RGLLNK--HQFDAILVTRSEKGMTLVTAN------APELHIPTVAREVYDVTGAGDTVIS
HLDE_SHESA      RGLLNK--HQFDAILVTRSEKGMTLVTAN------APELHIPTVAREVYDVTGAGDTVIS
HLDE_SHEON      RGLLNK--YQFDAILVTRSEKGMTLVTAN------APELHIPTVAREVYDVTGAGDTVIS
HLDE_SHEDO      RQLIKT--HEFSAMLVTRSEKGMTLITAD------EPELHIPTVAREVYDVTGAGDTVIS
HLDE_SHEFN      QKLIKL--HDFEAILVTRSEKGMTLVSQN------QPELHIPTVAREVHDVTGAGDTVIS
HLDE_SHEAM      QKLLQD--LALDALLVTRSEKGMTLITPN------APELHIPTVAREVYDVTGAGDTVIS
HLDE_SHEHH      QGLLEA--YDFTAMLVTRSEKGMTLITRD------QPELHIPTVAREVFDVTGAGDTVIS
HLDE_SHEPA      QGLLQA--FDLTAMLVTRSEKGMTLITKD------QPELHIPTVAREVYDVTGAGDTVIS
HLDE_SHELP      KELLKE--FDFEALLVTRSEKGMTLITAD------APELHIPTVAHEVYDVTGAGDTVIS
HLDE_SHESH      QALLSE--FDIEAILVTRSEKGMTLITAD------APELHIPTVAREVYDVTGAGDTVIS
HLDE_CHRSD      ERLRAE--LELEALLVTRSEKGMTLIREG------HAPLHLPTHAREVYDVTGAGDTVIG
HLDE_PSEAE      QALMSE--LDLGALLVTRGEHGMTLLRHG------QPALHLPARAREVFDVTGAGDTVIS
HLDE_PSEAB      QELMSE--LDLGALLVTRGEHGMTLLRHG------QPALHLPARAREVFDVTGAGDTVIS
HLDE_PSEA7      QALMSE--LELGALLVTRGEHGMTLLRHG------QPALHLPARAREVFDVTGAGDTVIS
HLDE_PSEMY      AKLMRE--LELGALLVTRGEHGMTLLRPE------HAPLHLPARAREVFDVTGAGDTVIS
HLDE_PSEP1      LQLLQD--LDLGALLVTRGEHGMTLLRVG------QPALHLPARAREVFDVTGAGDTVIS
HLDE_PSEPK      LQLLQD--LDLGALLVTRGEHGMTLLRVG------QPALHLPARAREVFDVTGAGDTVIS
HLDE_PSEPG      LQLLQD--LDLGALLVTRGEHGMTLLRVG------QPALHLPARAREVFDVTGAGDTVIS
HLDE_PSEE4      LKLLEE--LDLGALLVTRGEHGMTLLRVG------HPALHLPARAREVFDVTGAGDTVIS
HLDE_PSEF5      AQLMHD--LELGALLVTRGEHGMTLLRPD------HPAMHLPARAREVFDVTGAGDTVIS
HLDE_PSEPF      ATLMHD--LDLGALLVTRGEHGMTLLRPD------HPALHLPARAREVFDVTGAGDTVIS
HLDE_PSEU2      AQLMQE--LDLGALLVTRGEHGMTLLRPD------QQALHLPARAREVFDVTGAGDTVIS
HLDE_PSESM      AQLMQE--LDLGALLVTRGEHGMTLLRPD------QQALHLPARAREVFDVTGAGDTVIS
HLDE_PSE14      AQLMQE--LDLGALLVTRGEHGMTLLRPD------QQALHLPARAREVFDVTGAGDTVIS
HLDE_PSEU5      AELMRQ--LELGALLVTRGEHGMTLLRPE------HAPLHLPARAREVFDVTGAGDTVIS
HLDE_HAHCH      LKLVEE--LELEALLVTRSEQGMTLLRAG------RSELHLPAQAKEVFDVTGAGDTVIS
HLDE_ALCBS      QQLIRD--LDLQAMLVTRSEKGMTLLRDG------LPELHLPARAREVFDVTGAGDTVIS
HLDE_ALKEH      EALARE--CGIEALLVTRGEDGMSLVRPG------EAPVHLAARAREVFDVTGAGDTVIA
HLDE_HALHL      RQLAAD--LELEALLVTRGEAGMTLAPRE------GVAVHLPTRAREVFDVTGAGDTVIA
HLDE_NITOC      EQLRQQ--LALKALLITRGEQGMTLLEQG------HSPVHLPTEAREVFDVTGAGDTVIS
HLDE_COXBU      RALIHQ--YRFEAILITRGKQGMMLIQKE------GAAINLVAHAREVYDVTGAGDTVIA
HLDE_COXBR      RALIHQ--YRFEAILITRGKQGMMLIQKE------GAAINLVAHAREVYDVTGAGDTVIA
HLDE_COXBN      RALIHQ--YRFEAILITRGKQGMMLIQKE------GAAINLVAHAREVYDVTGAGDTVIA
HLDE_METCA      RALMTR--LDLEALLVTRGEHGMSLLRPT------AGALHLPAHGKEVYDVTGAGDTVIS
HLDE_MARMS      KALREQ--FGWKALLVTRGEDGLILLSDD------KPPFSLATAAKEVFDVTGAGDTVVA
HLDE_HYDCU      KQLIQE--INIDALLVTRSEHGMALIEKD------AGATILKSRAQEVFDVTGAGDTVIA
HLDE_DICNV      RACLID--AGISAFLITQSEKGMTYVTA-------QQHYHLPAQAREVFDVTGAGDTVIA
HLDE_MARHV      RAMLTD--AGIDTMLLTRSEQGMSLITP-------TEHHHFPAEVLEVSDVTGAGDTVIA
HLDE_PSEHT      RKLISD--AGIKAMLLTRSEQGMSLISA-------TEKYDFAAQELEVSDVTGAGDTVIA
HLDE_STRCO      ALNAAALVRDWRVAAVTVTLGSRGALLSYG-----EHPLLVPAPAAHHGDSCGAGDRFAA
                                *    .                        .  .  ****   .

HLDE_MAGSA      TLAAALASGATLPEAAHLANVAAGIVVGKVGTAVAYGDELVVALHRED--LTLGEAKIVP
HLDE_RHORT      TLAAALAGGAPLAVACRLANLAAGIVVGRVGTAAVPAADLMAAVHQEE--VSARDSKIVG
HLDE_PARL1      TLAAALGTGLTLAEAAGLANSAAGIVVGKVGTAVVHQDELLAKLRERE--LSMLEAKVAG
HLDE_ACICJ      VLAAGLASGLPLEIAARLSNIAGGLVVGKVGTAVARPDDLVDAVKPAS--GALR--KVVT
HLDE_RHILO      TFALALASGADPVAAASIANAAGGVVVGKRGTARLTVEELTGALFRSHG-PTAHKDAILD
HLDE_CAUVC      TLALAVAAGASLAQAAQLANLAGGLVVAKLGTDVVTAAELTACASSAQ--GEPGEIKIAD
HLDE_CAUSK      TLALALARGASPLDAARLANLAAGLVVAKLGTDVVTADELVGLAHGEH--ADPAVDKIAD
HLDE_BRASB      VLAATLAAGAGWEEALRMASAAAAVAVSKQGTASVTSAELRRKILPHAY-RAAEEKIIAG
HLDE_BRASO      VLAAALAAGAAWEDALRMASAAAAVAVSKQGTASVTSAELRRKILPHAY-RAAEEKIIEN
HLDE_RHOPS      VLAVVLAAGADWATAMRAASAAAAVAVSKNGTAVVTPAELRRKILPHAS-LAAEEKIIGS
HLDE_RHOP2      VLAVALAAGADWGTAMRAASAAAAVAVSKNGTAVVTPAELRRKILPHAS-LAAEDKIIGS
HLDE_RHOPA      VLAVVLASGANWATAMRAASAAAAVAVSKNGTAVVTPAELRRRILPHAS-LAAEEKIIGS
HLDE_RHOP5      VLAVMLAAGADWDIALRAANAGAAVAVSKKGTASVSLAELRRKILPHAF-LAAEEKIVAA
HLDE_RHOPB      VLAVMLAAGADWDVALRAANAGAAVAVSKNGTASVTLGELRRKVLPPAS-LAAEEKIVAA
HLDE_BRADU      ALAVSLAAGADWDTALRVANAAASVAVSKLGTAIVSTAELRRKILPHAY-LAAEEKIVLE
HLDE_NITHX      TLAVSLAAGADWETALRTASAAAAVAVGKSGTAVVTLAELRRKILPPAF-LAAEEKIAQS
HLDE_NITWN      TLAVSLAAGADWEAALRTASAAAAVAVAKSGTAIVTLAELRRNILPPAS-LAAEEKIARS
HLDE_HYPNA      ALATAIAGGGTLSDAVHLAIAASGIAVGKAGTATVSAEEIKAALSVAG---PVGRAGLLP
HLDE_AZOC5      ALAVSLAGGQSLEASVGIANAAAALAVAKLGTAVVTRAELRAALERT-AAQIAPPGALVS
HLDE_GLUOX      TVAAVLSAGQTLETAVVIATAAAALSVSKFGTATVSREELSRELLQ----EMPETGALVP
HLDE_GLUDA      ALALAAGSGMTLAQAMHVANAAAGVVVGKLGTATADIAEVLAELNAQDADAMGGTPSLLS
HLDE_GRABC      TLALAHASGLTLESAMRISNAAAGVVVSKAGTATLNVDELRAELDESAISN-GSTGSARS
HLDE_MAGMM      TLGAGLAAGLTRLDALHLANLAAGVVVGKLGTAAIDLNELRGALLTDAT--YEQSDKIAN
HLDE_METFK      TLTAGLAHGLPLHDAIELANIAAGIVVGKVGTVPINKAELEQELQSQQS--AAQADKVCN
HLDE_KORVE      TLSLSLASGLDPELGVHLANLAGAIVVSKVGTAPVEQYELLNALTAESV--PVAQAKVVT
HLDE_ARCB4      SIAFALGNDLNINEAVSFANLAAGVVVGKLGSATTTLDEIYEYESSL-------HKSNSN
HLDE_SULDN      SIAFAISAGKSIEESAKFANLAAGVVVGKIGSATVSISEIEEYEASL-------HKSTSD
HLDE_NITSB      ALGYAVAKGKNLKEAAVFANLAAGVVVGKVGAATATLEEIEEYERSI-------RKAPTE
HLDE_HELHP      ALSFALSSGCDIFQACEFANVAAAVVVGKVGSAVATHSEILQYIHTQ-------PSNLQQ
HLDE_WOLSU      SLAYGLSLGYPLRECALFANAAAAVVVGKIGSATATHGEIAEYLHSS-------HQGESQ
HLDE_HELPY      SLTLSLLESMSLKDACEFANAAAAVVVGKMGSALASLEEIALILNQT-------HPKILS
HLDE_HELPH      SLTLSLLESMSLKDACEFANAAAAVVVGKMGSALASLEEIALILNQT-------HPKILP
HLDE_HELPJ      SLTLSLLESKSLKEACEFANAAAAVVVGKMGSALASLEEIALILNQT-------HPKILP
HLDE_HELAH      SLTLSLLESKNLKEACEFANAAAAVVVGKMGSALASLEEIALILNQT-------HPKILS
HLDE_CAMC1      TLGYMLANGADIKEAIKIANLAAAVVVAKIGSATASFSEIEQLLNSSFG--ANFEHKLKS
HLDE_CAMC5      TLGFMLASKKDIKEAIKMANLAAAVVVAKIGSATANFGEIEELLRSRAN--AEFEHKIKS
HLDE_CAMFF      TLGYCLASKMSLEESIEIANLAAAVVVGKVGSADASWGEIENLKSKKSG----FERKIIS
