CLUSTAL format seed alignment for MF_01609

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

GCS2_ACIAC       ----------------------MSLEAFHHSEPLTLGVELELQLVNTHNYDLAPYAEDML
GCS2_ACISJ       ----------------------MSLEAFHHSEPLTLGVELELQLVSTNDYDLAPYAEDML
GCS2_VEREI       ----------------------MGLEAFSRSAPLTLGVELELQLVNTNDYDLAPYADDML
GCS2_POLNA       ----------------------MSLEPFQKSSALSLGVELEMQLVNTHDYDLAPYAEDML
GCS2_POLSJ       ----------------------MSLEVFHKSAALSLGVELELQLVNTHDYDLAPYAEDML
GCS2_AZOSB       ----------------------MSLEAFSPSRALSIGVELELQLVGTHDYDLVGAADDML
GCS2_BURCA       ----------------------MALETFVNSEPFTFGVELEIQVVNTHNYDLTKAASDLM
GCS2_BURCH       ----------------------MALETFVNSEPFTFGVELEIQVVNTHNYDLTKAASDLM
GCS2_BURCM       ----------------------MALETFVNSEPFTFGVELEIQVVNTHNYDLTKAASDLM
GCS2_BURL3       ----------------------MALETFVNSEPFTFGVELEIQVVNTHNYDLTKAASDLM
GCS2_BURMA       ----------------------MALETFVNSEPFTFGVELEIQIVNTHNYDLTKAASDLM
GCS2_BURP1       ----------------------MALETFVNSEPFTFGVELEIQIVNTHNYDLTKAASDLM
GCS2_BURPS       ----------------------MALETFVNSEPFTFGVELEIQIVNTHNYDLTKAASDLM
GCS2_BURTA       ----------------------MALETFVNSEPFTFGVELEIQIVNTHNYDLTKAASDLM
GCS2_PARXL       ----------------------MSLEPFIDSKPFTFGVELEMQIVNTHDYDLTKAGSDLL
GCS2_CUPNH       ----------------------MSLETFKHSEALTFGVELELQLVNRHDYDLAPFAPDLL
GCS2_CUPPJ       ----------------------MSLEPFKHSEALTFGVELELQLVNRHDYDLAPFAPDLL
GCS2_CUPMC       ----------------------MSLEPFKHSEALTFGVELELQLVNRHDYDLAPFAPDLL
GCS2_RALSO       ----------------------MSLEPFAKSEALTFGVELELQLVNRHDYDLASASADLL
GCS2_METPP       ----------------------MALQDFTPSEPLTLGVELELQLLSTHDFDLAPQAEDLL
GCS2_NITMU       ----------------------MSLMPFAPSRPLSIGVELELQLLGCNDYNLAPSAPEIL
GCS21_LEGPL      ----------------------MPLQPFKTSNLLTMGVELELQLISLSNFDLTAASPDIL
GCS21_LEGPA      ----------------------MPLQPFKTSNLLTMGVELELQLISLSNFDLTAASPDIL
GCS2_CHRVO       ------------------------MLEFNQSQPLTLGVELELMILNRRDYNLTRGSDDLL
GCS22_LEGPL      ----------------------MRLLSFKKSKIVSIGTELEFQIIDCSSLSLVSRSKELM
GCS2_LEGPH       ----------------------MRLLSFKKSKIVSIGTELEFQIIDCSSLSLVSRSKELM
GCS22_LEGPA      ----------------------MRLLSFKKSKIVSIGTELEFQIIDCSSLSLVSRSKELM
GCS2_DECAR       -------------------MTTKALGDFKDSAAFSLGVELELQLVSKRDFDLTRGATDLL
GCS2_ECOLI       ----------------------MPLPDFHVSEPFTLGIELEMQVVNPPGYDLSQDSSMLI
GCS2_SHISS       ----------------------MPLPDFHVSEPFTLGIELEMQVVNPPGYDLSQDSSMLI
GCS2_SHIFL       ----------------------MPLPDFHVSEPFTLGIELEMQVVNPPGYDLSQDSSMLI
GCS2_SHIF8       ----------------------MPLPDFHVSEPFTLGIELEMQVVNPPGYDLNQDSSMLI
GCS2_ECO57       ----------------------MPLPDFHVSEPFTLGIELEMQVVNPPGYDLSQDSSMLI
GCS2_SHIBS       ----------------------MPLPDFHVSEPFTLGIELEMLVVNPPGYDLSQDSSILI
GCS2_SHIDS       ----------------------MPLSDFHVSEPFTLGIELEMQVVNPPGYDLSQDSSMLI
GCS2_ECOUT       ----------------------MPLPDFHVSEPFTLGIELEMQVVNPPGYDLSQDSSMLI
GCS2_ECOK1       ----------------------MPLPDFHVSEPFTLGIELEMQVVNPPGYDLSQDSSMLI
GCS2_ECOL5       ----------------------MPLPDFHVSEPFTLGIELEMQVVNPPGYDLSQDSSMLI
GCS2_ECOL6       ----------------------MPLPDFHVSEPFTLGIELEMQVVNPPGYDLSQDSSMLI
GCS2_SALTI       ----------------------MALNDFHVSEPYTLGIELEMQVINPPGYDLSQDSSTLI
GCS2_SALTY       ----------------------MALNDFHVSEPYTLGIELEMQVINPPGYDLSQDSSTLI
GCS2_SALCH       ----------------------MALNDFHVSEPYTLGIELEMQVINPPSYDLSQDSSTLI
GCS2_SALPA       ----------------------MALNDFHVSEPYTLGIELEMQVINPPGYDLSQDSSTLI
GCS2_BORBR       ----------------------MEQIPFVSSAPNTLGIELELQLVDPRSFDLAAASDELL
GCS2_BORPA       ----------------------MEQIPFVSSAPNTLGIELELQLVDPRSFDLAAASDELL
GCS2_BORPE       ----------------------MEQIPFVSSAPNTLGIELELQLVDPRSFDLAAASDELL
GCS2_BORA1       ----------------------MEQIPFVSSSPNTLGIELELQLIDPAGFDLAAASDELL
GCS2_TRIV2       ----------------------MGDIEFKSSPEFSLGMEIELQLLNPDTLQLVDGISPLL
GCS2_BDEBA       -------------------MTKPQPIPFGKSDLFSLGVEVELQIIHPETRNLFPISPDIL
GCS2_GLOVI       -----------------------MTIPFQSSTAPTLGVEMELQIIDPATGNLTPRGPELV
GCS22_PAEAT      -----------------------MQIDFAPSRQSTLGVEWELALVNARTGELVSVANDVL
GCS21_ARTS2      -----------------------MKIDFASSRQSTLGVEWELALVNAQTGELASVANEVL
GCS2_LEIXX       ----------------------MQRLEFSESERSTVGIEWELALVDGATGDLVPIAKEVL
GCS2_MYCA1       -------------MSSVPARRGDAHIDFARSPRPTIGVEWEFALVDAQTRDLSNEATAVI
GCS2_MYCPA       ----------------MPARRGDAHIDFARSPRPTIGVEWEFALVDAQTRDLSNEATAVI
GCS2_MYCBO       ----------------MPARRSAARIDFAGSPRPTLGVEWEFALVDSQTRDLSNEATAVI
GCS2_MYCBP       ----------------MPARRSAARIDFAGSPRPTLGVEWEFALVDSQTRDLSNEATAVI
GCS2_MYCTU       ----------------MPARRSAARIDFAGSPRPTLGVEWEFALVDSQTRDLSNEATAVI
GCS2_MYCUA       MMPVSGWRAVSSAPASSSAGRTANRIDFARSPRPTVGVEWEFALVDAETRDLSNEATAVI
