CLUSTAL format seed alignment for MF_01606

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

YTFE_CITK8      MSFRDQPLGELALSIPRASALFRKYDMDYCCGGKQTLARAAARKELDVEAIEAELAQLAE
YTFE_ENT38      MAFRDQPLGELVLSIPRASALFRKYDMDYCCGGKQTLERAALRKELDVDAIEAELAQLAE
YTFE_SHIF8      MAYRDQPLGELALSIPRASALFRKYDMDYCCGGKQTLARAAARKELDVEVIEAELAKLAE
YTFE_SHISS      MAYRDQPLGELALSIPRASALFRKYDMDYCCGGKQTLARAAARKELDVEVIEAELAKLAE
YTFE_SHIFL      MAYRDQPLGELALSIPRASALFRKYDMDYCCGGKQTLARAAARKELDVEVIEAELAKLAE
YTFE_SHIDS      MAYRDQPLGELALSIPRASALFRKYDMDYCCGGKQTLARAAARKELDVEVIEAELAKLAE
YTFE_ECOLI      MAYRDQPLGELALSIPRASALFRKYDMDYCCGGKQTLARAAARKELDVEVIEAELAKLAE
YTFE_ECOHS      MAYRDQPLGELALSIPRASALFRKYDMDYCCGGKQTLARAAARKELDVEVIEAELAKLAE
YTFE_SHIB3      MAYRDQPLGELALSIPRASALFRKYDMDYCCGGKQTLARAAARKELDVEVIEAELAKLAE
YTFE_ECO45      MAYRDQPLGELALSIPRASALFRKYDMDYCCGGKQTLARAAARKELDVEVIEAELAKLAE
YTFE_ECO24      MAYRDQPLGELALSIPRASALFRKYDMDYCCGGKQTLARAAARKELDVEVIEAELAKLAE
YTFE_ECO55      MAYRDQPLGELALSIPRASALFRKYDMDYCCGGKQTLARAAARKELDVEVIEAELAKLAE
YTFE_ECOLC      MAYRDQPLGELALSIPRASALFRKYDMDYCCGGKQTLARAAARKELDVEVIEAELAKLAE
YTFE_ECOSE      MAYRDQPLGELALSIPRASALFRKYDMDYCCGGKQTLARAAARKELDVEVIEAELAKLAE
YTFE_ECOBW      MAYRDQPLGELALSIPRASALFRKYDMDYCCGGKQTLARAAARKELDVEVIEAELAKLAE
YTFE_ECODH      MAYRDQPLGELALSIPRASALFRKYDMDYCCGGKQTLARAAARKELDVEVIEAELAKLAE
YTFE_SHIBS      MAYRDQPLGELALSIPRASALFRKYNMDYCCGGKQTLARAAARKELDVEVIEAELAKLAE
YTFE_ECO8A      MAYRDQPLGELALSIPRASALFRKYDMDYCCGGKQTLSRAAARKELDVEVIEAELAKLAE
YTFE_ECO57      MAYRDQPLGELALSIPRASALFRKYDMDYCCGGKQTLARAAARKELDVEVIEAELAKLAE
YTFE_ECO5E      MAYRDQPLGELALSIPRASALFRKYDMDYCCGGKQTLARAAARKELDVEVIEAELAKLAE
YTFE_ECOLU      MAYRDQPLGELALSIPRASALFRKYDMDYCCGGKQTLARAAARKELDVEVIEAELAKLAE
YTFE_ECOL5      MAYRDQPLGELALSIPRASALFRKYDMDYCCGGKQTLARAAARKELDVEVIEAELAKLAE
YTFE_ECOK1      MAYRDQPLGELALSIPRASALFRKYDMDYCCGGKQTLARAAARKELDVDVIEAELAKLAE
YTFE_ECO7I      MAYRDQPLGELALSIPRASALFRKYDMDYCCGGKQTLARAAARKELDVDVIEAELAKLAE
YTFE_ECOSM      MAYRDQPLGELALSIPRASALFRKYDMDYCCGGKQTLARAAARKELDVDVIEAELAKLAE
YTFE_ECOUT      MAYRDQPLGELALSIPRASALFRKYDMDYCCGGKQTLARAAARKELDVDVIEAELAKLAE
YTFE_ECO27      MAYRDQPLGELALSIPRASALFRKYDMDYCCGGKQTLARAAARKELDVDVIEAELAKLAE
YTFE_ESCF3      MAYRDQPLGELALSIPRASALFRKYDMDYCCGGKQTLARAAARKELDVDVIEAELAKLAE