HLDE_CAMJE      VLAFCLANEIEIFKACELANEAAAVVVSKIGSVSVSFDEIKSFKR------VDFEKKIKS
HLDE_CAMJJ      VLAFCLANEIEIFKACELANEAAAVVVSKIGSVSVSFDEIKSFKH------VDFEKKIKS
HLDE_CAMJ8      VLAFCLASGIEIFKACELANEAAAVVVSKIGSMSVSFDEIKSFNR------VDFEKKIKS
HLDE_CAMJD      VLAFCLANGVEIFKACELANEAAAVVVGKIGSVSVSFDEIKSFNR------VDFEKKIKS
HLDE_CAMJR      VLAFCLANEIEIFKACELANEAAAVVVSKIGSVSVSFDEIRSFKS------MSFEKKIKN
HLDE_GEOMG      ILGLALACGVGFADAAGLANVAAGIAVGKVGTSTVSPAEVIGSMGFQHS---DSDAKIKN
HLDE_GEOSL      VLGMALAGGVGFADGARLANVAAGVAVGKVGTSTVSPAEIVGSLGFQHG---EGDAKVKN
HLDE_GEOUR      VLSVGLACGLEFGEAARVANVAAGIAVGKLGTSTVSPGEIIAEIGHAHP---DSDAKIKN
HLDE_PELPD      SLAAGMAAGMEMIEAARLANITAGIAVAKLGTSTVAPAEIINAVALAHS---DSDSKIKN
HLDE_PELCD      LVGLGLAGGLPVSEAAALANIGAGIVVGKVGTSTVNVEELHEAMAHHAL---EYDSKIRL
HLDE_ECOLI      VLAATLAAGNSLEEACFFANAAAGVVVGKLGTSTVSPIELENAVRGR----ADTGFGVMT
HLDE_ECOHS      VLAATLAAGNSLEEACFFANAAAGVVVGKLGTSTVSPIELENAVRGR----ADTGFGVMT
HLDE_ECO24      VLAATLAAGNSLEEACFFANAAAGVVVGKLGTSTVSPIELENAVRGR----ADTGFGVMT
HLDE_ECOL5      VLAATLAAGNSLEEACFFANAAAGVVVGKLGTSTVSPIELENAVRGR----ADTGFGVMT
HLDE_SHIBS      VLAATLAAGNSLEEACFFANAAAGVVVGKLGTSTVSPIELENAVRGR----ADTGFGVMT
HLDE_ECO57      VLAATLAAGNSLEEACFFANAAAGVVVGKLGTSTVSPIELENAVRGR----ADTGFGVMT
HLDE_SHISS      VLAATLAAGNSLEEACFFANAAAGVVVGKLGTSTVSPIELENAVRGR----ADTGFGVMT
HLDE_SHIFL      VLAATLAAGNSLEEACFFANAAAGVVVGKLGTSTVSPIELENAVRGR----ADTGFGVMT
HLDE_SHIF8      VLAATLAAGNSLEEACFFANAAAGVVVGKLGTSTVSPIELENAVRGR----ADTGFGVMT
HLDE_SHIDS      VLAATLAAGNSLEEACFFANAAAGVVVGKLGTSTVSPIELENAVRGR----AETGFGVMT
HLDE_ECOUT      VLAATLAAGNSLEEACFFANAAAGVVVGKLGTSTVSPIELENAVRGR----ADTGFGVMT
HLDE_ECOK1      VLAATLAAGNSLEEACFFANAAAGVVVGKLGTSTVSPIELENAVRGR----ADTGFGVMT
HLDE_ECOL6      VLAATLAAGNSLEEACFFANAAAGVVVGKLGTSTVSPIELENAVRGR----ADTGFGVMT
HLDE_SALCH      VLAATLAAGNTLEEACYFANAAAGVVVGKLGTSTVSPIELENAVRGR----ADTGFGVMT
HLDE_SALTI      VLAATLAAGNTLEEACYFANAAAGVVVGKLGTSTVSPIELENAVRGR----ADTGFGVMT
HLDE_SALTY      VLAATLAAGNTLEEACYFANAAAGVVVGKLGTSTVSPIELENAVRGR----ADTGFGVMT
HLDE_SALPA      VLAATLAAGNTLEEACYFANAAAGVVVGKLGTSTVSPIELENAVRGR----ADTGFGVMT
HLDE_CITK8      VLAATLAAGNSLEEACYFANAAAGVVVGKLGTSTVSPIELENAVRGR----ADTGFGVMT
HLDE_ENT38      VLAATLAAGNSLEEACYFANAAAGVVVGKLGTSTVSPIELENAVRGR----ADTGFGVMR
HLDE_CROS8      VLAATLASGNSLEEACFFANAAAGVVVGKLGTSTVSPVELENAVRGR----AETGFGVMS
HLDE_KLEP7      VLAATLASGNTLEEACYFANAAAGVVVGKLGTSTVSPVELENAVRGR----AETGFGVMS
HLDE_PECAS      VLAAALAAGNSLEEACFLANAAAGVVVGKLGTSTVTPIELENAIRGR----ADTGFGVMT
HLDE_YERPE      VLAAALAAGNSLEESCFLANAAAGVVVGKLGTSTVSPIELENAIRGR----AETGFGVMD
HLDE_YERPP      VLAAALAAGNSLEESCFLANAAAGVVVGKLGTSTVSPIELENAIRGR----AETGFGVMD
HLDE_YERPA      VLAAALAAGNSLEESCFLANAAAGVVVGKLGTSTVSPIELENAIRGR----AETGFGVMD
HLDE_YERPN      VLAAALAAGNSLEESCFLANAAAGVVVGKLGTSTVSPIELENAIRGR----AETGFGVMD
HLDE_YERPS      VLAAALAAGNSLEESCFLANAAAGVVVGKLGTSTVSPIELENAIRGR----AETGFGVMD
HLDE_YERP3      VLAAALAAGNSLEESCFLANAAAGVVVGKLGTSTVSPIELENAIRGR----AETGFGVMD
HLDE_YERE8      VLAAALAAGNSLEESCFLANAAAGVVVGKLGTSTVSPIELENAIRGR----AETGFGVMD
HLDE_SERP5      VLAAALAAGNTLEESCFLANAAAGVVVGKLGTSTVSPIELENAVRGR----AETGFGVMT
HLDE_SODGM      VLAAALAAGNSLEDSCFLANAAAGVVVGKLGTSTVSPIELENAIRGR----AETGFGVMT
HLDE_PHOLL      VLATAIAAGKPLNEACFLANAAAGVVVGKLGTSTVSPIELENAIRGR----AETGFGVMT
HLDE_ACTPL      VLATAIADGRPYEEACYLANAAAGVVVGKLGTSTVTPTELENAIHHR----EETGFGILA
HLDE_ACTP2      VLATAIADGRPYEEACYLANAAAGVVVGKLGTSTVTPTELENAIHHR----EETGFGILA
HLDE_HAEDU      ILATAIADGRPYEEACYLANAAAGIVVGKLGTSTVNATELENAIHHR----EETGFGIVT
HLDE_ACTSZ      VLATALADGRTVEEACYLANVAAGIVVGKLGTSAVSTVELENAIHGR----TVSGFGIMT
HLDE_MANSM      VLATALADGRSFEEACFLSNVAAGIVVGKLGTSTVSTIELENAIHGR----SSTGFGIMN
HLDE_HAES1      VLATALADGRSYEEACYLANVAAGIVVGKLGTSTVSTVELENAIHGR----TTAGFGIME
HLDE_PASMU      VLATGLADGRSFEEACYLANVAAGIVVGKLGTSTVSTVELENAIHGR----SNTGFGIMS
HLDE_HAEI8      VLATALADGRSFEESCYLANVAAGIVVGKLGTSTVSTVELENAIHAR----PETGFGIMS
HLDE_HAEIE      VLATALADGRSFEESCYLANVAAGIVVGKLGTSTVSTVELENAIHAR----PETGFGIMS
HLDE_HAEIG      VLATALADGRSFEESCYLANVAAGIVVGKLGTSTVSTVELENAIHAR----PETGFGIMS
HLDE_HAEIN      VLATALADGRSFEESCYLANVAAGIVVGKLGTSTVSTVELENAIHAR----PETGFGIMS
HLDE_BLOFL      VLSAALSLGENLEKSCFLANAAAGSVVEKSGTSTVNVAEINNVVQKYEY--TKIPTGIVD
HLDE_BLOPB      VLSAALSSGKSLEKACFLANLAASAVIKKSGTSTSNVTEMKNIMNSHIC--TTLPVGILD
HLDE_VIBCB      VLAASVAAGKSFEEACALANAAAGVVVGKLGTSTLSEIELAEAIHGS----QDTDYGVIS
HLDE_VIBPA      VLAASVAAGKSFEEACALANAAAGVVVGKLGTSTLSEIELAEAVHGS----QDTDFGVIS
HLDE_VIBVU      VLAASVAAGKPLDEACALANAAAGVVVGKLGTSTLSTIELAEAIHGS----RDTDFGVIA
HLDE_VIBVY      VLAASVAAGKPLDEACALANAAAGVVVGKLGTSTLSTIELAEAIHGS----RDTDFGVIA
HLDE_VIBC3      VLAASVAAGKALDEACALANAAAGVVVGKLGTSTVSTIELAEAVHGS----KDTDYGVIS
HLDE_ALIF1      VLAASVSTGKPLDEACALANAAAGVVVGKLGTSTLSTIELAEAIHGS----QDSGFGIIG
HLDE_PHOPR      VLASSVAAGKSLADACKLANAAAGVVVAKLGTSTLSTIELTEAIYGS----QDSGYGVIA
HLDE_PSYIN      VLASSLAAGSSFEQACTLANAAAGVVVGKIGTSTVNTIELANAVYSQ----QEIGFGVLS
HLDE_AERHH      TLATSLAAGKSLDEACALANTAAGIVVGKLGTSTVSPVELANALYTE----QETGFGVMS
HLDE_AERS4      TLATSLAAGMSLDEACALANTAAGIVVGKLGTSTVSPVELANALYTE----QETGFGVMS
HLDE_SHEB5      ALATSLAAGADLPQACAIANTAAGVVVGKLGTSTVSRIELIEALALHH---GESGFGVVS
HLDE_SHEB9      ALATSLAAGADLPQACAIANTAAGVVVGKLGTSTVSRIELIEALALHH---GESGFGVVS
HLDE_SHEB8      ALATSLAAGADLPQACAIANTAAGVVVGKLGTSTVSRIELIEALALHH---GESGFGVVS
HLDE_SHEPC      ALATSLAAGADLPQACAIANTAAGVVVGKLGTSTVSRIELIEALALHH---GESGFGVVS
HLDE_SHESW      ALATSLAAGADLPQACAIANTAAGVVVGKLGTSTVSRIELIEALALHH---GESGFGVVS
HLDE_SHESM      ALATSLAAGAELPQACAIANTAAGVVVGKLGTSTVSRIELIEALALHH---GESGFGVVS
HLDE_SHESR      ALATSLAAGAELPQACAIANTAAGVVVGKLGTSTVSRIELIEALALHH---GESGFGVVS
HLDE_SHESA      ALATSLAAGAELPQACAIANTAAGVVVGKLGTSTVSRIELIEALALHH---GESGFGVVS
HLDE_SHEON      ALATSLAAGAELAQACAIANTAAGVVVGKLGTSTVSRIELIEALALHH---GESGFGVVS
HLDE_SHEDO      ALATSLGAGSTLAQACAIANTAAGVVVGKLGTSTVSRIELIGALASHQ---GESGFGVVS
HLDE_SHEFN      ALATSIAAGASLAQACAIANTAAGVVVGKLGTSTVSRIELIQALALNH---GESGFGVMT
HLDE_SHEAM      ALATALGAGAELPQACAIANTAAGVVVGKLGTSTVSRIELIEALKSHQ---GESGIGVVS