GCS21_MYCSK      ----------------MLSVPASSRIDFAGSPRPTVGVEWEFALVDAHTRDLSNEAATVI
GCS2_MYCSS       ----------------MLSVPASSRIDFAGSPRPTVGVEWEFALVDAHTRDLSNEAATVI
GCS21_MYCSJ      ----------------MLSVPASSRIDFAGSPRPTVGVEWEFALVDAHTRDLSNEAATVI
GCS21_MYCVP      ------------MSSLAADQRADGRIDFVGSVRPTVGVEWEFALVDATTRDLSNEAASVI
GCS22_NOCFA      ------------------MAGVVESVPFEGSPRPTIGIEWEVALVDKVTRDLSNTAAAVF
GCS22_RHOJR      -----------------------MVVPFPGSPRPTLGVEWEIALVDRVTRDLSNTAAEVF
GCS23_NOCSJ      -----------------------MRIDFHASPEPTLGVEWEFALVDRRTRDLRNDATHLF
GCS21_COREF      -----------------------MAIEFKRSPKPTIGVEWEIALVDPESRDLAPRAAEVL
GCS2_CORGL       -----------------------MGIEFKRSPRPTLGVEWEIALVDPETRDLAPRAAEIL
GCS2_CORDI       -------------------------MIFPPSP-PTLGVEWEVALADPHSRDLVPRGHEVI
GCS2_CORJK       -------------------------MDFPGSA-PSVGIEWEVALVDPETRDLVPRAAELI
GCS21_FRAAA      -----------------------MQIPFSSSTSSSLGIEWELQLVDQQSRELRGEATLIL
GCS21_FRACC      -----------------------MQIPFSSSSSTSLGIEWELQLVDQQSRELRGEASGIL
GCS2_THEFY       -----------------------MTIEFNPSKRATLGVEWELQLVDRDSGHLRQDAQKLL
GCS21_RUBXD      ---------------------MPVEFKLGNSG-YTLGVEEELCIVDASTGELVPKIEEIM
GCS23_RUBXD      -----------------------METRFGASPPYTVGVEEEFQLIDPRTRALTPKIEEVL
GCS2_SOLUE       -----------------------MSLMSSVRPSLSIGIEEEYQTVDPVTRDLRSHIHAEI
GCS23_PAEAT      ----MQMAGRGANRRGQHRSPVLVRPPDAEWSMRTFGVEEELLIVDPVTGEPLALADALL
GCS22_ARTS2      --------------------------------MRTFGVEEELLIVDPVTGEPLALADALL
GCS21_PAEAT      ---------------------------MGRVAVRTFGVEEELLIADPVDGMPLALASGIL
GCS22_COREF      --------------------------------MRTFGVEEELLLVDAVTFSPLPAGDRAV
GCS22_NOCSJ      --------------------------------MRTVGVEEEFLLVDADRSRPIPAASRAL
GCS21_STRAW      --------------------------------MRTVGVEEELLLVDPETGEPKALSTAVL
GCS2_STRCO       --------------------------------MRTVGVEEELLLVDPATGEPRALSAAVL
GCS22_FRAAA      ---------------------------MTTEGVRTVGVEEEFVLVDPDRHAVRAAASRVL
GCS21_NOCSJ      -------------------------------MVRKLGIEEELLLFDPESGEVVPAAPSVL
GCS2_RHOBA       ----------------------------MSFQVPTVGVEEEYQLVDPRSGALIPNCKEVM
GCS22_STRAW      ------------------------------MSLYTVGVEEEYLLLDPATRLPMPAAEQVR
GCS22_MYCSJ      -----------------------------MAAHPTVGVEEEFLLVDPDSGAPIARNRDVA
GCS22_MYCSK      -----------------------------MAAHPTVGVEEEFLLVDPDSGAPIARNRDVA
GCS22_MYCVP      -----------------------------MTDIPTLGVEEEFLLVHPGSGAPVALNREVA
GCS21_NOCFA      ------------------------------MDAPTVGVEEEFLLVDPRTGAPTARNEAVA
GCS24_RHOJR      ------------------MATTTVPTKPRRDEIPTLGVEEEFVLVDPHTGRPSLSNTDVI
GCS21_SACEN      ------------------------------MLDLTLGVEEEFLLLDPGTLEPAAA-ADRF
GCS21_RHOJR      ----------------------MSPAATESGRDLSVGVEEEFFLVD-ESGHLSAAGPDVV
GCS22_SACEN      -------------MGLQEHPVTPAERQPPVRGGVTIGVEEEFLLVDAASGQLAPHAEAVL
GCS2_JANSC       ----------------MAQTFSDE--------HFTLGIEEEYLLVDAETYDLAE-APDAL
GCS2_RUEPO       ----------------MPVHWSKTGSGGVMQKEFTLGIEEEYLLVDRDSLQLAE-APEAL
GCS2_PARDP       ----------------MTEE-----------PEFSLGVEEEYLLVDAETGDLRE-APDAL
GCS2_RHORT       ----------------MREP------------AFTVGIEEEYLLVDRQSRALAADPPEAL
GCS2_BRADU       -------MLRLDSSDDKQHLVIRSAGGRGKAAEYSFGIEEEYFLADRRSLDVAIQTPNEL
GCS2_PSEAE       ----------------MTHDLAAS--------GLRFGIEEEFFLLDASDLDIVRSAPAGF
GCS2_PSEAB       ----------------MTHDLAAS--------GLRFGIEEEFFLLDASDLDIVRSAPAGF
GCS2_PSEE4       ---------------------MAR--------PWTFGIEEEYLLADTTSGQVLASPSPAV
GCS2_PSEPK       ---------------------MIR--------PCTFGIEEEYLLVNLGSGQVPATPSPAV
GCS2_PSEF5       ----------------MSAFDPGQ--------PQHLGIEEEYLLTDLQSRCMVAEPPPEV
GCS2_HALMA       --------------------MDATGSAEHFTRMGTLGIEEEFYVVDEFGRPTSGTDELVY
GCS2_NATPD       --------------------MDL-GSREAFDRTGTLGIEEEFFVVDEYGRPTAGTDELVY
GCS2_HALSA       --------------------MDV-GSPEAFSESGTLGVEEEFFVVDEHGVPTAGSDELVY
GCS2_HALWD       --------------------MDV-GSADAFDRMGTLGVEEEFFVVDDSGQPTAGIQELIY
GCS22_RUBXD      -------MVMDAGKKREAGALLPEEAFETGAPEGTLGAEEELWLADPETLKLAGGAQKIL
                                                    .* * *                   

GCS2_ACIAC       RL-MARQP------------------LPGSVVPEMTNSMIEVSTGICHSGSEVLGQLTQI
GCS2_ACISJ       RI-MKKVP------------------LPGSVVPEMTNSMIEISTGVCHSSSEVLGQLTQI
GCS2_VEREI       RL-MKKTP------------------LPGSVVPEMTNSMIEISTGICHSCSEVLGQLTPI
GCS2_POLNA       RL-MSKIA------------------LPGAVVPEMTSSMIEVSTGICHSSAEVLGQLTQI
GCS2_POLSJ       RL-MHKIP------------------LPGSVVPEMTSSMIEISTGVCSSSSEVLGQLSQI
GCS2_AZOSB       RL-TAGLD------------------LPGDIKPEMTDSMIEISTGVCDNHAMVLTQLDGL
GCS2_BURCA       RL-IQGET------------------FPGNITPEITESMIELSTGICHSHEQAVSELHAI
GCS2_BURCH       RL-IQGET------------------FPGNITPEITESMIELSTGICHSHEQAVSELHAI
GCS2_BURCM       RL-IQGET------------------FPGNITPEITESMIELSTGICHSHEQAVSELHAI