YTFE_ECOL6      MAYRDQPLGELALSIPRASALFRKYDMDYCCGGKQTLARAAARKELDVDVIEAELAKLAE
YTFE_ECO81      MAYRDQPLGELALSIPRASALFRKYDMDYCCGGKQTLARAAARKELDVDVIEAELAKLAE
YTFE_KLEP3      MAFRDQPLGELALTIPRASALFRQYDMDYCCGGKQTLARAASRKALDVAVIEAELAKLAE
YTFE_KLEP7      MAFRDQPLGELALTIPRASALFRQYDMDYCCGGKQTLARAASRKALDVAVIEAELAKLAE
YTFE_SALDC      MAYRDQPLGELALSIPRASALFRQYDMDYCCGGKQTLARAAARHDVDIDIIEAQLAQLAE
YTFE_SALTI      MAYRDQPLGELALSIPRASALFRQYDMDYCCGGKQTLARAAARHDVDIDIIEAQLAQLAE
YTFE_SALEP      MAYRDQPLGELALSIPRASALFRQYDMDYCCGGKQTLARAAARHDVDIDIIEAQLAQLAE
YTFE_SALG2      MAYRDQPLGELALSIPRASALFRQYDMDYCCGGKQTLARAAARHDVDIDIIEAQLAQLAE
YTFE_SALHS      MAYRDQPLGELALSIPRASALFRQYDMDYCCGGKQTLARAAARHDVDIDIIEAQLAQLAE
YTFE_SALNS      MAYRDQPLGELALSIPRASALFRQYDMDYCCGGKQTLARAAARHDVDIDIIEAQLAQLAE
YTFE_SALPA      MAYRDQPLGELALSIPRASALFRQYDMDYCCGGKQTLARAAARHDVDIDIIEAQLAQLAE
YTFE_SALPK      MAYRDQPLGELALSIPRASALFRQYDMDYCCGGKQTLARAAARHDVDIDIIEAQLAQLAE
YTFE_SALPB      MAYRDQPLGELALSIPRASALFRQYDMDYCCGGKQTLARAAARHDVDIDIIEAQLAQLAE
YTFE_SALPC      MAYRDQPLGELALSIPRASALFRQYDMDYCCGGKQTLARAAARHDVDIDIIEAQLAQLAE
YTFE_SALA4      MAYRDQPLGELALSIPRASALFRQYDMDYCCGGKQTLARAAARHDVDIDIIEAQLAQLAE
YTFE_SALSV      MAYRDQPLGELALSIPRASALFRQYDMDYCCGGKQTLARAAARHDVDIDIIEAQLAQLAE
YTFE_SALCH      MAYRDQPLGELALSIPRASALFRQYDMDYCCGGKQTLARAATRHDVDIDIIEAQLAQLAE
YTFE_SALTY      MAYRDQPLGELALSIPRASALFRQYDMDYCCGGKQTLARAAARHDVDIDIIEAQLAQLAE
YTFE_CROS8      MAFRDQPLGELALTIPRASALFRKYNLDFCCGGKQTLLRAATRQALDLDVIESELAALAE
YTFE_EDWI9      MTYRDRPLGELAISIPRATRLFRQYELDFCCGGKLTLQRAAARHSLDLVMLESQLAELDS
YTFE_PECAS      MAYRDQSLGELAIAIPRATKLFRELNLDFCCGGKQTLSRAAGKKDLNIDELEAQLEKLAA
YTFE_PECCP      MAYRDQSLGELAIAIPRATKLFRELNLDFCCGGKQTLSRAAGKKDLNIDELEAQLEKLAA
YTFE_YERPE      MDYRNQSLGALAIAIPRATKLFRQHQLDFCCGGKQTLLRAANKLNLDIDALEAQLSALQT
YTFE_YERPP      MDYRNQSLGALAIAIPRATKLFRQHQLDFCCGGKQTLLRAANKLNLDIDALEAQLSALQT
YTFE_YERPG      MDYRNQSLGALAIAIPRATKLFRQHQLDFCCGGKQTLLRAANKLNLDIDALEAQLSALQT
YTFE_YERPA      MDYRNQSLGALAIAIPRATKLFRQHQLDFCCGGKQTLLRAANKLNLDIDALEAQLSALQT
YTFE_YERPN      MDYRNQSLGALAIAIPRATKLFRQHQLDFCCGGKQTLLRAANKLNLDIDALEAQLSALQT
YTFE_YERPB      MDYRNQSLGALAIAIPQATKLFRQHQLDFCCGGKQTLLRAANKLNLDIDALEAQLSALQT
YTFE_YERPS      MDYRNQSLGALAIAIPRATKLFRQHQLDFCCGGKQTLLRAANKLNLDIDALEAQLSALQT