HLDE_SHEHH      ALATAIAAGSDLPQACAIANTAAGIVVAKLGTSTVTRLELIEALSLSH---GETGFGAVS
HLDE_SHEPA      ALATAIAAGSDLPQACAIANTAAGIVVAKLGTSTVTRLELIEALSLSH---GESGFGAVS
HLDE_SHELP      ALATSLAVGCELPVACALANTAAGIVVGKLGTSTVSRIELIAALNLSH---GESGYGVVS
HLDE_SHESH      ALATSLAAGSDLPQACAIANTAAGIVVAKLGTSTVSRIELIRALSVNH---GESGFGAVS
HLDE_CHRSD      VLGLALAAGHGYPEAIMLANLAAGLVVAKPGTATLSIAELYTALHGD----KLAEFGPIE
HLDE_PSEAE      TLAAALAAGEELPSAVGLANLAAGIVVGKLGTAAISAPELRRAVQRE----QGSERGVLG
HLDE_PSEAB      TLAAALAAGEELPSAVGLANLAAGIVVGKLGTAAISAPELRRAVQRE----QGSERGVLG
HLDE_PSEA7      TLAAALAAGEELPSAVGLANLAAGIVVGKLGTAAISAPELRRAVQRE----QGSERGVLG
HLDE_PSEMY      TLAASIAAGEELPNAVALANLAAGIVVGKLGTAAISAPELRRAVQRE----EGSERGVLS
HLDE_PSEP1      TLAAAIAAGEDLPHAVALANLAAGIVVGKLGTAAISAPELRRAIQRE----EGSERGVLG
HLDE_PSEPK      TLAAAIAAGEDLPHAVALANLAAGIVVGKLGTAAISAPELRRAIQRE----EGSERGVLG
HLDE_PSEPG      TLAAAIAAGEDLPHAVALANLAAGIVVGKLGTAAISAPELRRAIQRE----EGSERGVLG
HLDE_PSEE4      TLAAAIAAGEDLPHAVALANLAAGIVVGKLGTAAISAPELRRAIQRE----EGSERGVLS
HLDE_PSEF5      TLAAAIAAGEELPHAVGLANLAAGIVVGKLGTAAISAPELRRAIQRE----EGSERGVLS
HLDE_PSEPF      TLAAAIAAGEELPHAVALANLAAGIVVGKLGTAAISAPELRRAIQRE----EGSERGVLG
HLDE_PSEU2      TLAAAIAAGEELPHAVALANLAAGIVVGKLGTAAISAPELRRAIQRE----EGSERGVLG
HLDE_PSESM      TLAAAIAAGEELPHAVALANLAAGIVVGKLGTAAISAPELRRAIQRE----EGSERGVLG
HLDE_PSE14      TLAAAIAAGEELPHAVALANLAAGIVVGKLGTAAISAPELRRAIQRE----EGSERGVLG
HLDE_PSEU5      TLAASLAAGEELPQAVALANLAAGIVVGKLGTAAISAPELRRAVQRE----EGSERGVMT
HLDE_HAHCH      VLAAALAAGSEMGQAVALANIAAGIVVGKLGTASVSAPELRRAVQQE----QGAGRGAMT
HLDE_ALCBS      VLAVSLAAGAAMEDAVALANIAAGIVVAKLGTAVVSAPELRRAVHQE----GGSGRGVMS
HLDE_ALKEH      TLATGLATGLALPQAMALANLAAGIVVGKLGTATVSVAELRRALQ--EQ--EQSGRGVLT
HLDE_HALHL      TLAAALGAGVDLADASALANVAAGVVVGKLGTATVTPAELEAALGGGPA--PAAGSGVVD
HLDE_NITOC      VLGAALAAGGTFKEATLLANQAAGIVVGKLGTASVTRDELQQALH---P--RAIRRGITS
HLDE_COXBU      VMAASLAAGGDFYEAAQLANLAAGLVVRKLGAATVTVPELRRALH--QI--TASHHGILS
HLDE_COXBR      VMAASLAAGGDFYEAAQLANLAAGLVVRKLGAATVTVPELRRALH--QI--TASHHGILS
HLDE_COXBN      VMAASLAAGGDFYEAAQLANLAAGLVVRKLGAATVTVPELRRALH--QI--TASHHGILS
HLDE_METCA      VLAAALAVGRPLTDAVALANLAAGIVVGKLGTASVSPEELAIAIH--GQ--RAPRRGAIT
HLDE_MARMS      VLTAVYVTSKRFIDAVEYANQAAGYVVGKLGTASISAERLDAIMFQRS---HNTNFGVLS
HLDE_HYDCU      TLATAFGSGLSMPKSVKLANEAASIVVRKVGTSTVSKVELEEQLNASM---RHQGYASMS
HLDE_DICNV      TLACALASGYDCESAMIFANAAASVVVGKLGTATLTPTELHHALAPR----AAKARGLVD
HLDE_MARHV      TLGTLLSAGFDLKDAAWLSNLAAGIVVAKLGAATVSPEELAARASHQWS--AKTSGYHPS
HLDE_PSEHT      TLAVMLGAGMTPKNAVEIANLAAGIAVSKLGAATVSPEELSRKLGQYLH--ATGEHYQTP
HLDE_STRCO      TAAGLLADGALVGEAVEGAVGAATAFVAAGGAAAVPPAGSERALAALPD-----------
                                  :   .   :   *:                            

HLDE_MAGSA      V--------TAAAEVVDRWRRKGQKVGFTNGCFDLLHPGHVSILAQAKGACDKLVVGLNS
HLDE_RHORT      A--------EDAREVVDKWRRHGLRIGFTNGCFDLLHPGHVSLLRQARAACDRLVVGLNS
HLDE_PARL1      L--------KSAEDIVAGWRARGLTVGFTNGCFDLLHPGHVTLLERSRALCDRLVVGLNS
HLDE_ACICJ      R--------QAAAEAAERWRQRGWRIGFTNGCFDLLHPGHVHLLEQARAGCDRLVVGLNA
HLDE_RHILO      A--------SSAARMVAAWKEEGLSVGFTNGCFDILHAGHVSLLHAARSQCDRLVLGLNS
HLDE_CAUVC      R--------EQAQRIVEGWRARGLKVGFTNGCFDLLHPGHVSLLSQAKAACDRLIVGLNT
HLDE_CAUSK      L--------DGALAIVAGWRARGLKVGFTNGCFDLLHPGHVSLLAQAKAACDRLIVGLNT
HLDE_BRASB      D--------GEILARVEGWRSEGLRVGFTNGCFDILHPGHVKVLTAARAACDRLVVGLNS
HLDE_BRASO      D--------GELATRVAVWRSEGLRVGFTNGCFDILHPGHVKVLTAARAACDRLVVGLNS
HLDE_RHOPS      E--------AELDLRLAEWRREGLRVGFTNGCFDILHPGHVKVLTAARGACDRLIVGLNS
HLDE_RHOP2      D--------AELDLRLAEWRRDGLRVGFTNGCFDILHPGHVKVLTAARGACDRLIVGLNS
HLDE_RHOPA      D--------EELDERLKQWRREGLRVGFTNGCFDILHPGHVKVLTAARGACDRLIVGLNS
HLDE_RHOP5      G--------GDLAPHLAEWRAEGFRIGFTNGCFDILHPGHVKVLTAARAACDRLIVGLNS
HLDE_RHOPB      G--------GDLEPHLVEWRAEGLRIGFTNGCFDILHPGHVKVLTAARGACDRLIVGLNS
HLDE_BRADU      P--------AALDAQLAEWRTQGLRVGFTNGCFDILHPGHVKVLTAARGACDRLVVGLNS
HLDE_NITHX      T--------DDLDQRLSAWREQGLRIGFTNGCFDILHPGHVKVLTGARAACDRLVVGLNS
HLDE_NITWN      A--------GDLDQHLTAWREQGLRIGFTNGCFDILHPGHVKVLTGARAACDRLIVGLNS
HLDE_HYPNA      M--------DAMIGQVERWRAAGLKIGFTNGCFDILHPGHIRVIEQARAHCDRLVVGLNS
HLDE_AZOC5      R--------EDACAVVAAWKAQGLRVVFTNGCFDLVHPGHVSLLEQSAAQGDRLVVALNT
HLDE_GLUOX      V--------EQAARIVESWHRHGAKVVFTNGCFDLVHPGHVSLLQAAAREGDRLVVALNT
HLDE_GLUDA      R--------AQAAEQVARWKAQGLRVGFTNGCFDIIHPGHVALLAAARRACDRLIVALND
HLDE_GRABC      L--------GEARSLVKKWKQLGLTVGFTNGCFDILHAGHVSLLNEARTRCDRLIVAVNT
HLDE_MAGMM      --------WAHAKQQIARWHAQGEKVVFTNGCFDLLHAGHVTYLEHARRLGQRLVLGLNT
HLDE_METFK      --------LDSLLARVQNWRHQGERIVFTNGCFDLLHAGHVTYLEAARNTGDRLVLGLNT
HLDE_KORVE      --------RSELLELVARWRRNDERIVVTNGCFDLLHVGHISLLEQARGFGDRLVVAINS
HLDE_ARCB4      ---SHIKTFEEIEKLAAKLHNLGKKIVFTNGCFDILHVGHVKYLEEARSYGDVLILGLNA
HLDE_SULDN      ---AHIKGFEEIEAIVKRYKESGKKVVFTNGCFDILHVGHVKYLQIAKSFGDVLIVGLNS
HLDE_NITSB      ---EFIKDFEEIELISKDLHKRGKRIVFTNGCFDILHLGHVKYLQKAKELGDVLIVGVNS
HLDE_HELHP      YIESKIISQESLFTLLKDLKQS--KIVFTNGCFDILHIGHLSYLNKARDLGDILIVGLND
HLDE_WOLSU      ---ERILSRDSIQKIAKQWRSRGRKIVFTNGCFDILHAGHVQYLQKAKACGDCLIVGLNS
HLDE_HELPY      -----------LEKLLETLD--QQKIIFTNGCFDLLHKGHASYLQKAKALGDILIVGLNS
HLDE_HELPH      -----------LEKLLETLEHHQQKIVFTNGCFDLLHKGHASYLQKAKALGDILVVGLNS
HLDE_HELPJ      -----------LEKLLETLERNQQKIVFTNGCFDILHKGHASYLQKAKALGDILVVGLNS
HLDE_HELAH      -----------LEKLLNILEYNKQKVVFTNGCFDILHKGHASYLQKAKALGDILIVGLNS
HLDE_CAMC1      ----------IEELEEILSQKGKKKVVFTNGCFDILHAGHVKYLARARELGDLLVVGLNS
HLDE_CAMC5      ----------AEQVAEILSQRGEKKVVFTNGCFDILHAGHARYLAKARDFGDILIVGLNS
HLDE_CAMFF      ----------LDELLRVD--RSGKTMVFTNGCFDILHFGHISYLQSAKKIGDMLVVGLNS
HLDE_CAMJE      ----------KEELLVLLK-QNNKKIVFTNGCFDIVHFGHIKYLDKAKRLGDVLIVGLNS
HLDE_CAMJJ      ----------KEELLALLK-QNDKKIVFTNGCFDIVHFGHIKYLEKAKRLGDVLVVGLNS
HLDE_CAMJ8      ----------KEELLTLLK-QNDKKIVFTNGCFDIVHFGHIKYLEKAKRLGDVLIVGLNS
HLDE_CAMJD      ----------KEELLTLLK-QKDKKIVFTNGCFDIVHFGHIKYLEKAKRLGDVLIVGLNS
HLDE_CAMJR      ----------KEELLTLLK-QNDKKIVFTNGCFDIVHFGHIKYLEKAKRLGDVLIVGLNS
HLDE_GEOMG      --------LDGLAGIIEAEKARGKKIVFTNGCFDLLHVGHVKYLQKAKSYGDVLVLGLNS