GCS2_BURL3       RL-IQGET------------------FPGNITPEITESMIELSTGICHSHEQAVSELHAI
GCS2_BURMA       RL-IKDAK------------------FPGNITPEITESMIELSTGICRTHDQALGELHAI
GCS2_BURP1       RL-IKDAK------------------FPGNITPEITESMIELSTGICRTHDQALGELHAI
GCS2_BURPS       RL-IKDAK------------------FPGNITPEITESMIELSTGICRTHDQALGELHAI
GCS2_BURTA       RL-IKDAK------------------FPGNITPEITESMIELSTGICRTHDQALGELHAI
GCS2_PARXL       RL-IKDEK------------------IPGNITPEITESMIELSTGICTTHEQAVADLRKI
GCS2_CUPNH       RA-LKGAE------------------HAGDIKPEISPSMIEISTGICHTYQQALEELTVM
GCS2_CUPPJ       RA-LKGAQ------------------HAGDIKPEISPSMIEISTGICHTYQQALDELTTM
GCS2_CUPMC       RA-LRGTQ------------------HAGDIKPEISPSMIEISTGICHDYAQALEELSVM
GCS2_RALSO       RM-LRGKE------------------TPGDIKPEITESMIEIATGICHSHDEALWQMREI
GCS2_METPP       RE-TAKHS------------------GAWDIKPEITRSMIEIGSSIQRRHGPLREELRDM
GCS2_NITMU       RR-VAKRT------------------HPGEIKPEMTRSMIEINTSVQQEYAGLVTELRAL
GCS21_LEGPL      EL-LGRSS------------------FPGSFTPEITESMLEIATDVHEEYEQLLKQLFHI
GCS21_LEGPA      EL-LGRSS------------------FPGSFTPEITESMLEIATDVHEEYDQLLKQLFHI
GCS2_CHRVO       LQ-INRKP------------------HGYDIKPEITQGMIEIGTAVHSDVNAMLDELLAI
GCS22_LEGPL      RA-LKDMR------------------YRDQIKPEITQSMIEINSSIHQSAKEMYDELLEL
GCS2_LEGPH       RA-LKDMR------------------YRDQIKPEITQSMIEINSSIHQSAKEMYDELLEL
GCS22_LEGPA      RA-LKDMR------------------YRDQIKPEITQSMIEINSSIHQSAKEMYDELLEL
GCS2_DECAR       GS-LDYDE------------------RFGEIKLEITESMIEISTQPQSTVDGIAADLSGL
GCS2_ECOLI       DA-VKNKI------------------TAGEVKHDITESMLELATDVCRDINQAAGQFSAM
GCS2_SHISS       DA-VKNKI------------------TAGEVKHDITESMLELATDVCRDINQAAGQFSAM
GCS2_SHIFL       DA-VKNKI------------------TAGEVKHDITESMLELATDVCRDINQAAGQFSAM
GCS2_SHIF8       DA-VKNKI------------------TAGEVKHDITESMLELATDVCRDINQAAGQFSAM
GCS2_ECO57       DA-VKNKI------------------TAGEVKHDITESMLELATDVCRDINQAAGQFSAM
GCS2_SHIBS       DA-VKNKI------------------TAGEVKHDITESMLELATDVCRDINQAAGQFSAM
GCS2_SHIDS       DA-VKNEI------------------TAGEVKHDITESMLELATDVCRDINQAAGQFSAM
GCS2_ECOUT       DA-VKNQI------------------TAGEVKHDITESMLELATDVCRDINQAAGQFSAM
GCS2_ECOK1       DA-VKNQI------------------TAGEVKHDITESMLELATDVCRDINQAAGQFSAM
GCS2_ECOL5       DT-VKNQI------------------TAGEVKHDITESMLELATDVCRDINQAAGQFSAM
GCS2_ECOL6       DA-VKNKI------------------TAGEVKHDITESMLELATDVCRDINQAAGQFSAM
GCS2_SALTI       DA-VKPQL------------------TAGEIKHDITESMLEMATGVCRDIDQVAAQLSAM
GCS2_SALTY       DA-VKPQL------------------TAGEIKHDITESMLEMATGVCRDIDQAAAQLSAM
GCS2_SALCH       DA-VKSRL------------------TAGEIKHDITESMLEMATGVCRDIDQAAAQLSAM
GCS2_SALPA       DA-VKPQL------------------TAGEIKHDITESMLEMATGVCRDIDQAAAQLSAM
GCS2_BORBR       AQ-LANHP------------------IADRVKPEITRSMIELNSSVHEHPAGLLAEMREM
GCS2_BORPA       AQ-LANHP------------------IADRVKPEITRSMIELNSSVHEHPAGLLAEMREM
GCS2_BORPE       AQ-LANHP------------------IADRVKPEITRSMIELNSSVHEHPAGLLAEMREM
GCS2_BORA1       AQ-LANHP------------------VADRIKPEITRSMIELNSSVHEHPAGLLAEMREM
GCS2_TRIV2       AQ-TPEN---------------------SWIQPEFNQAMVEIASQVCSNIPELEANIVAI
GCS2_BDEBA       ---EEWSL------------------QSPHLKPEVFQSMLEIDTPICKNVQEVEYELLLT
GCS2_GLOVI       TFCEEHPE------------------VGLVVKPELVQATIEINTGICKDVAQVERDLTTQ
GCS22_PAEAT      KGVAANHPDLN------------EDDEHPHIKRELLLNTVELVTGICETVKDAKEDLSRS
GCS21_ARTS2      RGVSANHPELN------------EDDEHPHIKQELLLNTVELVTGICETVAQAKADLSSS
GCS2_LEIXX       GELGTS-----------------DGREHPQITHELLMNTVEVVSQVHRTVPAAIADLQEL
GCS2_MYCA1       AEIGE----------------------NPRVHKELLRNTVEVVSGICRTVPEAMEDLRQT
GCS2_MYCPA       AEIGE----------------------NPRVHKELLRNTVEVVSGICRTVPEAMEDLRQT
GCS2_MYCBO       AEIGE----------------------NPRVHKELLRNTVEIVSGICECTAEAMQDLRDT
GCS2_MYCBP       AEIGE----------------------NPRVHKELLRNTVEIVSGICECTAEAMQDLRDT
GCS2_MYCTU       AEIGE----------------------NPRVHKELLRNTVEIVSGICECTAEAMQDLRDT
GCS2_MYCUA       AEIGE----------------------NPRVHKELLRNTVEVVSGVCGSAGEAIEDLRTT
GCS21_MYCSK      AEIGE----------------------TPHVHKELLRNTVEVVTGICENTGEAMADLHDT
GCS2_MYCSS       AEIGE----------------------TPHVHKELLRNTVEVVTGICENTGEAMADLHDT
GCS21_MYCSJ      AEIGE----------------------TPHVHKELLRNTVEVVTGICENTGEAMADLHDT
GCS21_MYCVP      AEIGE----------------------NPRVHKELLRNTVEVVTGICANAGEAMEDLAST
GCS22_NOCFA      DAVGDLR----------------AWDGTPQVTKELLRNTVEIVTGVHETVGAAVEDLRGT
GCS22_RHOJR      DAVANLA----------------GPE-DPRITKELLRNTVELVTGIHSTVGEAMDDLDES
GCS23_NOCSJ      ARAKPRL----------------PD--PDKLHKELLRNTVEVVSGVCHTVGEAMADLRRT
GCS21_COREF      EIVAER-------------------HPEVHLEGEFLQNTVELVTGICDTVPEAVAELDRA
GCS2_CORGL       EIVAKN-------------------HPEVHLEREFLQNTVELVTGVCDTVPEAVAELSHD
GCS2_CORDI       E------------------------KATTHLEREFLANTVELVTSVCTTVPEAIEELREG