YTFE_YERP3      MDYRNQSLGALAIAIPRATKLFRQHQLDFCCGGKQTLLRAANKLNLDIDALEAQLSALQT
YTFE_YERPY      MDYRNQSLGALAIAIPRATKLFRQHQLDFCCGGKQTLLRAANKLNLDIDALEAQLSALQT
YTFE_DICC1      MHYRDQSLGELAITIPRATALFREFNLDFCCGGKQTLLRAATKRALDIDMLESRLADLST
YTFE_DICP7      MHYREKSLGELAIAIPRATALFREFNLDFCCGGKQTLQHAAGKRQLDIAMLEARLAELDA
                * :*::.** *.::**:*: ***: ::*:***** ** :** :  :::  :*:.*  *  

YTFE_CITK8      QP-IEKDWRTAPLAEIIDHIIVRYHDRHREQLPELILQATKVERVHADKPSVPKGLAKYL
YTFE_ENT38      QP-IDKDWRTVALGEIIDHIIVRYHDRHREQLPELILQATKVERVHADKASVPRGLAKYL
YTFE_SHIF8      QP-IEKDWRSAPLAEIIDHIIVRYHDRHREQLPELILQATKVERVHADKPSVPKGLTKYL
YTFE_SHISS      QP-IEKDWRSAPLAEIIDHIIVRYHDRHREQLPELILQATKVERVHADKPSVPKGLTKYL
YTFE_SHIFL      QP-IEKDWRSAPLAEIIDHIIVRYHDRHREQLPELILQATKVERVHADKPSVPKGLTKYL
YTFE_SHIDS      QP-IEKDWRSAPLAEIIDHIIVRYHDRHREQLPELILQATKVERVHADKPSVPKGLTKYL
YTFE_ECOLI      QP-IEKDWRSAPLAEIIDHIIVRYHDRHREQLPELILQATKVERVHADKPSVPKGLTKYL
YTFE_ECOHS      QP-IEKDWRSAPLAEIIDHIIVRYHDRHREQLPELILQATKVERVHADKPSVPKGLTKYL
YTFE_SHIB3      QP-IEKDWRSAPLAEIIDHIIVRYHDRHREQLPELILQATKVERVHADKPSVPKGLTKYL
YTFE_ECO45      QP-IEKDWRSAPLAEIIDHIIVRYHDRHREQLPELILQATKVERVHADKPSVPKGLTKYL
YTFE_ECO24      QP-IEKDWRSAPLAEIIDHIIVRYHDRHREQLPELILQATKVERVHADKPSVPKGLTKYL
YTFE_ECO55      QP-IEKDWRSAPLAEIIDHIIVRYHDRHREQLPELILQATKVERVHADKPSVPKGLTKYL
YTFE_ECOLC      QP-IEKDWRSAPLAEIIDHIIVRYHDRHREQLPELILQATKVERVHADKPSVPKGLTKYL
YTFE_ECOSE      QP-IEKDWRSAPLAEIIDHIIVRYHDRHREQLPELILQATKVERVHADKPSVPKGLTKYL
YTFE_ECOBW      QP-IEKDWRSAPLAEIIDHIIVRYHDRHREQLPELILQATKVERVHADKPSVPKGLTKYL
YTFE_ECODH      QP-IEKDWRSAPLAEIIDHIIVRYHDRHREQLPELILQATKVERVHADKPSVPKGLTKYL
YTFE_SHIBS      QP-IEKDWRSAPLAEIIDHIIVRYHDRHREQLPELILQATKVERVHADKPSVPKGLTKYL
YTFE_ECO8A      QP-IEKDWRSAPLAEIIDHIIVRYHDRHREQLPELILQATKVERVHADKPSVPKGLTKYL
YTFE_ECO57      QP-IEKDWRSAPLAEIIDHIIVRYHARHREQLPELILQATKVERVHADKPSVPKGLTKYL
YTFE_ECO5E      QP-IEKDWRSAPLAEIIDHIIVRYHARHREQLPELILQATKVERVHADKPSVPKGLTKYL
YTFE_ECOLU      QP-IEKDWRSAPLAEIIDHIIVRYHDRHREQLPELILQATKVERVHADKPSVPKGLTKYL
YTFE_ECOL5      QP-IEKDWRSAPLAEIIDHIIVRYHDRHREQLPELILQATKVERVHADKPSVPKGLTKYL
YTFE_ECOK1      QP-IEKDWRSAPLAEIIDHIIVRYHDRHREQLPELILQATKVERVHADKPSVPKGLTKYL
YTFE_ECO7I      QP-IEKDWRSAPLAEIIDHIIVRYHDRHREQLPELILQATKVERVHADKPSVPKGLTKYL
YTFE_ECOSM      QP-IEKDWRSAPLAEIIDHIIVRYHDRHREQLPELILQATKVERVHADKPSVPKGLTKYL