HLDE_GEOSL      --------LDVLAGIIAAEKAQGKRVVFTNGCFDLLHVGHVKYLQKARSFGDLLVLGLNS
HLDE_GEOUR      --------LDALAAIVKAEKTRGKRLVFTNGCFDLLHVGHVKYLQKARTFGDLLVVGLNS
HLDE_PELPD      --------RDVLAVLIEAEKARGKRIVFTNGCFDLLHAGHVKYLQKARTLGDLLVLGLNS
HLDE_PELCD      --------RESLRDVLEVERRRGKTVVFTNGCFDLLHVGHVKYLQKARRLGDLLVLGLNS
HLDE_ECOLI      E--------EELKLAVAAARKRGEKVVMTNGVFDILHAGHVSYLANARKLGDRLIVAVNS
HLDE_ECOHS      E--------EELKLAVAAARKRGEKVVMTNGVFDILHAGHVSYLANARKLGDRLIVAVNS
HLDE_ECO24      E--------EELKLAVAAARKRGEKVVMTNGVFDILHAGHVSYLANARKLGDRLIVAVNS
HLDE_ECOL5      E--------EELKLAVAAARKRGEKVVMTNGVFDILHAGHVSYLANARKLGDRLIVAVNS
HLDE_SHIBS      E--------EELKLAVAAARKRGEKVVMTNGVFDILHAGHVSYLANARKLGDRLIVAVNS
HLDE_ECO57      E--------EELKLAVVAARKRGEKVVMTNGVFDILHAGHVSYLANARKLGDRLIVAVNS
HLDE_SHISS      E--------EELKLAVAAARKRGEKVVMTNGVFDILHAGHVSYLANARKQGDRLIVAVNS
HLDE_SHIFL      E--------EELKLAVAAARKRGEKVVMTNGVFDILHAGHVFYLANARKLGDRLIVAVNS
HLDE_SHIF8      E--------EELKLAVAAARKRGEKVVMTNGVFDILHAGHVFYLANARKLGDRLIVAVNS
HLDE_SHIDS      E--------EELKLAVAAARKRGEKVVMTNGVFDILHAGHVSYLANARKLGDRLIVAVNS
HLDE_ECOUT      E--------EELKLAVAAARKRGEKVVMTNGVFDILHAGHVSYLANARKLGDRLIVAVNS
HLDE_ECOK1      E--------EELKLAVAAARKRGEKVVMTNGVFDILHAGHVSYLANARKLGDRLIVAVNS
HLDE_ECOL6      E--------EELKLAVAAARKRGEKVVMTNGVFDILHAGHVSYLANARKLGDRLIVAVNS
HLDE_SALCH      E--------EELRQAVASARKRGEKVVMTNGVFDILHAGHVSYLANARKLGDRLIVAVNS
HLDE_SALTI      E--------EELRQAVASARKRGEKVVMTNGVFDILHAGHVSYLANARKLGDRLIVAVNS
HLDE_SALTY      E--------EELRQAVASARKRGEKVVMTNGVFDILHAGHVSYLANARKLGDRLIVAVNS
HLDE_SALPA      E--------EELRQAVASARKRGEKVVMTNGVFDILHAGHVSYLANARKLGDRLIVAVNS
HLDE_CITK8      E--------AELKQAVASARKRGEKVVMTNGVFDILHAGHVSYLANARKLGDRLIVAVNS
HLDE_ENT38      E--------DELKVAVAAARKRGEKVVMTNGVFDILHAGHVSYLANARKLGDRLIVAVNS
HLDE_CROS8      E--------AALKEAVLAARKRGEKVVMTNGVFDILHAGHVSYLANARKLGDRLIVAVNS
HLDE_KLEP7      E--------EELKQAVAAARKRGEKVVMTNGVFDILHAGHVSYLANARKLGDRLIVAVNS
HLDE_PECAS      E--------EQLKHAVELARQRGEKIVMTNGCFDILHAGHVSYLANARKLGDRLIVAVNS
HLDE_YERPE      E--------QQLKIAVAQARQRGEKVVMTNGIFDILHAGHVSYLANARKLGDRLIVAVNS
HLDE_YERPP      E--------QQLKIAVAQARQRGEKVVMTNGIFDILHAGHVSYLANARKLGDRLIVAVNS
HLDE_YERPA      E--------QQLKIAVAQARQRGEKVVMTNGIFDILHAGHVSYLANARKLGDRLIVAVNS
HLDE_YERPN      E--------QQLKIAVAQARQRGEKVVMTNGIFDILHAGHVSYLANARKLGDRLIVAVNS
HLDE_YERPS      E--------QQLKIAVAQARQRGEKVVMTNGIFDILHAGHVSYLANARKLGDRLIVAVNS
HLDE_YERP3      E--------QQLKIAVAQARQRGEKVVMTNGIFDILHAGHVSYLANARKLGDRLIVAVNS
HLDE_YERE8      E--------QQLKKAVAQARQRGEKVVMTNGIFDILHAGHVSYLANARKLGDRLIVAVNS
HLDE_SERP5      E--------AQLKTAVAQARQRGEKVVMTNGIFDILHAGHVSYLANARKLGDRLIVAVNS
HLDE_SODGM      E--------SELKQAVAVARQRGEKVVMTNGIFDILHAGHVSYLANAQRLGDRLIVAVNS
HLDE_PHOLL      E--------FQLKQAVVDARQRGERVVMTNGCFDILHAGHVSYLENARRLGDRLIVAVNS
HLDE_ACTPL      E--------DELKRAVEQAKQRGEKIVMTNGCFDILHPGHVSYLENARKLGDRLIVAVNT
HLDE_ACTP2      E--------DELKRAVEQAKQRGEKIVMTNGCFDILHPGHVSYLENARKLGDRLIVAVNT
HLDE_HAEDU      E--------ERLKQFTKEAKNRGEKIVMTNGCFDILHPGHVSYLENARKLGDRLIVAVNC
HLDE_ACTSZ      E--------NELKNAVKLAKERGEKIVMTNGCFDILHPGHVSYLENARKLGDRLIVAVNT
HLDE_MANSM      E--------DELKVAVQLAKARGEKIVMTNGCFDILHPGHVSYLENARKLGDRLIVAVNT
HLDE_HAES1      E--------SQLKAAVELAKARGEKIVMTNGCFDILHPGHVSYLENARKLGDRLIVAVNT
HLDE_PASMU      E--------AELKRVVAQAKARGEKIVMTNGCFDILHPGHVSYLENARKLGDRLIVAVNS
HLDE_HAEI8      E--------AELKDAVAQAKARGEKIVMTNGCFDILHPGHISYLENARKLGDRLIVAVNS
HLDE_HAEIE      E--------AELKDAVAQAKARGEKIVMTNGCFDILHPGHISYLENARKLGDRLIVAVNS
HLDE_HAEIG      E--------AELKDAVAQAKARGEKIVMTNGCFDILHPGHISYLENARKLGDRLIVAVNS
HLDE_HAEIN      E--------AELKDAVAQAKARGEKIVMTNGCFDILHPGHISYLENARKLGDRLIVAVNS
HLDE_BLOFL      R--------GLLKYVVSVVRGRGEKIVMTNGVFDILHYGHISYLMDAKKLGHRLIVAVNS
HLDE_BLOPB      E--------KTLKQTISVVRNRGEKIVMTNGVFDILHSGHVSYLTNAKKLGDRLIVAVNS
HLDE_VIBCB      E--------QALIEAVKKARAKGEKVVMTNGCFDILHAGHVSYLNHAAELGDRLIVAVNT
HLDE_VIBPA      E--------KALIEAVKKARARGEKVVMTNGCFDILHAGHVSYLNHAAELGDRLIVAVNT
HLDE_VIBVU      E--------AALIDAVKAAQAKGEKVVMTNGCFDILHAGHVSYLNNAAKLGDRLIVAVNT
HLDE_VIBVY      E--------AALIDAVKAAQAKGEKVVMTNGCFDILHAGHVSYLNNAAKLGDRLIVAVNT
HLDE_VIBC3      E--------DALIEAVKKAQARGEKVVMTNGCFDILHAGHVSYLNHAAELGDRLIVAVNT
HLDE_ALIF1      E--------EQLISAVKQARARGEKVVMTNGCFDILHAGHVSYLNHAAELGDRLIVAVNT
HLDE_PHOPR      E--------TELKQAVSVARQRGETVVMTNGCFDILHAGHVAYLAEAAKLGDRLIVAVNS
HLDE_PSYIN      E--------EQLKLAVKLAQHRGEKVVMTNGCFDILHAGHVSYLNTAREQGNRLIVAVNS
HLDE_AERHH      E--------AQLKIAVQAARLRGEKVVMTNGCFDILHAGHVSYLANAGKLGDRLIVAVNT
HLDE_AERS4      E--------AQLKIAVQAARLRGEKVVMTNGCFDILHAGHVSYLANAGKLGDRLIVAVNT
HLDE_SHEB5      E--------DQLAYALEQAKLRGERVVMTNGCFDILHAGHVSYLKQAKALGDRLIVAVND
HLDE_SHEB9      E--------DQLAYALEQAKLRGERVVMTNGCFDILHAGHVSYLKQAKALGDRLIVAVND
HLDE_SHEB8      E--------DQLAYALEQAKLRGERVVMTNGCFDILHAGHVSYLKQAKALGDRLIVAVND
HLDE_SHEPC      E--------DQLAYALEQAKLRGERVVMTNGCFDILHAGHVSYLKQAKALGDRLIVAVND
HLDE_SHESW      E--------DQLAYALEQAKLRGERVVMTNGCFDILHAGHVSYLKQAKALGDRLIVAVND
HLDE_SHESM      E--------DQLAYALEQAKLRGERVVMTNGCFDILHAGHVSYLKQAKALGDRLIVAVND
HLDE_SHESR      E--------DQLAYALEQAKLRGERVVMTNGCFDILHAGHVSYLKQAKALGDRLIVAVND
HLDE_SHESA      E--------DQLAYALEQAKLRGERVVMTNGCFDILHAGHVSYLKQAKALGDRLIVAVND
HLDE_SHEON      E--------DQLAYALEQAKLRGERVVMTNGCFDILHAGHVSYLKQAKALGDRLIVAVND
HLDE_SHEDO      E--------DQLAYAMEQARLRGERVVMTNGCFDILHAGHVSYLKQAKALGDRLIVAVNS
HLDE_SHEFN      E--------DQLAYAMDQARLRGERIVMTNGCFDILHAGHVSYLQQAKALGDRLIVAVND
HLDE_SHEAM      E--------DQLVYALEQAKLRGERVVMTNGCFDILHAGHVSYLAQAKALGDRLIVAVND
HLDE_SHEHH      E--------DQLAYALEQAKLRGERVVMTNGCFDILHAGHVSYLQQARALGDRLIVAVNT
HLDE_SHEPA      E--------DQLAYALEQAKLRGERVVMTNGCFDILHAGHVSYLQQARALGDRLIVAVNT
HLDE_SHELP      E--------DQLAYALEQAKLKGERVVMTNGCFDILHAGHVSYLQQARALGDRLIVAVND
HLDE_SHESH      E--------DQLAYALEQARLRGERVVMTNGCFDILHAGHVSYLKQARELGDRLIVAVND
HLDE_CHRSD      E--------SALIDAVRAAKLRGERVVMTNGCFDILHAGHVAYLEQAKRLGDRLVVAVND
HLDE_PSEAE      L--------EQLLLAIEDARAHGEKIVFTNGCFDILHAGHVTYLEQARAQGDRLIVGVND
HLDE_PSEAB      L--------EQLLLAIEDARAHGEKIVFTNGCFDILHAGHVTYLEQARAQGDRLIVGVND