GCS2_CORJK       ARMDEV-------------------HPGHKVVREFLANTVEMVSGVHDTIPEAVEDLHVQ
GCS21_FRAAA      DELRAKVG----------------EREAAKAKHELFESTVEVITGVCGSVGEATADLAGT
GCS21_FRACC      HELRAKVG----------------ECEAAKAKHELFESTIEVITGVCDSVEEATADLSGT
GCS2_THEFY       EELPELSG----------------AESNPPLRHELMQSTIEVVTGICETVDEVKEDLSAT
GCS21_RUBXD      SRLPEDLAE--------------------AVSYELFQSVLEIKTPVCRTVGEAERVLREL
GCS23_RUBXD      AAGDGELPEG-------------------TLASELSASCLEVRTPAYASVAELARALPAL
GCS2_SOLUE       VQKGKLLLAE-------------------RVKPEMHQSVVEIGTGVCQNIQEAKDEIRDI
GCS23_PAEAT      AGQ---------------------DEPTSGLSHELKLEQIETQTRPCHSYGELLQQIRRG
GCS22_ARTS2      TGRKLAADDAPDKPRILDPHDPTRDDGDTGLTAELKLEQIETQTRPCLNYEELLLQIRQG
GCS21_PAEAT      DVAGFSETD-------------NSSDAGPSLKSEFKQEQIEVNSLPCRTAKELRAEIRAG
GCS22_COREF      QLHTEAHEAT------------GTDPGGYEITREFQQEQFEVAYPPQTTLADQLETIRAG
GCS22_NOCSJ      RVATEWGVA-------------GGQVGAGALVHELQEQQLEIYTAPQVRMASLETELRAW
GCS21_STRAW      ARAEQV------------------DPDQDVFEKELHGQMLEFATHPQTDMAALGAEIVRC
GCS2_STRCO       ARAFLD------------------DSEQDVFEKELHEQMLEFATHPQADMERLHAEIVRC
GCS22_FRAAA      ARGDRDGAGGPPG------GADPDGDLDGDLDVELTREQVESGSAPHTSLAGLRGSLVGL
GCS21_NOCSJ      KEFREHGPGR-----------QRARAATDELDQELFRHQLETRTDPVRRAADALDQLVAA
GCS2_RHOBA       RTIRRNG---------------GSEEAHSEIQHELHLNQIEMASDVCSSLEEVRDALTQT
GCS22_STRAW      AAAGLEP---------------IAGE--DEIQPELSEAQVEVATPVCTSLDEIGGHLVRL
GCS22_MYCSJ      RHA---------------------ADRGVDLQLELTSCQVETATGVASSMADVREQLTHL
GCS22_MYCSK      RHA---------------------ADRGVDLQLELTSCQVETATGVASSMADVREQLTHL
GCS22_MYCVP      ARA---------------------ADMDVELQLELTSCQVETATAVVDDTAHLREQLLHL
GCS21_NOCFA      HTA---------------------GELGIDLQLELTRCQVETSTAVHSDIGALFGQLRDL
GCS24_RHOJR      ASG---------------------RELGITLQPELSRCQIETATSIGTHIRDLRDQLCES
GCS21_SACEN      RAE---------------------TDRG-EVHRELAPAQIESATAVCRTLEELHHDLSGL
GCS21_RHOJR      TEA---------------------GHDIHGLQRELARCQIETATGVCHTGEELHEELRSL
GCS22_SACEN      AEAANGP----------------LGAPDAVLHAEMLNSQVEAATGCCRTLEELRSQLVAA
GCS2_JANSC       MAACADKLSSK-------------------VSPEFLQCQIEVGTGVCASIADARADLRNL
GCS2_RUEPO       MSTCQADFEGQ-------------------VSPEFLQCQIEVGTRPHATIAAAREDLKRL
GCS2_PARDP       MEACKAELADQ-------------------VGPEFLRCQIEIGTPVAADVAQARDHLARL
GCS2_RHORT       MTRLAAAFGDTNH---------------GAVTPEFLRAQIEVGTKVCDSLAEAGEALGAL
GCS2_BRADU       FESANWSTGGQ-------------------AMREMLQSQLEVATNVHVDVNDAREELRFL
GCS2_PSEAE       VAACRDTLGEH-------------------FAEEMFECQVEVASPVFSTLAEAARFHGQA
GCS2_PSEAB       VAACRDTLGEH-------------------FAEEMFECQVEVASPVFSTLAEAARFHGQA
GCS2_PSEE4       TRRCREMLGAT-------------------FAEEMFLSQIEVVSPVFDSLHQARSFLGEN
GCS2_PSEPK       MGRCREALGRY-------------------FAQEMFRSQIELASPVFTNLYEAREFLQRN
GCS2_PSEF5       LRDCREALGQN-------------------FAYEMFQGQIEVASPVFDHSAQAGAYLRQV
GCS2_HALMA       E--TEPPA-----------------VLDGRLDHELFKCVIETQTPRIDDPANAGDHLRSV
GCS2_NATPD       E--NEPPE-----------------PLKDRLDHELFKCVIETQTPTIGSLSAADDALAEV
GCS2_HALSA       E--GEPPE-----------------PIAGRLDHELFKFVVETQTPTLNGVAEAPAAIREV
GCS2_HALWD       DYNHPPAG-----------------VLADRLDHELFQFVIETQTPLLEDVSAVSESVQAV
GCS22_RUBXD      AAEPAEHF-----------------------SGELIDCEVEANTGVHREAAGVARDLLAR
                                                  :.    .*                   

GCS2_ACIAC       RDALVRSADKLNIAVVGGGTHPFQQWHERRIYDKPRFQELSQLYGYLSKQFTIFGQHVHI
GCS2_ACISJ       RDALVKSADKLNIAVVGGGTHPFQQWHERRIYDKPRFQELSQLYGYLSKQFTIFGQHVHI
GCS2_VEREI       RDALVKSADKLNIAVLGGGTHPFQQWHERRIYDKPRFRELSELYGYLSKQFTIFGQHVHI
GCS2_POLNA       RDALVKSADKLNIAVVGGGTHPFQQWHERRIYDKPRFRELSELYGYLSKQFTIFGQHVHI
GCS2_POLSJ       RDALVKSADKLNIAVVGGGTHPFQQWHERRIYDKPRFRELSELYGYLSKQFTIFGQHVHV
GCS2_AZOSB       RAALVDIARRLNVGICGGGTHGFQDWGERRIFDNPRFHYLHELYGYLAKQFTVFGQHVHI
GCS2_BURCA       RDVLVKAADQLNVGLAGGGTHAFQQWSDRQIYDAPRFQYISELYGYLAKQFTVFGQHVHI
GCS2_BURCH       RDVLVKAADQLNVGLAGGGTHAFQQWSDRQIYDAPRFQYISELYGYLAKQFTVFGQHVHI
GCS2_BURCM       RDVLVKAADQLNVGLCGGGTHAFQQWSDRQIYDAPRFQYISELYGYLAKQFTVFGQHVHI
GCS2_BURL3       RDVLVKAADQLNVGLAGGGTHAFQQWSDRQIYDAPRFQYISELYGYLAKQFTVFGQHVHI
GCS2_BURMA       RDTLVSAADQLNVGLCGGGTHAFQQWSERQIFDAPRFQYISELYGYLAKQFTVFGQHVHI
GCS2_BURP1       RDTLVSAADQLNVGLCGGGTHAFQQWSERQIFDAPRFQYISELYGYLAKQFTVFGQHVHI
GCS2_BURPS       RDTLVSAADQLNVGLCGGGTHAFQQWSERQIFDAPRFQYISELYGYLAKQFTVFGQHVHI
GCS2_BURTA       RDTLVNAADQLNVGLCGGGTHAFQQWSERQIFDAPRFQYISELYGYLAKQFTVFGQHVHI
GCS2_PARXL       RDTLVSAADHLNVGLCGGGTHAFQQWSERQIVDTPRFQYLSELYGYLAKQFTVFGQHVHI
GCS2_CUPNH       RDLMVAASRSLNLGIAGGGTHPFQQWADRTISDSPRYQYISELYGYLAKQFTVFGQHVHI
GCS2_CUPPJ       RDLMQAASRSLNIGISGGGTHPFQQWADRIISDSPRYQYISELYGYLAKQFTVFGQHVHI
GCS2_CUPMC       RDLMVNASRGLNLGICGGGTHPFQVWSDRTISDSPRYQYISELYGYLAKQFTVFGQHVHI
GCS2_RALSO       RDRMVEAAVPLNIGICGGGTHPFQQWSQRTISASPRYQYISELYGYLAKQFTVFGQHVHL