YTFE_ECOUT      QP-IEKDWRSAPLAEIIDHIIVRYHDRHREQLPELILQATKVERVHADKPSVPKGLTKYL
YTFE_ECO27      QP-IEKDWRSAPLAEIIDHIIVRYHDRHREQLPELILQATKVERVHADKPSVPKGLTKYL
YTFE_ESCF3      QP-IEKDWRSAPLAEIIDHIIVRYHDRHREQLPELILQATKVERVHADKPSVPKGLTKYL
YTFE_ECOL6      QP-IEKDWRSAPLAEIIDHIIVRYHDRHREQLPELILQATKVERVHADKPSVPKGLTKYL
YTFE_ECO81      QP-IEKDWRSAPLAEIIDHIIVRYHDRHREQLPELILQATKVERVHADKPSVPKGLTKYL
YTFE_KLEP3      QP-LSRDWRAAPLPEIIDHIIVRYHDRHREQLPELILQATKVERVHADKPNVPKGLTKYL
YTFE_KLEP7      QP-LSRDWRAAPLAEIIDHIIVRYHDRHREQLPELILQATKVERVHADKPNVPKGLTKYL
YTFE_SALDC      QP-IEKDWRAVPLADIIDHIVVRYHDRHREQLPELILQATKVERVHADKPNVPRGLTKYL
YTFE_SALTI      QP-IEKDWRAVPLADIIDHIVVRYHDRHREQLPELILQATKVERVHADKPNVPRGLTKYL
YTFE_SALEP      QP-IEKDWRAVPLADIIDHIVVRYHDRHREQLPELILQATKVERVHADKPNVPRGLTKYL
YTFE_SALG2      QP-IEKDWRAVPLADIIDHIVVRYHDRHREQLPELILQATKVERVHADKPNVPRGLTKYL
YTFE_SALHS      QP-IEKDWRAVPLADIIDHIVVRYHDRHREQLPELILQATKVERVHADKPNVPRGLTKYL
YTFE_SALNS      QP-IEKDWRAVPLADIIDHIVVRYHDRHREQLPELILQATKVERVHADKPNVPRGLTKYL
YTFE_SALPA      QP-IEKDWRAVPLADIIDHIVVRYHDRHREQLPELILQATKVERVHADKPNVPRGLTKYL
YTFE_SALPK      QP-IEKDWRAVPLADIIDHIVVRYHDRHREQLPELILQATKVERVHADKPNVPRGLTKYL
YTFE_SALPB      QP-IEKDWRAVPLADIIDHIVVRYHDRHREQLPELILQATKVERVHADKPNVPRGLTKYL
YTFE_SALPC      QP-IEKDWRAVPLADIIDHIVVRYHDRHREQLPELILQATKVERVHADKPNVPRGLTKYL
YTFE_SALA4      QP-IEKDWRAVPLADIIDHIVVRYHDRHREQLPELILQATKVERVHADKPNVPRGLTKYL
YTFE_SALSV      QP-IEKDWRAVPLADIIDHIVVRYHDRHREQLPELILQATKVERVHADKPNVPRGLTKYL
YTFE_SALCH      QP-IEKDWRAVPLADIIDHIVVRYHDRHREQLPELILQATKVERVHADKPNVPRGLTKYL
YTFE_SALTY      QP-IEKDWRAVPLADIIDHIVVRYHDRHREQLPELILQATKVERVHADKPNVPRGLTKYL
YTFE_CROS8      TP-LEKDWQAAPLAEIIEHILVRYHDRHREQLPELILQATKVERVHADKPGVPKGLAKYL
YTFE_EDWI9      TPDQHRDWRQAPLDELCAFIVTRYHQRHRDQLPELVLMAQKVEQVHTGKTGCPRGLAKQL
YTFE_PECAS      QPSDARDWREAPLADIIAYIIPRFHDRHREQLPELILMAKKVERVHHDKADCPHGLANQL
YTFE_PECCP      QPSDARDWREAPLADIIAYIIPRFHDRHREQLPELILMAEKVERVHHDKADCPHGLANQL
YTFE_YERPE      EPHSSEDWQQQPLTNLISFIISRYHDRHREQLPELVLMAEKVERVHGEKPTCPRGLAAEL
YTFE_YERPP      EPHSSEDWQQQPLTNLISFIISRYHDRHREQLPELVLMAEKVERVHGEKPTCPRGLAAEL
YTFE_YERPG      EPHSSEDWQQQPLTNLISFIISRYHDRHREQLPELVLMAEKVERVHGEKPTCPRGLAAEL
YTFE_YERPA      EPHSSEDWQQQPLTNLISFIISRYHDRHREQLPELVLMAEKVERVHGEKPTCPRGLAAEL