HLDE_PSEA7      L--------EQLLLAIEDARAHGEKIVFTNGCFDILHAGHVTYLEQARAQGDRLIVGVND
HLDE_PSEMY      L--------DQLLIAIEDARAHGEKIVFTNGCFDILHAGHVTYLEQARAQGDRLIVAIND
HLDE_PSEP1      L--------EQLLLAIDDARAHNEKIVFTNGCFDILHAGHVTYLEQARAQGDRLIVAVND
HLDE_PSEPK      L--------EQLLLAIDDARAHNEKIVFTNGCFDILHAGHVTYLEQARAQGDRLIVAVND
HLDE_PSEPG      L--------EQLLLAIDDARAHKEKIVFTNGCFDILHAGHVTYLEQARAQGDRLIVAVND
HLDE_PSEE4      L--------EQLLLAIDDARAHNETIVFTNGCFDILHAGHVTYLEQARAQGDRLIVAIND
HLDE_PSEF5      L--------DQLLLAIDDARAHNEKIVFTNGCFDILHAGHVTYLEQARAQGDRLIVAIND
HLDE_PSEPF      L--------EQLLLAVADARAHNEKIVFTNGCFDILHAGHVTYLEQARAQGDRLIVAIND
HLDE_PSEU2      L--------EQLLLAVDDARAHKERIVFTNGCFDILHAGHVTYLEQARALGDRLIVAVND
HLDE_PSESM      L--------EQLLLAVDDARAHKEKIVFTNGCFDILHAGHVTYLEQARAQGDRLIVAVND
HLDE_PSE14      L--------EQLLLAVDDARAHKEKIVFTNGCFDILHAGHVTYLEQARALGDRLIVAVND
HLDE_PSEU5      V--------EQLLTVVEDARAQGEKIVFTNGCFDILHAGHVTYLEQARAQGDRLVVAVND
HLDE_HAHCH      V--------EQLKVALDDARAHGEKIVFTNGCFDIIHAGHVGYLDQARKLGDRLVVAINS
HLDE_ALCBS      E--------AQLLIAIEDARAQGERIVFTNGCFDIIHAGHVGYLDTARRQGDRLVLAVNG
HLDE_ALKEH      E--------PELLHAVADARAHGERIVMTNGCFDLLHAGHVAYLEQARSRGDRLIVAVND
HLDE_HALHL      E--------PGLLAAVRQARAAGERIVMTNGCFDLLHAGHVDYLQRARRRGERLVVAVND
HLDE_NITOC      E--------EELLHFINLARSRGECIVMTNGCFDILHPGHVNYLAEARQLGDRLIVAVND
HLDE_COXBU      E--------KALLLAVADARAHGETIVMTNGCFDILHAGHVHYLEAAKAMGHRLIVAVND
HLDE_COXBR      E--------KALLLAVADARAHGETIVMTNGCFDILHAGHVHYLEAAKAMGHRLIVAVND
HLDE_COXBN      E--------KALLLAVADARAHGETIVMTNGCFDILHAGHVHYLEAAKAMGHRLIVAVND
HLDE_METCA      L--------AELLDVLIPLRRAGERIVVTNGCFDLLHPGHVHYLEQARALGDRLIVLVNG
HLDE_MARMS      P--------KDLLEQIKLAQMNGEKIVFTNGCFDILHPGHIAYMKQAKALGDRLIVAVNT
HLDE_HYDCU      E--------DEVHSLVQIAQSKGEKVVFTNGCFDLLHSGHVRYLNEAARQGDRLVVAVNS
HLDE_DICNV      L--------SQLQEQLHYLKKQGKTVVMTNGCFDILHAGHVRYLEEAKALGDCLIVAINT
HLDE_MARHV      V--------EQSLLHIDYARQQGERIVFTNGCFDILHAGHVRYLAQARALGDRLVVGLNS
HLDE_PSEHT      F--------DDVLQHIEFAKQNGETIVFTNGCFDILHAGHVRYLAQAKARGDRLVVGLNN
HLDE_STRCO      --------TDDPGALAARIRAEHGTVVAAGGCFDLLHAGHVGLLQAARRLGDCLVVCVNS
                                         :  :.* **::* **   :  :    . *:: :* 

HLDE_MAGSA      DASVQRLKGPTRPVQSEASRATVLSSLATVDLVVIF-----GEDTPLEVIGTLKPDVLVK
HLDE_RHORT      DASVRRLKGDSRPVQDETARAIVLASLADVDLVAVF-----GEDTPLGLITTLLPDVLVK
HLDE_PARL1      DASVSRLKGPERPVQPDIARATVLAALASVDLVVIF-----EEDTPEALIKALRPDILVK
HLDE_ACICJ      DSSVRRLKGATRPVQPEAARAAVLASLASVDLVVIF-----EEDTPLDLLSAIRPDVLVK
HLDE_RHILO      DASVRRLKGPGRPVNDQHDRACVLAALASVDAVVVF-----EEDTPLALIEALLPDILVK
HLDE_CAUVC      DASVSKLKGPTRPVQKEQGRATVLASLSSVDLVVLF-----DEDTPLELIKAFRPDVLVK
HLDE_CAUSK      DASVQRLKGPTRPVQKETGRATVLASLSAVDLVVLF-----DEQTPLNLIRAFRPDVLVK
HLDE_BRASB      DASVKRLKGESRPVQDERARAEVLAALEAVDLVAIF-----TEDTPLRLIELVRPSVLVK
HLDE_BRASO      DTSVKRLKGESRPVQDERARAEVLAALEAVDLVAIF-----TEETPLRLIELVRPSVLVK
HLDE_RHOPS      DASVRRLKGESRPVQNERARAEVLAALEAVDLVAIF-----GEDTPLKLIKRIVPSVLVK
HLDE_RHOP2      DASVRRLKGESRPVQNERARAEVLAALEAVDLVAIF-----EEDTPLKLITRIEPSVLVK
HLDE_RHOPA      DASVRRLKGESRPVQHERARAEVLAALEAVDLVAIF-----EEDTPLRLITRIEPSVLVK
HLDE_RHOP5      DASVRRLKGETRPVQDERARAEVLAALEAVDLVAIF-----DEDTPLRLITEIKPSVLVK
HLDE_RHOPB      DASVKRLKGESRPVQDERARAEVLAALEAVDLVVIF-----EEDTPLQLITRIVPSVLVK
HLDE_BRADU      DASVRRLKGADRPVQDERARAEVLAALEAVDLVVIF-----EEDTPIDLITRIKPAALVK
HLDE_NITHX      DASVTRLKGEGRPIQDERARAEVLAALEAVDLVVIF-----EEDTPMNLIERIQPNVLVK
HLDE_NITWN      DASVKRLKGEGRPIQNERARAEVLAALEAVDLVAIF-----EEDTPLNLIGRIQPNVLVK
HLDE_HYPNA      DNSVKRLKGPLRPINNEQARADVLSALSAVDGVIIF-----DTDTPLDAIAALNPDVLVK
HLDE_AZOC5      DASVRRLKGPSRPLQDEQARARVMGAMRCVDLVVLF-----DEETPLETIKALLPDVLVK
HLDE_GLUOX      DRSVSRLKGPTRPVQKEEARARVIGALRSVDLVVLF-----DEDTPLEVIRTLKPDILVK
HLDE_GLUDA      DASVARLKGPERPVNPLEDRARVMAAIRHVDAVVAF-----GEDTPLELIRLLLPDVLVK
HLDE_GRABC      DASVSRLKGPTRPINGFEDRCTVLAGLRSVDCVVGF-----QEDTPLSVISVLLPDRLFK
HLDE_MAGMM      DASVSRLKGPERPLIQEQDRARVLAALAAVDLVVLF-----EQDTPLELIEQLRPDILAK
HLDE_METFK      DRSVSALKGPSRPVIHEQDRARVLAALESVDAVILF-----DEDTPIDLINAIRPDVIAK
HLDE_KORVE      DRSVRELKGNSRPIVGEQERARVLAAIAAVDAVVIF-----DERTPLELIEATRPDVLVK
HLDE_ARCB4      DSSVKKLKGESRPINNQDDRAYILASLESVDYVVIF-----EEETPYELIKLIKPHVLVK
HLDE_SULDN      DTSVTRLKGPSRPVNIAEDRAYLLAALEAVDFVVPF-----EDDTPYELIKMIKPDTLVK
HLDE_NITSB      DASVKRLKGDDRPINPQFDRAYLLASLEAVDYVVIF-----EEDTPYELIKIVKPDILVK
HLDE_HELHP      DDSIKRLKGKERPINTLHNRALMLAGLECVDYVVSF-----CQDTPLELIKAIKPDVLVK
HLDE_WOLSU      DASVRRLKGELRPINSQEDRALVLSGLEAVDYVVVF-----DEETPYELIRAIEPDVLVK
HLDE_HELPY      DASIKRLKGDKRPIVSEKDRAFLLASLSCVDYVVVF-----EEDTPIKLIQALKPDILVK
HLDE_HELPH      DNSIKRLKGNKRPIVSEKDRAFLLASLSCVDYVVVF-----EEDAPIKLIQALKPDILVK
HLDE_HELPJ      DNSIKRLKGDKRPIVSEKDRAFLLASLSCVDYVVVF-----GEDTPIKLIQALKPDILVK
HLDE_HELAH      DASIKRLKGDKRPIVGEKDRAFLLASLSCVDYIVVF-----EEDTPIGLIQALKPDILVK
HLDE_CAMC1      DASVKRLKGEARPINSQDDRACVLSGLGFVDYVVIF-----DEDTPLNLITKIKPDVLVK
HLDE_CAMC5      DASVRRLKGESRPINSQLDRACVLSGLGFVDYVVIF-----DEDTPMELIKKLRPDILVK
HLDE_CAMFF      DRSVKELKGDNRPVNAQSDRASMLAALEFVDFVVIF-----DEDTPLNLIKTLKPDILVK
HLDE_CAMJE      DASVKRLKGESRPVNSEFQRACMLAAFYFVDFVVIF-----DEDTPLELISFLKPDILVK
HLDE_CAMJJ      DASVKSLKGESRPVNSEFQRACMLAAFYFVDFVVVF-----DEDTPLELISFLKPDILVK
HLDE_CAMJ8      DASVKRLKGESRPVNSEFQRACMLAAFYFVDFVVIF-----DEDTPLELISFLKPDILIK
HLDE_CAMJD      DASVKKLKGESRPVNSEFQRACMLAAFYFVDFVVIF-----DEDTPLELISFLKPDILVK
HLDE_CAMJR      DASVKRLKGESRPVNSEFQRACMLAAFYFVDFVVIF-----DEDTPLELISFLKPDILVK
HLDE_GEOMG      DASVRRLKGEKRPLIDEAERAHILAALDCIDYVVIF-----DEDTPLRLIETLKPAVLVK
HLDE_GEOSL      DASIRRLKGEKRPLIGQEERAHILAALDCIDYVVVF-----DEDTPLNLIETLRPAVLVK
HLDE_GEOUR      DASVRRLKGAERPLIGEAERAHILAALDCVDFVVIF-----DEDTPLRLIETLQPQVLVK
HLDE_PELPD      DASVRRLKGEKRPLIGEQERAHILAALDCIDYVVIF-----EEDTPLELIAALKPHILAK
HLDE_PELCD      DASIRRLKGPSRPLISEQERAHILAALSCIDYVVVF-----DEDTPLELIDTLRPDILVK
HLDE_ECOLI      DASTKRLKGDSRPVNPLEQRMIVLGALEAVDWVVSF-----EEDTPQRLIAGILPDLLVK
HLDE_ECOHS      DASTKRLKGDSRPVNPLEQRMIVLGALEAVDWVVSF-----EEDTPQRLIAGILPDLLVK