GCS2_METPP       RNQLTRAARKLNIAIAGGGTHAYQHWSEQQIFPAERFRYISELYGYLAKQFTVFGQHVHV
GCS2_NITMU       RDVVSEAGCFLNVAVAGGGTHPFQHWSEQKIFDAPRFHYLSELYGYLAKQFTIFGQHVHI
GCS21_LEGPL      RDTLVAVGDRLNIGICGGGTHPFQMWSDQRIFNKTRFIEVSELYGYLTKQFTIFGQHIHI
GCS21_LEGPA      RDTLVTVGDRLNIGICGGGTHPFQMWSNQRIFNKTRFIEVSELYGYLTKQFTIFGQHIHI
GCS2_CHRVO       RTLLVDSAHKLNLGLAGGGAHPFQHWEDQRIYPKERYKLVSELYGYLAKQFTVYGQHIHI
GCS22_LEGPL      QKILVETAASIDIAFCGGGTHPFQQWTMQKIFPSKRFKKKFNQYRYLSKRATVFGQHIHI
GCS2_LEGPH       QKILVETAASIDIAFCGGGTHPFQQWTMQKIFPSKRFKKKFNQYRYLSKRATVFGQHIHI
GCS22_LEGPA      QKILVETAASIDIAFCGGGTHPFQQWTMQKIFPSKRFKKKFNQYRYLSKRATVFGQHIHI
GCS2_DECAR       RDTLRQHCERNNIGICGGGTHPFHHWPERRICPGDRFNDLYQRYGYLAKQFTVFGQHVHI
GCS2_ECOLI       QKVVLQAATDHHLEICGGGTHPFQKWQRQEVCDNERYQRTLENFGYLIQQATVFGQHVHV
GCS2_SHISS       QKVVLQAAADHHLEICGGGTHPFQKWQRQEVCDNERYQRTLENFGYLIQQATVFGQHVHV
GCS2_SHIFL       QKVVLQAAADHHLEICGGGTPPFQKWQRQEVCDNERYQRTLENFGYLIQQATVFGQHVHV
GCS2_SHIF8       QKVVLQAAADHHLEICGGGTPPFQKWQRQEVCDNERYQRTLENFGYLIQQATVFGQHVHV
GCS2_ECO57       QKVVLQAAADHHLEICGGGTHPFQKWQRQEVCDNERYQRTLENFGYLIQQATVFGQHVHV
GCS2_SHIBS       QKVVLQAAADHHLEICGGGTHPFQKWQRQEVCDNERYQRTLENFGYLIQQVTVFGQHVHV
GCS2_SHIDS       QKVVLQAAADHHLEICGGGTHPFQKWQRQEVCDNERYQRTLENFGYPIQQATVFGQHVHV
GCS2_ECOUT       QKVVLQAAADHHLEICGGGTHPFQKWQRQEVCDNERYQRTLENFGYLIQQATVFGQHVHV
GCS2_ECOK1       QKVVLQAAADHHLEICGGGTHPFQKWQRQEVCDNERYQRTLENFGYLIQQATVFGQHVHV
GCS2_ECOL5       QKVVLQAAADHHLEICGGGTHPFQKWQRQEVCDNERYQRTLENFGYLIQQATVFGQHVHV
GCS2_ECOL6       QKVVLQAAADHHLEICGGGTHPFQKWQRQEVCDNERYQRTLQNFGYLIQQATVFGQHVHV
GCS2_SALTI       QHVILQAASEHHLGICGGGTHPFQKWQRQEVCDNERYQRTLENFGYLIQQATVFGQHVHV
GCS2_SALTY       QHVILQAASEHHLGICGGGTHPFQKWQRQEVCDNERYQRTLENFGYLIQQATVFGQHVHV
GCS2_SALCH       QHVILQAASEHHLGICGGGTHPFQKWQRQEVCDNERYQRTLENFGYLIQQATVFGQHVHV
GCS2_SALPA       QHVILQAASEHHLGICGGGTHPFQKWQRQEVCDNERYQRTLENFGYLIQQATVFGQHVHV
GCS2_BORBR       RDVLCEAADAVGVGVTGGGAHPFMRWQDRAISDTPRFQYLAEMYGYLARQFTVFGQHIHL
GCS2_BORPA       RDVLCEAADAVGVGVTGGGAHPFMRWQDRAISDTPRFQYLAEMYGYLARQFTVFGQHIHL
GCS2_BORPE       RDVLCEAADAVGVGVTGGGAHPFMRWQDRAISDTPRFQYLAEMYGYLARQFTVFGQHIHL
GCS2_BORA1       RDALCEAADAVGVSVSGGGTHPFMRWQERTISDTPRFQYLAEMYGYLARQFTVFGQHIHL
GCS2_TRIV2       LRDLKTRCQALGMTICTAGTYPCCDRFA-SITPIPRYLSQQNTSGYLADLMMTCALQLHV
GCS2_BDEBA       SRELLRICKKHGARLASNGTHPFAKWHHRIFYPSDRYEYLLERNQHIARRLMIYGLHVHL
GCS2_GLOVI       LTLLRSVCRERGVSFLSAGTHPFARWRERRYTQTPRYRALVDKHVWTARRMQIYGLHVHV
GCS22_PAEAT      LAAVREVTDPMGVEVFCAGSHPFSPPLLQPVTDKERYAKLIERTQWWGRQMVIYGVHVHV
GCS21_ARTS2      LAAVREVTDPMGVEVFCAGSHPFSPPQLQPVTDKARYAKLIDRTQWWGRQMVIYGVHVHV
GCS2_LEIXX       IGMVREVTDPRGVELMCAETHPFAQWYDQRITPSERYDRLLDRTQWWGRQMMIWGVHVHI
GCS2_MYCA1       LGPARRIVRDRGMELFCAGAHPFAQWTTQKLTDAPRYAELIKRTQWWGRQMLIWGVHVHV
GCS2_MYCPA       LGPARRIVRDRGMELFCAGAHPFAQWTTQKLTDAPRYAELIKRTQWWGRQMLIWGVHVHV
GCS2_MYCBO       LGPARQIVRDRGMELFCAGTHPFARWSAQKLTDAPRYAELIKRTQWWGRQMLIWGVHVHV
GCS2_MYCBP       LGPARQIVRDRGMELFCAGTHPFARWSAQKLTDAPRYAELIKRTQWWGRQMLIWGVHVHV
GCS2_MYCTU       LGPARQIVRDRGMELFCAGTHPFARWSAQKLTDAPRYAELIKRTQWWGRQMLIWGVHVHV
GCS2_MYCUA       LGPARRIVHARGMELFCEGTHPFAQWSTQKLTDAPRYAELIKRTQWWGRQMLIWGVHVHV
GCS21_MYCSK      LKVVRRIVRDRGMELFCAGTHPFANWSTQQLTDAPRYAELIKRTQWWGRQMLIWGVHVHV
GCS2_MYCSS       LKVVRRIVRDRGMELFCAGTHPFANWSTQQLTDAPRYAELIKRTQWWGRQMLIWGVHVHV
GCS21_MYCSJ      LQVVRRIVRDRGMELFCAGTHPFANWSTQQLTDAPRYAELIKRTQWWGRQMLIWGVHVHV
GCS21_MYCVP      LRPVREVVRERGMDLFCAGTHPFADWSVQKLTDAPRYAELIKRTQWWGRQMLIWGVHVHV
GCS22_NOCFA      MDKVRRAADPLGVDVFCAGTHPFAQWSTQQLTRSPHYDELIERTQWWGRQMMIWGVHVHV
GCS22_RHOJR      LDLLRRAANPLGVDLICAGTHPFAQWSTQLVTRTPDYDELIERTQWWGRQMLIWGVHVHV
GCS23_NOCSJ      LEVVVPAGDDLDLDLYGGGTHPFASWTVQQLSEGHRYEELINRTQWWGRQMLIWGVHVHV
GCS21_COREF      LAAVQEAATELGLRPWTSGSHPFSDFRENPVSKKGSYDEIIARTQYWGNQMLIWGIHVHV
GCS2_CORGL       LDALKEAADSLGLRLWTSGSHPFSDFRENPVSEKGSYDEIIARTQYWGNQMLIWGIHVHV
GCS2_CORDI       IEEVKAIAADMGLKVWAAGSHPFSDFRKQPVNEKGHYNEIIERTQYWGNQMLIWGIHVHV
GCS2_CORJK       AKQLMECADDIGVNLFSAGTHPFAHWGDQKLSEKGSYQEIIERTQYWGRQMLIWGIHVHV
GCS21_FRAAA      VSLLRDLAERRGVGLMCSGTHPTSDYAGQRITDDNRYSRLVSQMQWLARRLLIFGVHVHV
GCS21_FRACC      VSLLRDLAERRGIGLMCSGTHPASDYMGQRITEDHRYFRLVSQMQWLARRLLIFGVHVHV
GCS2_THEFY       VARLTQAADGRGIELACAGTHPIDDWRDQEFAPSQRYSELIEQMQWLARRILTFGVHVHV
GCS21_RUBXD      RGRVGSWTAACGASLASAGTHPFSRYRDQKVTEHERYRQVIEELRWVATREVIFGQHVHV
GCS23_RUBXD      RARVRRLAERSGARLVSAGAHPFSPAAEQPITGKPRYRKVDEEMGWPARMQAIYGLHVHV
GCS2_SOLUE       RQQIIRLARQNDLRLAAGGTHPFAQWREQEIYPDDRYRTIVEDLKMVARANLIFGLHVHI
GCS23_PAEAT      RAMANQAARQHGARVAAIATSPLA--SNTHTTPDPRYAAMLDRFGIIATEQLTCGFHVHT
GCS22_ARTS2      RALADTAAEKHNARVAALATSPIA--STTHTTPNPRYATMQERFGLTVHEQLTCGFHVHT
GCS21_PAEAT      RALADSAARAVGARVAALATPPVF--HATPTAGNQRYAAMGTEFGLISREQLTCGFHVHV