YTFE_YERPN      EPHSSEDWQQQPLTNLISFIISRYHDRHREQLPELVLMAEKVERVHGEKPTCPRGLAAEL
YTFE_YERPB      EPHSSEDWQQQPLTNLISFIISRYHDRHREQLPELVLMAEKVERVHGEKPTCPRGLAAEL
YTFE_YERPS      EPHSSEDWQQQPLTNLISFIISRYHDRHREQLPELVLMAEKVERVHGDKPTCPRGLAAEL
YTFE_YERP3      EPHSSEDWQQQPLTNLISFIISRYHDRHREQLPELVLMAEKVERVHGDKPTCPRGLAAEL
YTFE_YERPY      EPHSSEDWQQQPLTNLISFIISRYHDRHREQLPELVLMAEKVERVHGDKPTCPRGLAAEL
YTFE_DICC1      QPSTEKDWQQASLGEMIVHIISRFHDRHRAQLPELIRMAEKVERVHHDKPGCPIGLTDQL
YTFE_DICP7      EPPSEKNWRAAPLNDMIPYIVQRFHDRHREQLPELIIMAEKVERVHQDKSACPHGLAAQL
                 *   .:*:  .* ::  .*: *:* *** *****:  * ***:**  *.  * **:  *

YTFE_CITK8      TMLHQELSSHMMKEEQILFPMIKQGMGSQAMGPISVMESEHDDAGELLEVIKHTTNNVTP
YTFE_ENT38      TMLHEELFSHMMKEEQILFPMIKQGMGSQAMGPISVMESEHDDAGELLEVIKHTTDNVTP
YTFE_SHIF8      TMLHEELSSHMMKEEQILFPMIKQGMGSQAMGPISVMESEHDEAGELLEVIKHTTNNVTP
YTFE_SHISS      TMLHEELSSHMMKEEQILFPMIKQGMGSQAMGPISVMESEHDEAGELLEVIKHTTNNVTP
YTFE_SHIFL      TMLHEELSSHMMKEEQILFPMIKQGMGSQAMGPISVMESEHDEAGELLEVIKHTTNNVTP
YTFE_SHIDS      TMLHEELSSHMMKEEQILFPMIKQGMGSQAMGPISVMESEHDEAGELLEVIKHTTNNVTP
YTFE_ECOLI      TMLHEELSSHMMKEEQILFPMIKQGMGSQAMGPISVMESEHDEAGELLEVIKHTTNNVTP
YTFE_ECOHS      TMLHEELSSHMMKEEQILFPMIKQGMGSQAMGPISVMESEHDEAGELLEVIKHTTNNVTP
YTFE_SHIB3      TMLHEELSSHMMKEEQILFPMIKQGMGSQAMGPISVMESEHDEAGELLEVIKHTTNNVTP
YTFE_ECO45      TMLHEELSSHMMKEEQILFPMIKQGMGSQAMGPISVMESEHDEAGELLEVIKHTTNNVTP
YTFE_ECO24      TMLHEELSSHMMKEEQILFPMIKQGMGSQAMGPISVMESEHDEAGELLEVIKHTTNNVTP
YTFE_ECO55      TMLHEELSSHMMKEEQILFPMIKQGMGSQAMGPISVMESEHDEAGELLEVIKHTTNNVTP
YTFE_ECOLC      TMLHEELSSHMMKEEQILFPMIKQGMGSQAMGPISVMESEHDEAGELLEVIKHTTNNVTP
YTFE_ECOSE      TMLHEELSSHMMKEEQILFPMIKQGMGSQAMGPISVMESEHDEAGELLEVIKHTTNNVTP
YTFE_ECOBW      TMLHEELSSHMMKEEQILFPMIKQGMGSQAMGPISVMESEHDEAGELLEVIKHTTNNVTP
YTFE_ECODH      TMLHEELSSHMMKEEQILFPMIKQGMGSQAMGPISVMESEHDEAGELLEVIKHTTNNVTP
YTFE_SHIBS      TMLHEELSSHMMKEEQILFPMIKQGMGSQAMGPISVMESEHDEAGELLEVIKHTTNNVTP
YTFE_ECO8A      TMLHEELSSHMMKEEQILFPMIKQGMGSQAMGPISVMESEHDEAGELLEVIKHTTNNVTP
YTFE_ECO57      TMLHEELSSHMMKEEQILFPMIKQGMGSQAMGPISVMESEHDEAGELLEVIKHNTNNVTP
YTFE_ECO5E      TMLHEELSSHMMKEEQILFPMIKQGMGSQAMGPISVMESEHDEAGELLEVIKHNTNNVTP
YTFE_ECOLU      TMLHEELSSHMMKEEQILFPMIKQGMGSQAMGPISVMESEHDEAGELLEVIKHTTNNVTP