HLDE_ECO24      DASTKRLKGDSRPVNPLEQRMIVLGALEAVDWVVSF-----EEDTPQRLIAGILPDLLVK
HLDE_ECOL5      DASTKRLKGDSRPVNPLEQRMIVLGALEAVDWVVSF-----EEDTPQRLIAGILPDLLVK
HLDE_SHIBS      DASTKRLKGDSRPVNPLEQRMIVLGALEAVDWVVSF-----EEDTPQRLIAGILPDLLVK
HLDE_ECO57      DASTKRLKGDSRPVNPLEQRMIVLGALEAVDWVVSF-----EEDTPQRLIAGILPDLLVK
HLDE_SHISS      DASTKRLKGDSRPVNPLEQRMIVLGALEAVDWVVSF-----EEDTPQRLIAGILPDLLVK
HLDE_SHIFL      DASTKRLKGDSRPVNPLEQRMIVLGALEAVDWVVSF-----EEDTPQRLIAGILPDLLVK
HLDE_SHIF8      DASTKRLKGDSRPVNPLEQRMIVLGALEAVDWVVSF-----EEDTPQRLIAGILPDLLVK
HLDE_SHIDS      DASTKRLKGDSRPVNPLEQRMIVLGALEAVDWVVSF-----EEDTPQRLIAGILPDLLVK
HLDE_ECOUT      DASTKRLKGDSRPVNPLEQRMIVLGALEAVDWVVSF-----EEDTPQRLIAGILPDLLVK
HLDE_ECOK1      DASTKRLKGDSRPVNPLEQRMIVLGALEAVDWVVSF-----EEDTPQRLIAGILPDLLVK
HLDE_ECOL6      DASTKRLKGDSRPVNPLEQRMIVLGALEAVDWVVSF-----EEDTPQRLIAGILPDLLVK
HLDE_SALCH      DASTKRLKGESRPVNPLEQRMIVLGALESVDWVVSF-----EEDTPQRLIAGILPDLLVK
HLDE_SALTI      DASTKRLKGESRPVNPLEQRMIVLGALESVDWVVSF-----EEDTPQRLIAGILPDLLVK
HLDE_SALTY      DASTKRLKGESRPVNPLEQRMIVLGALESVDWVVSF-----EEDTPQRLIAGILPDLLVK
HLDE_SALPA      DASTKRLKGESRPVNPLEQRMIVLGALESVDWIVSF-----EEDTPQRLIAGILPDLLVK
HLDE_CITK8      DASTKRLKGETRPVNPLEQRMIVLGALESVDWVVSF-----DEDTPQRLIAGVLPDLLVK
HLDE_ENT38      DASTKRLKGETRPVNPLEQRMIVLGALEAVDWVVSF-----EEDTPQRLIAGILPDLLVK
HLDE_CROS8      DASTRRLKGDTRPVNPQEQRMIVLAALEAVDWVVPF-----EEDTPQRLISEILPDLLVK
HLDE_KLEP7      DASTKRLKGETRPVNPLEQRMIVLGALEAVDWVVSF-----EEDTPQRLIAGILPDLLVK
HLDE_PECAS      DASTKRLKGPTRPVNPLPQRMIVLGALEAVDWVVPF-----EEDTPQRLIASILPDILVK
HLDE_YERPE      DASTKRLKGEKRPVNPLEQRMVVLGALEAVDWVVPF-----EEDTPQRLIADILPDLLVK
HLDE_YERPP      DASTKRLKGEKRPVNPLEQRMVVLGALEAVDWVVPF-----EEDTPQRLIADILPDLLVK
HLDE_YERPA      DASTKRLKGEKRPVNPLEQRMVVLGALEAVDWVVPF-----EEDTPQRLIADILPDLLVK
HLDE_YERPN      DASTKRLKGEKRPVNPLEQRMVVLGALEAVDWVVPF-----EEDTPQRLIADILPDLLVK
HLDE_YERPS      DASTKRLKGEKRPVNPLEQRMVVLGALEAVDWVVPF-----EEDTPQRLIADILPDLLVK
HLDE_YERP3      DASTKRLKGEKRPVNPLEQRMVVLGALEAVDWVVPF-----EEDTPQRLIADILPDLLVK
HLDE_YERE8      DASTKRLKGEKRPVNPLDQRMIVLGALEAVDWVVPF-----EEDTPQRLIADILPDLLVK
HLDE_SERP5      DASTKRLKGETRPVNALENRMIVLGALEAVDWVVPF-----EEDTPQRLIADILPDLLVK
HLDE_SODGM      DESTKRLKGESRPVNPLAQRMTVLAALEAVDWVVPF-----SEDTPQRLIADVLPDVLVK
HLDE_PHOLL      DASTKRLKGESRPVNPLEQRMIVLSALGAVDWVVPF-----EEDTPQRLIADVLPDVLVK
HLDE_ACTPL      DESVKRLKGESRPINDLNARMAVLAGLASVDWVVPF-----AEDTPQRLIGEILPNLLVK
HLDE_ACTP2      DESVKRLKGESRPINDLNARMAVLAGLASVDWVVPF-----AEDTPQRLIGEILPNLLVK
HLDE_HAEDU      DQSVKRLKGESRPINSLSARMAILAGLASVDWVIAF-----EEDTPQRLISEILPDVLVK
HLDE_ACTSZ      DESVKRLKGETRPINDLASRMAVLAGLSSVDWLVAF-----DEDTPQRLIGEILPDLLVK
HLDE_MANSM      DDSVKRLKGETRPINDLPSRMAVLAGLSSVDWLVAF-----DEDTPQRLIGEVLPDLLVK
HLDE_HAES1      DNSVKRLKGETRPINDLATRMAVLAGLSSVDWLVAF-----DEDTPQRLIAEILPDLLVK
HLDE_PASMU      DDSVKRLKGETRPINDLQSRMAVLAGLSSVDWLVAF-----HEDTPQRLIAEVLPDLLVK
HLDE_HAEI8      DDSVKRLKGESRPINNLENRMAVLAGLASVDWLVPF-----TEDTPQRLIGEILPDLLVK
HLDE_HAEIE      DDSVKRLKGESRPINNLENRMAVLAGLASVDWLVPF-----TEDTPQRLIGEILPDLLVK
HLDE_HAEIG      DDSVKRLKGESRPINNLENRMAVLAGLASVDWLVPF-----TEDTPQHLIGEILPDLLVK
HLDE_HAEIN      DDSVKRLKGESRPINNLENRMAVLAGLASVDWLVPF-----TEDTPQRLIGEILPDLLVK
HLDE_BLOFL      DKSTRRLKGKHRPINVLERRMFVLSALSMVDWVVSF-----DEDNPIQLILEISPDFLVK
HLDE_BLOPB      DGSTRRLKGKTRPINTLEQRMFILAALTVVDWVVPF-----YEDTPSRLVAYLSPDFLVK
HLDE_VIBCB      DESVKRLKGPGRPVNPTDRRMAVLAGLGAVDWVVPF-----SEDTPQRLISEVLPSLLVK
HLDE_VIBPA      DESVKRLKGPGRPVNPTDRRMAVLAGLGAVDWVVPF-----SEDTPQRLISEVLPSMLVK
HLDE_VIBVU      DESVKRLKGPGRPVNPTDRRMAVLAGLGAVDWVVPF-----SEDTPQRLISEVLPDLLVK
HLDE_VIBVY      DESVKRLKGPGRPVNPTDRRMAVLAGLGAVDWVVPF-----SEDTPQRLISEVLPDLLVK
HLDE_VIBC3      DESVKRLKGPGRPVNSTDRRMAVLAGLGAVDWVVPF-----SEDTPQRLIAAILPNLLVK
HLDE_ALIF1      NESVQRLKGPGRPINPTDRRMAVLAGLGAVDWVVPF-----SEDTPQRLISQVLPSLLVK
HLDE_PHOPR      DSSVQGLKGPGRPVNPEDRRMAVLAGLGAVDWVVPF-----TEETPQRLISEILPSLLVK
HLDE_PSYIN      DQSVRNLKGQGRPVNPVDRRMAVLAGLGAVDWVIEF-----TEETPQRLIAEILPDLLVK
HLDE_AERHH      DESVRRLKGPGRPVNPTERRMAVLAALGAVDWVVPF-----AEDTPQRLIAEVLPDLLVK
HLDE_AERS4      DGSVRRLKGPGRPVNSTDRRMAVLAGLGAVDWVVPF-----AEDTPQRLIAEVLPDLLVK
HLDE_SHEB5      DASVKRLKGDGRPVNQVDRRMAVLAGLASVDWVVPF-----SEDTPQRIITRLLPNLLVK
HLDE_SHEB9      DASVKRLKGDGRPVNQVDRRMAVLAGLASVDWVVPF-----SEDTPQRIITRLLPNLLVK
HLDE_SHEB8      DASVKRLKGDGRPVNQVDRRMAVLAGLASVDWVVPF-----SEDTPQRIITRLLPNLLVK
HLDE_SHEPC      DASVKRLKGEGRPVNQVDRRMAVLAGLASVDWVVPF-----SEDTPQRIIARLLPDLLVK
HLDE_SHESW      DASVKRLKGEGRPVNQVDRRMAVLAGLASVDWVVPF-----SEDTPQRIIARLLPDLLVK
HLDE_SHESM      DASVKRLKGEGRPVNQVDRRMAVLAGLAAVDWVVPF-----SEDTPQRIIARLLPDLLVK
HLDE_SHESR      DASVKRLKGEGRPVNQVDRRMAVLAGLAAVDWVVPF-----SEDTPQRIIARLLPDLLVK
HLDE_SHESA      DASVKRLKGEGRPVNQVDRRMAVLAGLAAVDWVVPF-----SEDTPQRIIARLLPDLLVK
HLDE_SHEON      DASVKRLKGEGRPVNQVDRRMAVLAGLASVDWVVPF-----SEDTPQRIIARLLPDLLVK
HLDE_SHEDO      DASVKRLKGDGRPVNQVDRRMAVLAGLAAVDWVVPF-----CEDTPERIITRLLPDALVK
HLDE_SHEFN      DSSVTRLKGPGRPVNPVDRRMAVLAGLASVDWVVPF-----TEDTPQRIITRLLPDSLVK
HLDE_SHEAM      DDSVRRLKGDGRPVNSVDRRMAVLAGLASVDWVVPF-----SEDTPQRVIARLLPDLLVK
HLDE_SHEHH      DASVKRLKGEGRPVNTEDRRMTVLAALASVDWVVPF-----TEDTPQRIISRLLPDLLVK
HLDE_SHEPA      DASVKRLKGEGRPVNSEDRRMTVLAALASVDWVVPF-----SEDTPQRIISRLLPDLLVK
HLDE_SHELP      DDSVKRLKGDGRPVNKLDRRMAVLAGLASVDWVVPF-----SEDTPQRIISRLLPNKLVK
HLDE_SHESH      DDSVKRLKGEGRPVNQSDRRMAVLAGLASVDWVVPF-----TEDTPQRIISRLLPDLLVK
HLDE_CHRSD      DASVGRLKGPKRPINALERRMQVLAGLSAVDWVVPF-----GEETPARLIAEVLPDVLVK
HLDE_PSEAE      DASVTRLKGVGRPINSVDRRMAVLAGLGAVDWVVSF-----AEDTPERLLEQVRPDVLVK
HLDE_PSEAB      DASVTRLKGVGRPINSVDRRMAVLAGLGAVDWVVSF-----AEDTPERLLEQVRPDVLVK
HLDE_PSEA7      DASVTRLKGAGRPINSVDRRMAVLAGLGAVDWVVSF-----AEDTPERLLEQVRPDVLVK
HLDE_PSEMY      DASVSRLKGPGRPINAVDRRMAVLAGLGAVDWVVSF-----AEDTPERLLKQVQPDVLVK
HLDE_PSEP1      DASVSRLKGPGRPINSVDRRMAVLAGLGAVDWVISF-----PEGTPENLLSQVKPDVLVK
HLDE_PSEPK      DASVSRLKGPGRPINSVDRRMAVLAGLGAVDWVISF-----PEGTPENLLSQVKPDVLVK
HLDE_PSEPG      DASVSRLKGPGRPINSVDRRMAVLAGLGAVDWVISF-----PEGTPENLLSQVKPDVLVK
HLDE_PSEE4      DASVSRLKGPGRPINSVDRRMAVLAGLGAVDWVISF-----PEATPENLLRQVKPDVLVK