GCS22_COREF      RALADTAASRVGGRVVALPTSPGP--ISPHLVPNPRYQRISERFGFTVKEQLTCGFHIHV
GCS22_NOCSJ      RAAAAAAAAAVGARLVASATSPVA--VEPHRVRSPRYDRMAERFGIVTDEQLTCGCHVHV
GCS21_STRAW      RKEAARHAGEAGCAVAALATSPLP--VSPSIAMNRRYQWMAEQYGIAMQEQLTCGCHVHV
GCS2_STRCO       REEAGRHAGGIGCAVAALATSPLP--VTPSIGVNRRYEWMAEQYGVVVHEQLVLGCHVHV
GCS22_FRAAA      RRAAARAAEAAGVALAATATCPTP--TRPTITPKPRYERMRGEFGLTAREQLTCGCHVHV
GCS21_NOCSJ      RRTAGEAARAAGYAAGACGIVPLGG-DRSVVSPNDRYRDMVDTYGEIARTGGTCGMHVHV
GCS2_RHOBA       RRMLIDAARSNETELASAGTNPLPIPTDDALTPKDRYQAMTDRYQQIARDLFIFGCHVHV
GCS22_STRAW      RHVLGRAAESNGCRLAACGTPPIKEESPPPLTNNPRYRAMRAQAPQLVAEQLVCGTHVHV
GCS22_MYCSJ      RSTVARAADDSGARLLAVAVPPTVPH-EFPVTDNPRYHRIAERFGMLAREQGICGAHVHV
GCS22_MYCSK      RSTVARAADDSGARLLAVAVPPTVPH-EFPVTDNPRYHRIAERFGMLAREQGICGAHVHV
GCS22_MYCVP      RRTASAAAEHAGARLLAVGLPPTLPH-EFPVTDTPRYRDIGERYGMIAHEQGICGCHVHV
GCS21_NOCFA      RCGVARCAQANESRLLAVAIPPTVPH-EFPVTDTPRYRRIAESFGMIAHEQGLCGCHVHV
GCS24_RHOJR      RAVTADAAARTGCQLLAVGTPMYSPP-HDSITDTPRHRRIAEQFGALATGV-MCGCHVHV
GCS21_SACEN      RRALAADAAEQGYRLASVGVPPIGSAGPPPVTDSPRYRRMYETYGSIIEDQGVCGCHVHV
GCS21_RHOJR      RRRLAKAAAGRDLLLLPSGTSLVVEGLPPAITPSPRYEEMARHFGSIVDTVTTCGCHVHV
GCS22_SACEN      RTSLDRAASVAGARIVSSGTPVLAVEGTGTS-NGQRFADIAERYRAVASDYHVCGCHVHV
GCS2_JANSC       RATVAECAGRFGLAPIAVSCHPFADWKDQSHTDKDRYNQLARDLGGVVERMLICGAHCHV
GCS2_RUEPO       RAGVSQRAAEHNLTPIAVSCHPFASWKDQHHTRKERYDALQHALGGVARRMLICGMHVHI
GCS2_PARDP       RGSIARHAAEFGLAPISVACHPVADWRAQGRTDKDRYNQISQEMGGVARRMLICGMHVHV
GCS2_RHORT       RRVLAEEAKGFGLAPIAASTHPFAEWADLKHTPKERYDLLAEDLQAVVRRLVICGMHVHV
GCS2_BRADU       RREVANVAAQYGFVIMACGTHPTAVWRMSQPSPKPRYEEMIEDLRSIGHRNMMCGMHVHV
GCS2_PSEAE       RQRLAHLAMDFGLRSLCVGTHPFADWRRARSNPAAHFARLFEDQGRVARRSLVCGLHVHV
GCS2_PSEAB       RQRLAHLAMDFGLRSLCVGTHPFADWRRARSNPAAHFARLFEDQGRVARRSLVCGLHVHV
GCS2_PSEE4       RQRLGEALGDFGVGLYGAASHPCAQWLRQHPRGTAHFRQLFDDYRLVARRSLVNGLHVHV
GCS2_PSEPK       RQRLRVALAEEGMGPYAAASHPCAAWLLQKPAAQGHYKQLFDDYRHVARRSLLNGLHVHV
GCS2_PSEF5       RSALDQALASHGLGFICAGSHPLADWHEQRATPQAHFRQLFNEFALAARRSVLSGLHVHA
GCS2_HALMA       RDALVDHAEANGFGIAAAGLHPLAKWRELEHAEKPRYKSQLDRIQYPQHRNTTAGLHVHV
GCS2_NATPD       RKALVSHAETHGFGIAAAGLHPAAKWRELDHAEKPRYRAQLDRIQYPQHRNTTAGLHIHV
GCS2_HALSA       RAALVAYASEHGLRIAGAGLHPGARWREHEHAEKPRYRSQLDRIQYPQHRNTTAGLHIHV
GCS2_HALWD       RDALVTHAADHGYRIAAAGLHPTAKWRERNHVEKPRYQSQLDRIQYPQHRNTTAGLHVHV
GCS22_RUBXD      RRTLLEHAGRLGRVLGTSGTHPLGDWREQEIIDKPHYQYLKRKLGWLIRRNNTFSLHVHY
                                                     .                 . : * 

GCS2_ACIAC       GCPDADAALLMLHRMSRYIPHFIALSASSPYVQGQDTAFDSARLNSVFAFPLSGRAPM-V
GCS2_ACISJ       GCPDADSALLMLHRMSRYIPHFIALSASSPYVQAQDTQFDSARLNSVFAFPLSGRAPC-V
GCS2_VEREI       GCPDANAALLMLHRMSRYIPHFIALSASSPYVQGQDTAFDSARLNSVFAFPLSGRAPL-A
GCS2_POLNA       GCPDADTALLTLHRMSRYIPHFIALSASSPYVQGQDTAFDSARLNSVFAFPLSGRAPF-A
GCS2_POLSJ       GCPNADSALLTLHRMSRYIPHFIALSASSPYVQGQDTAFDSARLNSVFAFPLSGRAPF-A
GCS2_AZOSB       GCPGPDAALYLVHGLSRYIPHLIALSASSPFLQGQDTGFQSSRLNAVFAFPLSGRAPF-A
GCS2_BURCA       GCPDPDSALFLLHSMSRFIPHFIALSASSPFVQNVDTGFHSARLNSVFAFPLSGRAPF-V
GCS2_BURCH       GCPDPDSALFLLHSMSRFIPHFIALSASSPFVQNVDTGFHSARLNSVFAFPLSGRAPF-V
GCS2_BURCM       GCPDPDSALFLLHSMSRFIPHFIALSASSPFVQNVDTGFHSARLNSVFAFPLSGRAPF-V
GCS2_BURL3       GCPDPDSALFLLHSMSRFIPHFIALSASSPFVQNVDTGFHSARLNSVFAFPLSGRAPF-V
GCS2_BURMA       GCPDADSALFLLHSMSRFIPHFIALSASSPYVQNVDTGFHSARLNSVFAFPLSGRAPF-V
GCS2_BURP1       GCPDADSALFLLHSMSRFIPHFIALSASSPYVQNVDTGFHSARLNSVFAFPLSGRAPF-V
GCS2_BURPS       GCPDADSALFLLHSMSRFIPHFIALSASSPYVQNVDTGFHSARLNSVFAFPLSGRAPF-V
GCS2_BURTA       GCPDADSALFLLHSMSRFIPHFIALSASSPYVQNVDTGFHSARLNSVFAFPLSGRAPF-V
GCS2_PARXL       GCPDPNSALYLLHSMSRFIPHFIALSASSPFVQGVDTGFHSARLNSVFAFPLSGRAPF-V
GCS2_CUPNH       GCPSADESLFLLHAIGRYVPHFVALAASSPYVQGVDTGFASARLNSVAAFPMSGRAPF-L
GCS2_CUPPJ       GCPSADESLFLLHAIGRYVPHFVALAASSPYVQGVDTGFASARLNSVAAFPMSGRAPF-L
GCS2_CUPMC       GCPSPDESLFLLHAIGRYVPHFIALAASSPYVQGVDTGFASARLNSVAAFPMSGRAPF-V
GCS2_RALSO       GCPSPDDALYLLHAMSRYVPHFIALAASSPFVQGVDTGFASARLNSVSAFPMSGRAPF-V
GCS2_METPP       GCPDGDQALWLLHALSRYVPHFIALSASSPYVQGQDTGFDSARLNSVFAFPLSGRAPF-V
GCS2_NITMU       GCPGPDEALHLTHMLSRYIPHFIALSASSPFVQGHDTGFASARLNSVFSFPLSGRAPF-V
GCS21_LEGPL      GCEDGNQALFLLHSLNRYIPHFIALSASSPFVQSKDTLYNSARLNSVFAFPLSGRAPF-V
GCS21_LEGPA      GCEDGNQALFLLHSLNRYIPHFIALSASSPFVQSKDTLYNSARLNSVFAFPLSGRAPF-V
GCS2_CHRVO       GCPDGDAAVRLTHYLARYIPHFIALSASSPFYQGVDTSFQTSRLTSVNAFPLSGCMPV-V
GCS22_LEGPL      GCPTGDDAIYLTHALARYVPHFIAISASSPFYLGINTNYCSSRSTIFNAFPLSGVIPY-L
GCS2_LEGPH       GCPTGDDAIYLTHALARYVPHFIAISASSPFYLGINTNYCSSRSTIFNAFPLSGVIPY-L
GCS22_LEGPA      GCPTGDDAIYLTHALARYVPHFIAISASSPFYLGINTNYCSSRSTIFNAFPLSGVIPY-L
GCS2_DECAR       GCTSADEAIWLTQAFGVYVPAFIALSASSPFVDGVDSFYQSARLNAVSAFPLSGQCPP-L
GCS2_ECOLI       GCASGDDAIYLLHGLSRFVPHFIALSAASPYMQGTDTRFASSRPNIFSAFPDNGPMPW-V