YTFE_ECOL5      TMLHEELSSHMMKEEQILFPMIKQGMGSQAMGPISVMESEHDEAGELLEVIKHTTNNVTP
YTFE_ECOK1      TMLHEELSSHMMKEEQILFPMIKQGMGSQAMGPISVMESEHDEAGELLEVIKHTTNNVTP
YTFE_ECO7I      TMLHEELSSHMMKEEQILFPMIKQGMGSQAMGPISVMESEHDEAGELLEVIKHTTNNVTP
YTFE_ECOSM      TMLHEELSSHMMKEEQILFPMIKQGMGSQAMGPISVMESEHDEAGELLEVIKHTTNNVTP
YTFE_ECOUT      TMLHEELSSHMMKEEQILFPMIKQGMGSQAMGPISVMESEHDEAGELLEVIKHTTNNVTP
YTFE_ECO27      TMLHEELSSHMMKEEQILFPMIKQGMGSQAMGPISVMESEHDEAGELLEVIKHTTNNVTP
YTFE_ESCF3      TMLHEELSSHMMKEEQILFPMIKQGMGSQAMGPISVMESEHDEAGELLEVIKHTTNNVTP
YTFE_ECOL6      TMLHEELSSHMMKEEQILFPMIKQGMGSQAMGPISVMESEHDEAGELLEVIKHTTNNVTP
YTFE_ECO81      TMLHEELSSHMMKEEQILFPMIKQGMGSQAMGPISVMESEHDEAGELLEVIKHTTNNVTP
YTFE_KLEP3      TMLHQELSSHMMKEEQILFPMIKQGMGAQAGGPISVMESEHDEAGELLEVIKHITHNVTP
YTFE_KLEP7      TMLHQELSSHMMKEEQILFPMIKQGMGAQAGGPISVMESEHDEAGELLEVIKHITHNVTP
YTFE_SALDC      TALHEELSSHMMKEEQILFPMIKQGMGRQATGPISVMESEHDEAGELVDVIKHVTQNVTP
YTFE_SALTI      TALHEELSSHMMKEEQILFPMIKQGMGRQATGPISVMESEHDEAGELVDVIKHVTQNVTP
YTFE_SALEP      TALHEELSSHMMKEEQILFPMIKQGMGRQATGPISVMESEHDEAGELVDVIKHVTQNVTP
YTFE_SALG2      TALHEELSSHMMKEEQILFPMIKQGMGRQATGPISVMESEHDEAGELVDVIKHVTQNVTP
YTFE_SALHS      TALHEELSSHMMKEEQILFPMIKQGMGRQATGPISVMESEHDEAGELVDVIKHVTQNVTP
YTFE_SALNS      TALHEELSSHMMKEEQILFPMIKQGMGRQATGPISVMESEHDEAGELVDVIKHVTQNVTP
YTFE_SALPA      TALHEELSSHMMKEEQILFPMIKQGMGRQATGPISVMESEHDEAGELVDVIKHVTQNVTP
YTFE_SALPK      TALHEELSSHMMKEEQILFPMIKQGMGRQATGPISVMESEHDEAGELVDVIKHVTQNVTP
YTFE_SALPB      TALHEELSSHMMKEEQILFPMIKQGMGRQATGPISVMESEHDEAGELVDVIKHVTQNVTP
YTFE_SALPC      TALHEELSSHMMKEEQILFPMIKQGMGRQATGPISVMESEHDEAGELVDVIKHVTQNVTP
YTFE_SALA4      TALHEELSSHMMKEEQILFPMIKQGMGRQATGPISVMESEHDEAGELVDVIKHVTQNVTP
YTFE_SALSV      TALHEELSSHMMKEEQILFPMIKQGMGRQATGPISVMEIEHDEAGELVDVIKHVTQNVTP
YTFE_SALCH      TALHEELSSHMMKEEQILFPMIKQGMGRQATGPISVMESEHDEAGELVDVIKHVTQNVTP
YTFE_SALTY      TALHEELSSHMMKEEQILFPMIKQGMGRQATGPISVMESEHDEAGELVDVIKHVTKNVTP
YTFE_CROS8      SLLHEELTSHMMKEERVLFPMIKQGMGSQAAGPVSVMESEHDEAGELLEVIKHTTNNVTP
YTFE_EDWI9      DSLRQELDSHMMKEERILFPLIEQGEGARCHGPISVMEHEHRDAGELLDVIRFLTDNMTP
YTFE_PECAS      TAIYNELSQHMMKEERILFPMIGQGMGANAAAPISVMEHEHDDAGRDVEVVKELTNGVVP
YTFE_PECCP      TAIYNELSQHMMKEERILFPMIGQGMGANAAAPISVMEHEHDDAGRDVEVVKELTHGVVP
YTFE_YERPE      SAILEELTQHMYKEEQILFPMIQRGMGSQASGPIFVMEAEHDAVGQQLDVVKQLTQNVTP