HLDE_PSEF5      DASVSRLKGPGRPINSVDRRMAVLAGLGAVDWVISF-----PEGTPENLLSQVRPDVLVK
HLDE_PSEPF      DASVSRLKGPGRPINSVDRRMAVLAGLGAVDWVISF-----AEGTPENLLREVKPDVLVK
HLDE_PSEU2      DASVSRLKGPGRPINSVERRMAVLAGLGAVDWVISF-----PEGTPENLLTHVKPDVLVK
HLDE_PSESM      DASVSRLKGPGRPINSVDRRMAVLAGLGAVDWVISF-----PEGTPENLLTHVKPDVLVK
HLDE_PSE14      DASVSRLKGPGRPINSVDRRMAVLAGLGAVDWVISF-----PEGTPENLLSHVKPDVLVK
HLDE_PSEU5      DGSVSRLKGPGRPINSVDRRMAVLAGLEAVDWVVCF-----AEDTPENLLAQVRPDVLVK
HLDE_HAHCH      DASVSRLKGPARPINPLERRMAVLAGLEAVDWVTWY-----EDDTPERLLEILKPDILVK
HLDE_ALCBS      DESIRRLKGPGRPINPLERRMAVLAALEAVDWVVAF-----DTDTPEPLLESIKPDVLVK
HLDE_ALKEH      DASVRRLKGEGRPINPVQQRMAVLAGLASVDWVVPF-----SEDTPARVIGAVLPDVLVK
HLDE_HALHL      DASVARLKGAERPVTPLAQRMAVLAALDTVDWVVPF-----SEDTPARLIEAVLPDRLVK
HLDE_NITOC      DASVQRLKGKNRPINSLAQRLTVLAALHDVDWVVPF-----SEDTPARLIERVLPDILVK
HLDE_COXBU      DNSVRRLKGKDRPINSLQARMEVLTALRAIDWVVPF-----SEDTPARLITEVLPNILVK
HLDE_COXBR      DNSVRRLKGKDRPINSLQARMEVLTALRAIDWVVPF-----SEDTPARLITEVLPNILVK
HLDE_COXBN      DNSVRRLKGKDRPINSLQARMEVLTALRAIDWVVPF-----SEDTPARLITEVLPNILVK
HLDE_METCA      DDSVRRLKGAGRPVNPLPHRMAMLAALESVDWVVAF-----DGDTPRDEICAIRPHVLVK
HLDE_MARMS      DASVKRLKGEKRPINNLIHRMSVLEGVGSIDWVTWF-----DEDTPKEIIEFLTPDVLVK
HLDE_HYDCU      DESVKLLKGDSRPIVELAGRMELLSALSCVDWVVPF-----NEETPERLICKLAPDVLVK
HLDE_DICNV      DESVKRLKGADRPANTLASRAAVLAALHSVDWVISF-----AEDTPADLIAAINPDILVK
HLDE_MARHV      DASVRRLKGEERPVNSLEDRMEVLSALACVDWVIPFGDNTVENDTPEQLIKRVNPQVLAK
HLDE_PSEHT      DASISRLKGADRPINPLDERAMVLSALSSVDWVIPFGSAD-ENDTPAKLIEQISPDILVK
HLDE_STRCO      DASVRRGKGGGRPVNPLADRVRVLRALACVDAVAVF-----DEDTPERLLGELRPDVWVK
                : *    **  **      *  :: ..  :* :  :         *   :    *    *

HLDE_MAGSA      GADYTI-DKVVGADLVQSWGGKVVLAELVNGQSTTNTIKKMNGN--------
HLDE_RHORT      GADYTV-DTVVGSDVVLTNGGRVLLADLKAGFSTTSTIARLHGGSRRSGDTL
HLDE_PARL1      GGDYTI-DKIVGADFVQAHGGRVEIVDIVPGFSTTGTLARLKG---------
HLDE_ACICJ      GADYTH-DTVVGAREVESWGGRVMLAELLPGHSTTATVTRLRS---------
HLDE_RHILO      GADYTI-DTVVGADVVQKAGGRVVLVDLVAGKSTTGTIGKLRAGSTS-----
HLDE_CAUVC      GADYTV-ETVVGSDVVLGYGGKVVLAELKQGQSTTNLIARMNS---------
HLDE_CAUSK      GADYTV-ETVVGSDVVLAYGGKVVLAQLKAGQSTTNLIGRMNAPAVGG----
HLDE_BRASB      GGDYTR-EQVVGHEVVEAGGGEVILIDILKGHSTTALVDRARSDGR------
HLDE_BRASO      GGDYTR-EQVVGHEVVEAAGGEVLLIDILKGHSTTALVDRARSDQR------
HLDE_RHOPS      GGDYTR-EQVVGHEIVAARGGEVLLVDVLPGFSTTSLVEKAREGTT------
HLDE_RHOP2      GGDYTR-EQVVGHEIVAARGGEVLLIDVLPGFSTTSLVEKAREGTS------
HLDE_RHOPA      GGDYTR-EQVVGHEIVAAKGGDVLLVDVLPGFSTTSLVARAREGQS------
HLDE_RHOP5      GGDYTR-EQVVGHEVVAANGGEVLLIDILPGHSTTSLVARAQNGKS------
HLDE_RHOPB      GGDYTR-EQVVGHEIVAAQGGEVVLVDILPGHSTTTLVARAQNGKA------
HLDE_BRADU      GGDYTR-EQVVGHEVVEAAGGVVVLVDILQGFSTTALVHRARGGAK------
HLDE_NITHX      GGDYSL-EQVVGQELVTARGGEVVLIDILRGFSTTSLVKRAGGRA-------
HLDE_NITWN      GGDYSL-EQVVGQELVTARGGEVILIDILQGFSTTSLVKRAGGA--------
HLDE_HYPNA      GGDYTR-ESIVGADIVEARGGEIVIVPLVAGHSTTAIIARSETGK-------
HLDE_AZOC5      GADYAP-HEVVGADVVTANGGELVLVDLVAGKSTSSLVAKART---------
HLDE_GLUOX      GADYTE-DQVVGADVVKSYGGKVVLVDLVEGQSTTRLVRGMQSAPS------
HLDE_GLUDA      GADYRP-DQVVGADVVRQAGGRVVLADLEDGKSTTRTIGRIRAAGAADR---
HLDE_GRABC      GADYRE-EDVVGGDVVRAAGGKVELIDLVPGRSTTGIVKKISTLT-------
HLDE_MAGMM      GADYRE-DQVVGGDLVRRWGGRVALVQLVQGRSTTGIVQRISAQK-------
HLDE_METFK      GSDYTE-DQVVGGAEVKSWGGKVALIDVVPGRSTSNIIRKLAS---------
HLDE_KORVE      GGDYAV-SGVVGAEEVQSWGGHVKIVPIVEGFSTTKLIEKGH----------
HLDE_ARCB4      GGDYEG-KDVVGQDIAD----ELKLVKFVDGKSTTNTIKRIQENEKCNN---
HLDE_SULDN      GGDYEG-KSVIGTEFAQ----ELKLVDFVDGKSTTKTIQKIKGDLHV-----
HLDE_NITSB      GGDYKG-KEVVGSDIAK----EVRLIDFVEGKSTTAIVERMRSC--------
HLDE_HELHP      GGDYHN-KEVVGKEYAK----EVVLIDFIEGHSTSNIIESIQRSKICKHS--
HLDE_WOLSU      GGDYEG-KEVVGSDLVK----EVKLIEFLEGRSTSAVVKKIQGS--------
HLDE_HELPY      GADYLN-KEVIGSEFAK----ETHLMEFEEGYSTSAIIEKIKRTCND-----
HLDE_HELPH      GADYLN-KEVIGSEFAK----ETHLMEFEEGYSTSAIIEKIKRTHND-----
HLDE_HELPJ      GADYLN-KEVIGSELAK----ETRLIEFEEGYSTSAIIEKIKRTHND-----
HLDE_HELAH      GADYLD-KEVIGSEFAK----ETCLMAFEEGYSTSAIIEKIKRAYND-----
HLDE_CAMC1      GADYKG-KEVVGSDIVK----EVRLIDFVEGKSTTGIIKRIKDAKNDDKK--
HLDE_CAMC5      GADYEG-KEVVGSDIVK----DVRLVEFVDGKSTSAIVKRIKDADK------
HLDE_CAMFF      GADYTG-KKVVGSEFVR----EVKLIDFVDGKSTTNIINKIKG---------
HLDE_CAMJE      GADYKD-KLVVGADIVS----RVELIDFEEGFSTSKIIEKIKDKK-------
HLDE_CAMJJ      GADYKD-KIVVGADIVS----KVELIDFEEGFSTSKIIEKIKDKK-------
HLDE_CAMJ8      GADYKD-KLVVGADIVS----KVELIDFEEGFSTSKIIEKIKDKK-------
HLDE_CAMJD      GADYKD-KIVVGADIVS----KVELIDFEEGFSTSKIIEKIKDKK-------
HLDE_CAMJR      GADYKD-KLVVGSNLIS----RVELIDFEEGFSTSKIIEKIKDKK-------
HLDE_GEOMG      GGDYTP-EGVVGKDVVESYGGRVELVTFVDGRSTTNIIDKILRAYGEE----
HLDE_GEOSL      GGDYTL-DGVVGREVVESYGGRVELVAFVDGRSTTNIIEKILKAYGEE----
HLDE_GEOUR      GGDYTP-ERVVGKEVVESYGGRVELVTFVDGKSTTNIIEKIRTGSIKE----
HLDE_PELPD      GGDYTP-EGVVGRELVESYGGRVELVSFVDGKSTTNIIERVLERYS------
HLDE_PELCD      GGDYTP-ETVVGKDLVESYGGRVELIDLVDGRSTTNIIERILDRYEQG----
HLDE_ECOLI      GGDYKP-EEIAGSKEVWANGGEVLVLNFEDGCSTTNIIKKIQQDKKG-----
HLDE_ECOHS      GGDYKP-EEIAGSKEVWANGGEVLVLNFEDGCSTTNIIKKIQQDKKG-----
HLDE_ECO24      GGDYKP-EEIAGSKEVWANGGEVLVLNFEDGCSTTNIIKKIQQDKKG-----
HLDE_ECOL5      GGDYKP-EEIAGSKEVWANGGEVLVLNFEDGCSTTNIIKKIQQDKKG-----
HLDE_SHIBS      GGDYKP-EEIAGSKEVWANGGEVLVLNFEDGCSTTNIIKKIQQDKKG-----
HLDE_ECO57      GGDYKP-EEIAGSKEVWANGGEVLVLNFEDGCSTTNIIKKIQQDKKG-----
HLDE_SHISS      GGDYKP-EEIAGSKEVWANGGEVLVLNFEDGCSTTNIIKKIQQDKKG-----
HLDE_SHIFL      GGDYKP-EEIAGSKEVWANGGEVLVLNFEDGCSTTNIIKKIQQDKKG-----
HLDE_SHIF8      GGDYKP-EEIAGSKEVWANGGEVLVLNFEDGCSTTNIIKKIQQDKKG-----
HLDE_SHIDS      GGDYKP-EEIAGSKEVWANGGEVLVLNFEDGCSTTNIIKKIQQDKKG-----
HLDE_ECOUT      GGDYKP-EEIAGSKEVWANGGEVLVLNFEDGCSTTNIIKKIQLDKKG-----
HLDE_ECOK1      GGDYKP-EEIAGSKEVWANGGEVLVLNFEDGCSTTNIIKKIQLDKKG-----
HLDE_ECOL6      GGDYKP-EEIAGSKEVWANGGEVLVLNFEDGCSTTNIIKKIQLDKKG-----
HLDE_SALCH      GGDYKP-EEIAGSEEVWANGGEVMVLNFEDGCSTTNIIKKIQTESEK-----
HLDE_SALTI      GGDYKP-EEIAGSEEVWANGGEVMVLNFEDGCSTTNIIKKIQTESEK-----