GCS2_SHISS       GCASGDDAIYLLHGLSRFVPHFIALSAASPYMQGTDTRFASSRPNIFSAFPDNGPMPW-V
GCS2_SHIFL       GCASGDDAIYLLHGLSRFVPHFIALSAASPYMQGTDTRFAPSRPNIFSAFPDNGPMPW-V
GCS2_SHIF8       GCASGDDAIYLLHGLSRFVPHFIALSAASPYMQGTDTRFAPSRPNIFSAFPDNGPMPW-V
GCS2_ECO57       GCASGDDAIYLLHGLSRFVPHFIALSAASPYMQGTDTRFASSRPNIFSAFPDNGPMPW-V
GCS2_SHIBS       GCASGDDAIYLLHGLSRFVPHFIALSAASPYMQGTDTRFASSRPNIFSAFPDNGPMPW-V
GCS2_SHIDS       GCASGDDAIYLLHGLSRFVPHFIALSAASPYMQGTDTRFASSRPNIFSAFPDNGPMPW-V
GCS2_ECOUT       GCASGDDAIYLLHGLSRFVPHFIALSAASPYMQGTDTRFASSRPNIFSAFPDNGPMPW-V
GCS2_ECOK1       GCASGDDAIYLLHGLSRFVPHFIALSAASPYMQGTDTRFASSRPNIFSAFPDNGPMPW-V
GCS2_ECOL5       GCASGDDAIYLLHGLSRFVPHFIALSAASPYMQGTDTRFASSRPNIFSAFPDNGPMPW-V
GCS2_ECOL6       GCASGDDAIYLLHGLSRFVPHFIALSAASPYMQGTDTRFASSRPNIFSAFPDNGPMPW-V
GCS2_SALTI       GCANGDDAIYLLHGLSHFVPHFIALSAASPYMQGSDTRFACARLNIFSAFPDNGPMPW-V
GCS2_SALTY       GCANGDDAIYLLHGLSHFVPHFIALSAASPYMQGADTRFACARLNIFSAFPDNGPMPW-V
GCS2_SALCH       GCANGDDAIYLLHGLSHFVPHFIALSAASPYMQGSDTRFACARLNIFSAFPDNGPMPW-V
GCS2_SALPA       GCANGDDAIYLLHGLSHFVPHFIALSAASPYMQGADTRFACARLNIFSAFPDNGPMPW-V
GCS2_BORBR       GVPSGDAAVRMVRGLSPYVPHFIALSAASPYCEGVDTLFSCCRLNAVNSFPLAGHMPADV
GCS2_BORPA       GVPSGDAAVRMVRGLSPYVPHFIALSAASPYCEGVDTLFSCCRLNAVNSFPLAGHMPADV
GCS2_BORPE       GVPSGDAAVRMVRGLSPYVPHFIALSAASPYCEGVDTLFSCCRLNAVNSFPLAGHMPADV
GCS2_BORA1       GVPSGDAAVRLVHGLSPYVPHFIALSASSPYREGVDTLFSCARLNAVNSFPLAGHLPPEV
GCS2_TRIV2       GMPSGDVAIDIMGRLKPYLPILLALSASSPFWWGHDTSFASFRQRFLSSMRTYGICPT-F
GCS2_BDEBA       GMKDGDHCIAMMNEFLYYLPHMLAMSASSPFWTGHDTGLASSRITVFEAHPAGG-TPCRV
GCS2_GLOVI       GMPDGDTAIQVINQITQYAPMLLALSANSPFWEGDDTGLDSCRTKVFENLSSAG-LPFRF
GCS22_PAEAT      GIDHRDKVLPILDGLVNYFPHFQALSASSPYWAGEETGYASQRALMFQQLPTAG-LPFQF
GCS21_ARTS2      GLDSRDKVLPVLDGLVNYFPHFQALSASSPFWGGEDTGYASQRALMFQQLPTAG-LPFQF
GCS2_LEIXX       GIDERDKALPIVNGLLTYYPHLQALSASSPFWAGANTGYASNRALMFQQLPTAG-LPWQF
GCS2_MYCA1       GISSPNKVMPIMTSLLNYYPHLLALSASSPWWTGVDTGYASNRAMMFQQLPTAG-LPFQF
GCS2_MYCPA       GISSPNKVMPIMTSLLNYYPHLLALSASSPWWTGVDTGYASNRAMMFQQLPTAG-LPFQF
GCS2_MYCBO       GIRSAHKVMPIMTSLLNYYPHLLALSASSPWWGGEDTGYASNRAMMFQQLPTAG-LPFHF
GCS2_MYCBP       GIRSAHKVMPIMTSLLNYYPHLLALSASSPWWGGEDTGYASNRAMMFQQLPTAG-LPFHF
GCS2_MYCTU       GIRSAHKVMPIMTSLLNYYPHLLALSASSPWWGGEDTGYASNRAMMFQQLPTAG-LPFHF
GCS2_MYCUA       GVSSANKVMPIISALLNYYPHLLALSASSPWWGGEDTGYASNRAMMFQQLPTAG-LPFQF
GCS21_MYCSK      GISSAHKVMPIISSLLNQYPHLLALSASSPYWDGSDTGYASNRAMMFQQLPTAG-LPFQF
GCS2_MYCSS       GISSAHKVMPIISSLLNQYPHLLALSASSPYWDGSDTGYASNRAMMFQQLPTAG-LPFQF
GCS21_MYCSJ      GISSAHKVMPIISSLLNQYPHLLALSASSPYWDGSDTGYASNRAMMFQQLPTAG-LPFQF
GCS21_MYCVP      GVSSAHKVMPIITALLHQYPHLLALSASSPYWDGEDTGYASNRAMMFQQLPTAG-LPFHF
GCS22_NOCFA      GVSHREKVFPILNSLLTTFPHLLALSASSPMWAGSDTGYASNRTLMFQQLPTAG-LPFQF
GCS22_RHOJR      GVSSPQKVFPILNALLQRYPHLLALSASSPMWAGVNTGYASNRALMFQQLPTAG-LPYQF
GCS23_NOCSJ      GMPERDRVMAVLSSLLNFHPHLQALSASSPIWSGIDTGYASNRALMFQQLPTAG-LPFQF
GCS21_COREF      GISHEDRVWPIINALVTNYPHLLALSASSPAWDGLDTGYASNRTMLYQQLPTAG-LPYQF
GCS2_CORGL       GISHEDRVWPIINALLTNYPHLLALSASSPAWDGLDTGYASNRTMLYQQLPTAG-LPYQF
GCS2_CORDI       GISSKDRVWPIINAMLTYYPHLLALTASSPGWDGIDTGYASNRTMLYQQLPTAG-LPYQF
GCS2_CORJK       GVGSKEKVWPIINALMTHYPHILAMSASSPAWEGLDTGYSSNRTLLYQQLPTAG-MPYQF
GCS21_FRAAA      GVRSPDKAMPIMNALMVYIPHFLALSASSPFWLGGDTGLASSRSQVFASLPTAG-LPYPL
GCS21_FRACC      GVRSADKAMPIVNALMAYVPHFLALSASSPYWLGGDTGLASSRSQVFASLPTAG-LPYPL
GCS2_THEFY       GVTDRDKVIPIVNALSRYLPHFLALTASSPFWSGHDTGLASSRSIVFGALPTAG-PPPRL
GCS21_RUBXD      AVPGPEEAIQAHNRLAEQAPLLLALSANSPYWQGMDTGFESSRVQIFETFPRAG-MPPAF
GCS23_RUBXD      AVPGGEEAVRAVSALARHVPLFIALSANSPFWEGRDTRLASVRAKVFGLIPRSG-LPPRF
GCS2_SOLUE       GVEDRETAIQLMNSARYFLPHLLALSANSPFWVGMETGLRSYRCKVFDKFPRTN-IPDLY
GCS23_PAEAT      SVESPEEGVVVLDHIRDKLAVLTALTANSPYWRGLPTGFDSYRTQAWNRWPTSG-PSSVF
GCS22_ARTS2      FVESPEEGVAVIDRLRDKLAVLTALSANSPYWNGVETGFESYRTQAWNRWPTSG-PSQIF
GCS21_PAEAT      SIESPEEGVAVLDRMRHWLPVLLALSANSPFWMGADTGFASYRTQIWNRWPTAG-PMDVF
GCS22_COREF      QVESPAEAVAVLDRVRVWLPVVLALSANSPFWQGFDTDFASYRYQAWNRWPTAG-PTDVF
GCS22_NOCSJ      AVGSTAEAVGVLDRIRVWLPALLALSANSPFWQGRDTGYASFRIQALGRWPLSG-PTELF
GCS21_STRAW      AVESDEEGVAVVDRIRPWLPVLVALSANSPFWQGRDSSYESYRSRVWGRWPSAG-PTELF
GCS2_STRCO       SVDSDEEGVAVIDRVRPWLPVLAALSANSPFWQGRDSSYSSYRSRVWQRWPSAG-PTELF
GCS22_FRAAA      AVHSRQEAVGALDRLRPWLSVLVAMTANSPFWQGADSGYASYRTQVWQRWPTAG-ATGAF
GCS21_NOCSJ      DIGSDEEGVAVVDRIAPWLPVLVALAANSPYVEGRDSGYASWRAQVWARWPSAG-PTEQF
GCS2_RHOBA       AMEDRELGIQVMNRCRRWLPILQAITANSPYWDGVDTGYASYRRELWAQWPMAG-PPAHF
GCS22_STRAW      GVPDPEIGVAVLNRIRLWLPVLVAMSANSPFWAGHDTGFASWRTVIFGRWPVSG-PPPHF
GCS22_MYCSJ      AVPTREVAIRVSNRLRPWLPVLLALTANSAIYRNADSGYASWRRMLWARWPSAG-PPPHF
GCS22_MYCSK      AVPTREVAIRVSNRLRPWLPVLLALTANSAIYRNADSGYASWRRMLWARWPSAG-PPPHF