YTFE_YERPP      SAILEELTQHMYKEEQILFPMIQRGMGSQASGPIFVMEAEHDAVGQQLDVVKQLTQNVTP
YTFE_YERPG      SAILEELTQHMYKEEQILFPMIQRGMGSQASGPIFVMEAEHDAVGQQLDVVKQLTQNVTP
YTFE_YERPA      SAILEELTQHMYKEEQILFPMIQRGMGSQASGPIFVMEAEHDAVGQQLDVVKQLTQNVTP
YTFE_YERPN      SAILEELTQHMYKEEQILFPMIQRGMGSQASGPIFVMEAEHDAVGQQLDVVKQLTQNVTP
YTFE_YERPB      SAILEELTQHMYKEEQILFPMIQRGMGSQASGPIFVMEAEHDAVGQQLEVVKQLTQNVTP
YTFE_YERPS      SAILEELTQHMYKEEQILFPMIQRGMGSQASGPIFVMEAEHDAVGQQLDVVKQLTQNVTP
YTFE_YERP3      SAILEELTQHMYKEEQILFPMIQRGMGSQASGPIFVMEAEHDAVGQQLDVVKQLTQNVTP
YTFE_YERPY      SAILEELTQHMYKEEQILFPMIQRGMGSQASGPIFVMEAEHDAVGQQLDVVKQLTQNVTP
YTFE_DICC1      TLIHDDLTQHMMKEERILFPMIQSGMGTQAGGPISVMEHEHDDAGQQLDVIKSLTNDVTP
YTFE_DICP7      TLILDDLSQHMMKEERILFPMIQAGMGRQAAGPISVMEHEHDDAGQQLEVVKTLTDNLTP
                  : ::* .** ***::***:*  * * .. .*: *** **  .*. ::*::  *..:.*

YTFE_CITK8      PPEACTTWKAMYNGINEMIDDLMEHISLENNVLFPRALAGE-
YTFE_ENT38      PADACTTWKAMYNGINELIDDLMEHISLENNVLFPRALAGE-
YTFE_SHIF8      PPEACTTWKAMYNGINELIDDLMDHISLENNVLFPRALAGE-
YTFE_SHISS      PPEACTTWKAMYNGINELIDDLMDHISLENNVLFPRALAGE-
YTFE_SHIFL      PPEACTTWKAMYNGINELIDDLMDHISLENNVLFPRALAGE-
YTFE_SHIDS      PPEACTTWKAMYNGINELIDDLMDHISLENNVLFPRALAGE-
YTFE_ECOLI      PPEACTTWKAMYNGINELIDDLMDHISLENNVLFPRALAGE-
YTFE_ECOHS      PPEACTTWKAMYNGINELIDDLMDHISLENNVLFPRALAGE-
YTFE_SHIB3      PPEACTTWKAMYNGINELIDDLMDHISLENNVLFPRALAGE-
YTFE_ECO45      PPEACTTWKAMYNGINELIDDLMDHISLENNVLFPRALAGE-
YTFE_ECO24      PPEACTTWKAMYNGINELIDDLMDHISLENNVLFPRALAGE-
YTFE_ECO55      PPEACTTWKAMYNGINELIDDLMDHISLENNVLFPRALAGE-
YTFE_ECOLC      PPEACTTWKAMYNGINELIDDLMDHISLENNVLFPRALAGE-
YTFE_ECOSE      PPEACTTWKAMYNGINELIDDLMDHISLENNVLFPRALAGE-
YTFE_ECOBW      PPEACTTWKAMYNGINELIDDLMDHISLENNVLFPRALAGE-
YTFE_ECODH      PPEACTTWKAMYNGINELIDDLMDHISLENNVLFPRALAGE-
YTFE_SHIBS      PPEACTTWKAMYNGINELIDDLMDHISLENNVLFPRALAGE-
YTFE_ECO8A      PPEACTTWKAMYNGINELIDDLMDHISLENNVLFPRALAGE-
YTFE_ECO57      PPEACTTWKAMYNGINELIDDLMDHISLENNVLFPRALAGE-
YTFE_ECO5E      PPEACTTWKAMYNGINELIDDLMDHISLENNVLFPRALAGE-
YTFE_ECOLU      PPEACTTWKAMYNGINELIDDLMEHISLENNVLFPRALAGE-
YTFE_ECOL5      PPEACTTWKAMYNGINELIDDLMEHISLENNVLFPRALAGE-
YTFE_ECOK1      PPEACTTWKAMYNGINELIDDLMEHISLENNVLFPRALAGE-
YTFE_ECO7I      PPEACTTWKAMYNGINELIDDLMEHISLENNVLFPRALAGE-