HLDE_SALTY      GGDYKP-EEIAGSEEVWANGGEVMVLNFEDGCSTTNIIKKIQTESEK-----
HLDE_SALPA      GGDYKP-EEIAGSEEVWANGGEVMVLNFEDGCSTTNIIKKIQTESEK-----
HLDE_CITK8      GGDYKP-EEIAGSEEVWANGGEVLVLNFEDGCSTTNIIKKIQKDSDK-----
HLDE_ENT38      GGDYKP-EQIAGSEEVWANGGDVMVLNFEDGCSTTNIIKKIQKDSQ------
HLDE_CROS8      GGDYKP-EDIAGSKEVWANGGDVMVLNFEDGCSTTNIIKKIQKNS-------
HLDE_KLEP7      GGDYKP-EQIAGSEEVWANGGEVLVLNFEDGCSTTNIIKKIQKDSDK-----
HLDE_PECAS      GGDYQP-HEIAGSEEVWANGGEVKVLNFEDGCSTTNIINMIKASTSQS----
HLDE_YERPE      GGDYKP-HEIAGSEEVWAAGGEVKVLNFEDGVSTTNIIQSIKNGRG------
HLDE_YERPP      GGDYKP-HEIAGSEEVWAAGGEVKVLNFEDGVSTTNIIQSIKNGRG------
HLDE_YERPA      GGDYKP-HEIAGSEEVWAAGGEVKVLNFEDGVSTTNIIQSIKNGRG------
HLDE_YERPN      GGDYKP-HEIAGSEEVWAAGGEVKVLNFEDGVSTTNIIQSIKNGRG------
HLDE_YERPS      GGDYKP-HEIAGSEEVWAAGGEVKVLNFEDGVSTTNIIQSIKNGRG------
HLDE_YERP3      GGDYKP-HEIAGSEEVWAAGGEVKVLNFEDGVSTTNIIQSIKNGRG------
HLDE_YERE8      GGDYKP-DEIAGSAEVWAAGGEVKVLNFEDGVSTTNIIQSIKNGLG------
HLDE_SERP5      GGDYKP-EDIAGSTEVWANGGDVKVLNFEDGLSTTNIIKAIKDGRG------
HLDE_SODGM      GGDYQP-HQIAGSKEVWDNGGDVLVLNFEDGCSTTNIINAIKRRAGQRTVV-
HLDE_PHOLL      GGDYKP-EEIAGSEEVWAAGGDVKVLNFEDGISTTNIIKAIKNQ--------
HLDE_ACTPL      GGDYKP-EEIAGSQEVWANGGEVKVLNFENGCSTTNVIKKIQASK-------
HLDE_ACTP2      GGDYKP-EEIAGSQEVWANGGEVKVLNFENGCSTTNVIKKIQASK-------
HLDE_HAEDU      GGDYKP-EQIVGCQEVWANGGNVKALNFEDGCSTTDVIKKIQAIR-------
HLDE_ACTSZ      GGDYKP-EEIAGSKEVWANGGDVSVLNFENGCSTSNVIKKIRDLKD------
HLDE_MANSM      GGDYKP-EDIAGSKEVWANGGDVKVLNFENGCSTSNVIQKIRELKD------
HLDE_HAES1      GGDYKP-EEIVGSKEVWLNGGEVKVLNFENGCSTTNVIKKIQQLKE------
HLDE_PASMU      GGDYKP-EDIAGSQEVWASGGDVKVLNFENGCSTSNVISKIQQLKD------
HLDE_HAEI8      GGDYKP-EEIAGSKEVWANGGDVKVLNFENGCSTTNVIEKIKLLKD------
HLDE_HAEIE      GGDYKP-EEIAGSKEVWANGGDVKVLNFENGCSTTNVIEKIKLLKD------
HLDE_HAEIG      GGDYKP-EEIAGSKEVWANGGDVKVLNFENGCSTTNVIEKIKLLKD------
HLDE_HAEIN      GGDYKP-EEIAGSKEVWANGGDVKVLNFENGCSTTNVIEKIKLLKD------
HLDE_BLOFL      GGDYNV-NNIVGGKEVLRQGGQVCVLKFQEDCSSSSIIDTMEINEIN-----
HLDE_BLOPB      GGDYHV-CDIEGSQGVLNRGGTVRVLNFQTGCSSSNIINAIKRKN-------
HLDE_VIBCB      GGDYKP-EEIAGGKEVIAAGGEVRVLNFEDGCSTSEIINAIKGGKG------
HLDE_VIBPA      GGDYKP-EEIAGGKEVIAAGGEVRVLNFEDGCSTSEIINAIKGGKG------
HLDE_VIBVU      GGDYKP-EDIAGGKEVIAAGGEVKVLNFEDGCSTTEIIDAIKGGRG------
HLDE_VIBVY      GGDYKP-EDIAGGKEVIAAGGEVKVLNFEDGCSTTEIIDAIKGGRG------
HLDE_VIBC3      GGDYKP-EEIAGGKEVIAAGGEVKVLNFEEGCSTTEIIEAIKGGRG------
HLDE_ALIF1      GGDYAI-EDIAGGAEVIAAGGEVKVLNFEDGCSTTGIIEAIKGGRG------
HLDE_PHOPR      GGDYKP-EDIAGGKEVIAAGGEVRVLSFEDGCSTSKIIEAIRGGKG------
HLDE_PSYIN      GGDYLP-EDIAGGKEVIANGGEVRVLQFEEGCSTSEIIKTIRNNS-------
HLDE_AERHH      GGDYKP-EEIAGYAEVTANGGEVRVLNFEDGCSTSDIIKTIRERG-------
HLDE_AERS4      GGDYKP-KDIAGYDEVTANGGEVRVLNFEDGCSTSDIIKTIRERG-------
HLDE_SHEB5      GGDYKL-EDIAGGAEVIAAGGQVQVLGFEDGISTTAIIQNIMANQ-------
HLDE_SHEB9      GGDYKL-EDIAGGAEVIAAGGQVQVLGFEDGISTTAIIQNIMANQ-------
HLDE_SHEB8      GGDYKL-EDIAGGAEVIAAGGQVQVLGFEDGFSTTAIIQNIMANQ-------
HLDE_SHEPC      GGDYKI-EDIAGGAEVIAAGGQVQVLGFEDGISTTAIIQNIMANQ-------
HLDE_SHESW      GGDYKI-EDIAGGAEVIAAGGQVQVLGFEDGISTTAIIQNIMANQ-------
HLDE_SHESM      GGDYKI-EDIAGGAEVIAAGGQVQVLGFEDGISTTAIIQNIMAKQ-------
HLDE_SHESR      GGDYKI-EDIAGGAEVIAAGGQVQVLGFEDGISTTAIIQNIMAKQ-------
HLDE_SHESA      GGDYKV-EDIAGGAEVIAAGGQVQVLGFEDGISTTAIIQNIMAKQ-------
HLDE_SHEON      GGDYKV-EDIAGGAEVISAGGQVQVLGFEDGISTTAIIQNIMAKQ-------
HLDE_SHEDO      GGDYKV-EDIAGGAQVIAAGGKVEVLGFEDGVSTTSIIQNIMARQ-------
HLDE_SHEFN      GGDYKV-EDIAGGAEVIAAGGKVEVLGFEDGVSTTAIIQNIMSQK-------
HLDE_SHEAM      GGDYKV-EDIAGGAEVIANGGQVKVLGFEDGVSTTAIIQNIMSRH-------
HLDE_SHEHH      GGDYKV-EDIAGGAEVMAAGGQVKVLGFEDGISTTAIIQNIMANQ-------
HLDE_SHEPA      GGDYKV-EDIAGGSEVMAAGGQVKVLGFEDGISTTAIIQNIMANQ-------
HLDE_SHELP      GGDYNV-EDIAGGKEVIAAGGSVEVLGFEDGVSTTAIIENIMAKQ-------
HLDE_SHESH      GGDYKI-EDIAGGKEVIAAGGSVKVLGFEDGVSTTSIIENIMANQ-------
HLDE_CHRSD      GGDYRP-EDIAGGEAVMAAGGEVRVLNFEDGVSTTAMIDTILDREG------
HLDE_PSEAE      GGDYGV-EQVVGAQIVKAYGGEVRVLGLVENSSTTAIVEKIRQKG-------
HLDE_PSEAB      GGDYGV-EQVVGAQIVKAYGGEVRVLGLVENSSTTAIVEKIRQKG-------
HLDE_PSEA7      GGDYGV-EQVVGAQIVKAYGGEVRVLGLVENSSTTAIVEKIRQKG-------
HLDE_PSEMY      GGDYGI-DQVVGADIVQAYGGEVRVLGLVENSSTTAIVEKIRNK--------
HLDE_PSEP1      GGDYGI-DQVVGADIVKGYGGTVKVLGLVENSSTTAIVEKIRKN--------
HLDE_PSEPK      GGDYGI-DQVVGADIVKGYGGTVKVLGLVENSSTTAIVEKIRKN--------
HLDE_PSEPG      GGDYGI-DQVVGADIVKAYGGTVKVLGLVENSSTTAIVEKIRKN--------
HLDE_PSEE4      GGDYGI-DQVVGADIVKAYGGTVKVLGLVENSSTTAIVEKIRKH--------
HLDE_PSEF5      GGDYSI-DQVVGADIVGAYGGTVKVLGLVENSSTTAIVEKIRKTDKAE----
HLDE_PSEPF      GGDYGI-DQVVGADIVKAYGGAVKVLGLVENSSTTAIVEKIRKSE-------
HLDE_PSEU2      GGDYGV-DQVVGADIVQAYGGEVRVLGLVENSSTTAIVEKIRGQG-------
HLDE_PSESM      GGDYGI-DQVVGADIVQAYGGEVRVLGLVENSSTTAIVEKIRGQG-------
HLDE_PSE14      GGDYGV-DQVVGADIVQAYGGDVRVLGLVENSSTTAIVEKIRGQG-------
HLDE_PSEU5      GGDYGV-DQVVGADLVKAYGGVVKVLGLVENSSTTAIVEKIRKA--------
HLDE_HAHCH      GGDYSK-EQVVGWEIVEGYGGEVRALDFLDNCSTTAIVEKIRKDQVK-----
HLDE_ALCBS      GGDYSV-DQVVGHEFVKSYGGEVKVLDFIDDISTTKIVERIREKD-------
HLDE_ALKEH      GGDYQP-EAIAGHDAVVAHGGRVEILDFLDGCSTSAMIERMQSAPDT-----
HLDE_HALHL      GGDYQP-EQIAGHDVVVAAGGSVEVLPLLAGASTTDLIARIRSRG-------
HLDE_NITOC      GGDYTP-EQIAGANAVVANGGKIIILTYQQGCSTSQIIDIIRKN--------
HLDE_COXBU      GGDYQP-SQIAGGDEVVKNGGKVLTIPIKEGFSTSRLVEKMLN---------
HLDE_COXBR      GGDYQP-SQIAGGDEVVKNGGKVLTIPIKEGFSTSRLVEKMLN---------
HLDE_COXBN      GGDYQP-SQIAGGDEVVKNGGKVLTIPIKEGFSTSRLVEKMLN---------
HLDE_METCA      GGDYADITAIVGHDCVLETGGEVRILDFVEGHSTTRIIEAIRNG--------
HLDE_MARMS      GGDYTI-ETIVGADHVLAHGGEVKVLTFVDGYSTTSIIEKANL---------
HLDE_HYDCU      GGDYKP-DEIAGAQCVWDKGGEVAVLSFWEGYSTTRMVDKIQEAEIKEGAAQ
HLDE_DICNV      GGDNRV-DDIPGAQWVREHGGSVRVLSYVDGFSTTKTLQQFLSHHEKD----
HLDE_MARHV      GGDYSI-DTIVGADFVQENGGEVAILPTVEGRSTTGLIKKVRG---------
HLDE_PSEHT      GGDYTV-EQIAGAEHVLLHGGKVEVLEFLDGCSTSKVISKIKQ---------
HLDE_STRCO      GGDYAG-ADLPEAGLLKEWGGQAVLLPYLDGRSSTALLARAAEGAR------
                *.*      :                    . *::  :