YTFE_ECOSM      PPEACTTWKAMYNGINELIDDLMEHISLENNVLFPRALAGE-
YTFE_ECOUT      PPEACTTWKAMYNGINELIDDLMEHISLENNVLFPRALAGE-
YTFE_ECO27      PPEACTTWKAMYNGINELIDDLMEHISLENNVLFPRALAGE-
YTFE_ESCF3      PPEACTTWKAMYNGINELIDDLMEHISLENNVLFPRALAGE-
YTFE_ECOL6      PPEACTTWKAMYNGINELIDDLMEHISLENNVLFPRALAGE-
YTFE_ECO81      PPEACTTWKAMYNGINELIDDLMEHISLENNILFPRALAGE-
YTFE_KLEP3      PPEACTTWKAMYNGINEMIDDLMEHISLENNVLFPRALAGK-
YTFE_KLEP7      PPEACTTWKAMYNGINEMIDDLMEHISLENNVLFPRALGGK-
YTFE_SALDC      PPEACTTWKAMYNGINEMIDDLMEHISLENNVLFPRALAGE-
YTFE_SALTI      PPEACTTWKAMYNGINEMIDALMEHISLENNVLFPRALAGE-
YTFE_SALEP      PPEACTTWKAMYNGINEMIDDLMEHISLENNVLFPRALAGE-
YTFE_SALG2      PPEACTTWKAMYNGINEMIDDLMEHISLENNVLFPRALAGE-
YTFE_SALHS      PPEACTTWKAMYNGINEMIDDLMEHISLENNVLFPRALAGE-
YTFE_SALNS      PPEACTTWKAMYNGINEMIDDLMEHISLENNVLFPRALAGE-
YTFE_SALPA      PPEACTTWKAMYNGINEMIDDLMEHISLENNVLFPRALAGE-
YTFE_SALPK      PPEACTTWKAMYNGINEMIDDLMEHISLENNVLFPRALAGE-
YTFE_SALPB      PPEACTTWKAMYNGINEMIDDLMEHISLENNVLFPRALAGE-
YTFE_SALPC      PPEACTTWKAMYNGINEMIDDLMEHISLENNVLFPRALAGE-
YTFE_SALA4      PPEACTTWKAMYNGINEMIDDLMEHISLENNVLFPRALAGE-
YTFE_SALSV      PPEACTTWKAMYNGINEMIDDLMEHISLENNVLFPRALAGE-
YTFE_SALCH      PPEACTTWKAMYNGINEMIDDLMEHISLENNVLFPRALAGE-
YTFE_SALTY      PPEACTTWKAMYNGINEMIDDLMEHISLENNVLFPRALAGE-
YTFE_CROS8      PPEACTTWRALYNGINELIDDLMNHISLENNTLFPRALAGEK
YTFE_EDWI9      PTGACTTWRALYAGISELINDLMEHVSLENNLLFPRALGDV-
YTFE_PECAS      PEGACNTWRALYSGINEFITDLMEHIHLENNLLFPRALRGE-
YTFE_PECCP      PEGACNTWRALYSGINEFITDLMEHIHLENNLLFPRALRGE-
YTFE_YERPE      PEGACNTWRALYTGINEFITDLMEHIHLENNLLFPRALRGE-
YTFE_YERPP      PEGACNTWRALYTGINEFITDLMEHIHLENNLLFPRALRGE-
YTFE_YERPG      PEGACNTWRALYTGINEFITDLMEHIHLENNLLFPRALRGE-
YTFE_YERPA      PEGACNTWRALYTGINEFITDLMEHIHLENNLLFPRALRGE-
YTFE_YERPN      PEGACNTWRALYTGINEFITDLMEHIHLENNLLFPRALRGE-
YTFE_YERPB      PEGACNTWRALYTGINEFITDLMEHIHLENNLLFPRALRGE-
YTFE_YERPS      PEGACNTWRALYTGINEFITDLMEHIHLENNLLFPRALRGE-
YTFE_YERP3      PEGACNTWRALYTGINEFITDLMEHIHLENNLLFPRALRGE-
YTFE_YERPY      PEGACNTWRALYTGINEFITDLMEHIHLENNLLFPRALRGE-
YTFE_DICC1      PDNACTTWRALYTGINEFIDDLMEHIHLENNQLFPRALRGE-
YTFE_DICP7      PADACNTWRALYAGIGEFITDLMEHIHLENNLLFPRALRGEA
                *  **.**:*:* **.*:*  **:*: **** ****** .