GCS22_MYCVP      AVPDRDAAIAVSNRLRPWLPLLLALTANSAIYRNADTGHASWRSVLWARWPSAG-PPPHF
GCS21_NOCFA      AVPDRETAVQVSNYLRPWLPMLLALTANSAIYRGSDTGYASWRSILWRRWPSAG-PPPYF
GCS24_RHOJR      GVPGREQAIQIINHLRPWLPTLLALTANSPIADGCDTGYASWRYILFGHWPSAG-PPPYF
GCS21_SACEN      GALDLETALVAGNHLRPWLPALLLLTTNSPFFRGGDTGYASWRTTLWSRWPAAG-PPPVL
GCS21_RHOJR      GIPSRDVGVRVSNLVRSWLPVLLALAANSPFHSGHDTAYHSWRHIMWSRWPSAG-PPPHF
GCS22_SACEN      GVPDRDTAVAVVNHLRPWLPTLLAISANSPFHLGHDTGHASWRGVQQRLYPGSG-VPPHF
GCS2_JANSC       GLPSENDRVDIMRQMTYFLPHLLALSTSSPFWQGRDTGLASYRLTVFDNLPRTG-LPPSF
GCS2_RUEPO       GVEDKALRADLMPQLSYFLPHMLALSASSPFWNGEDTGLSSYRLTIFDNLPRTG-LPPSF
GCS2_PARDP       GISDKDMRIDLMNQFSWFLPHLLALSASSPFWLGEDTLLASYRTTVFAGYPRTG-LPPRL
GCS2_RHORT       GIEDPDLRMDLMAQVSYFLPHLLALTTSSPFWRGEDSGLKSYRIAVFSALPRTG-LPDSF
GCS2_BRADU       QLPDPEKRMAVMRAMLPHLPLFIALSASSPFWNSHKTGLKGYRLAAYSELPRTG-LPELF
GCS2_PSEAE       EIPPSHDRMAVLQRVLPWLPLLLALSASSPFRGGRRSGLASYRRALCGEWPRMN-IPPAL
GCS2_PSEAB       EIPPSHDRMAVLQRVLPWLPLLLALSASSPFRGGRRSGLASYRRALCGEWPRMN-IPPAL
GCS2_PSEE4       GVPAGTDRMQLINRVLYWLPLFLVLSTSSPLWGGQDTGYMSYRRVICGEWPHMG-LPEPL
GCS2_PSEPK       GVPPACDRMQLINRLLPWLPLLLALSTSSPLWAGQPTGYLSYRRVICGEWPHMG-LPEAL
GCS2_PSEF5       QVPAAVDRIAVMNEVLPWTPLLLALSLSSPFWQGHDSGYLSYRQVACDEWPRMG-IPEYL
GCS2_HALMA       GVDDADKAVWVANELRWHLPLMLALSANSPYWNGFDTGLQSARGKIFEALPNTG-MPTTF
GCS2_NATPD       GVDDADKAVWVANELRWYMPVMLALSANSPYWNGFDTGLQSARAKIFEALPNTG-MPTAF
GCS2_HALSA       GVDDPDKAVWVSNRMRWHMPVLLALSANSPYWNGFDTGLASARAKIFEGLPNTG-LPTAF
GCS2_HALWD       GVDDPDAATWIANELRWYLPPLLALSANSPYWNGFDTGLASARAKIFEALPNTG-MPTRF
GCS22_RUBXD      AVQGKEKVIYLFDRIREYVPHFLAVSVNSPFWQGEFTDTRSARALVFSRSLPHAGMPEAF
                                    . .  ::  *.      :     *                 

GCS2_ACIAC       LTWKDFE-AYFDKMTRTGVVKSMKDFYWDIRPKPEFGTIEIRVFDTPLTIERAAALSAFV
GCS2_ACISJ       LTWSEFE-QYFNKMTRTGVVKSMKDFYWDIRPKPEYGTIEIRVFDTPLTIERAAALAGYV
GCS2_VEREI       LTWEDFG-AYFDKMTRTGVVRSMKDFYWDIRPKPEFGTIEIRVFDTPLTIERAAALAGYV
GCS2_POLNA       LTWDEFT-VYFNKMAHTGVVKSMKDFYWDIRPKPEFGTIEIRVFDTPLTIERATALAGYV
GCS2_POLSJ       LTWDDFK-VYFDKMTRTGVVKSMKDFYWDIRPKPEFGTIEIRVFDTPLTVERATALAGFV
GCS2_AZOSB       LSWSDFG-AYFDKMSATGVVSSMKDFYWDIRPKPEYGTVEVRVMDTPLTVERAAALAAYI
GCS2_BURCA       LTWDSFE-EYFTKMVNTGVVNSMKDFYWDIRPKPGYGTIEVRVMDTPLSVDRAAAIACYI
GCS2_BURCH       LTWDSFE-EYFTKMVNTGVVNSMKDFYWDIRPKPGYGTIEVRVMDTPLSVDRAAAIACYI
GCS2_BURCM       LTWDSFE-EYFTKMVNTGVVNSMKDFYWDIRPKPGYGTIEVRVMDTPLSVDRAAAIACYI
GCS2_BURL3       LTWDSFE-EYFTKMVNTGVVNSMKDFYWDIRPKPGYGTIEVRVMDTPLSVDRAAAIACYI
GCS2_BURMA       LTWHGFE-EYFTKMVNTGVVNSMKDFYWDIRPKPGYGTIEVRVMDTPLSVDRAAAIACYI
GCS2_BURP1       LTWHGFE-EYFTKMVNTGVVNSMKDFYWDIRPKPGYGTIEVRVMDTPLSVDRAAAIACYI
GCS2_BURPS       LTWHGFE-EYFTKMVNTGVVNSMKDFYWDIRPKPGYGTIEVRVMDTPLSVDRAAAIACYI
GCS2_BURTA       LTWSGFE-EYFTKMVNTGVVNSMKDFYWDIRPKPGYGTIEVRVMDTPLSVDRAAAIACYI
GCS2_PARXL       LTWDSFE-EYFSKMVHTGVVNSMKDFYWDIRPKPGFGTIEVRVMDTPLSVDRAAAIACYI
GCS2_CUPNH       LTWDAFT-AYFEKMRNTGVIESMKDFYWDIRPKPEFGTIEVRVMDTPLTVQRACDIAAYI
GCS2_CUPPJ       LTWDAFT-AYFEKMRNTGVIESMKDFYWDIRPKPEFGTIEVRVMDTPLTVERACDIAAYI
GCS2_CUPMC       LTWDAFK-AYFDKMRATGVIESMKDFYWDIRPKPEFGTIEVRVMDTPLTVQRACDIAAYI
GCS2_RALSO       LTWDAFV-AYFEKMRATGVIESMKDFYWDIRPKPEFGTIEVRVMDTPLTVERAAAVAAYI
GCS2_METPP       RSWEEFG-GFFDKMTATGVVQSMKDFYWDIRPKPEFGTIELRVCDTPLSVDKAAALACYL
GCS2_NITMU       LRWNDFE-KFFAKMTGTGVVESMKDFYWDIRPKPEFGTIEVRVCDTPLTVEIAASIACYI
GCS21_LEGPL      LNWDEFSLGYFEKMEHTGIVKSMKDFYWDLRPKPEFGTIEMRVCDSPLTVERAAALACYM
GCS21_LEGPA      LNWDEFSLGYFEKMEHTGIVKSMKDFYWDLRPKPEFGTIEMRVCDSPLTVERAAALACYM
GCS2_CHRVO       DSWDAFN-AYFERMEALGIVASMKDFYWDIRPKPEYGTVEIRICDTPLSVETPVLLAAYA
GCS22_LEGPL      RNWQEFS-DYYRKMYRWKIIENMKDFYWDIRPKPELGTIEIRVCDTPLTLRKSILITAYI
GCS2_LEGPH       RNWQEFS-DYYRKMYRWKIIENMKDFYWDIRPKPELGTIEIRVCDTPLTLRKSILITAYI
GCS22_LEGPA      RSWQEFS-DYYRKMYRWKIIENMKDFYWDIRPKPELGTIEIRVCDTPLTLRKSILITAYI
GCS2_DECAR       GSWQEFT-EHFAFLQACGIAQSIKDLYWDVRPKPEFGTVEIRVCDTPLTIEQATSLAALA
GCS2_ECOLI       SNWQQFE-ALFRCLSYTTMIDSIKDLHWDIRPSPHFGTVEVRVMDTPLTLSHAVNMAGLI
GCS2_SHISS       SNWQQFE-ALFRCLSYTTMIDSIKDLHWDIRPSPHFGTVEVRVMDTPLTLSHAVNMAGLI
GCS2_SHIFL       SNWQQFE-ALFRCLSYTTMIDSIKDLHWDIRPSPHFGTVEVRVMDTPLTLSHAVNMAGLI
GCS2_SHIF8       SNWQQFE-ALFRCLSYTTMIDSIKDLHWDIRPSPHFGTVEVRVMDTPLTLSHAVNMAGLI
GCS2_ECO57       SNWQQFE-ALFRCLSYTTMIDSIKDLHWDIRPSPHFGTVEVRVMDTPLTLSHAVNMAGLI
GCS2_SHIBS       SNWQQFE-ALFRCLSYTTMIDSIKDLHWDIRPSPHFGTVEVRVMDTPLTLSHAVNMAGLI
GCS2_SHIDS       SNWQQFE-ALFRCLSYTTMIDSIKDLHWDIRPSPHFGTVEVRVMDTPLTLSHAVNMAGLI
GCS2_ECOUT       SNWQQFE-ALFRCLSYTTMIDSIKDLHWDIRPSPHFGTVEVRVMDTPLTLSHAVNMAGLI
GCS2_ECOK1       SNWQQFE-ALFRCLSYTTMIDSIKDLHWDIRPSPHFGTVEVRVMDTPLTLSHAVNMAGLI
GCS2_ECOL5       SNWQQFE-ALFRCLSYTTMIDSIKDLHWDIRPSPHFGTVEVRVMDTPLTLSHAVNMAGLI
GCS2_ECOL6       SNWQQFE-ALFRCLSYTTMIDSIKDLHWDIRPSPHFGTVEVRVMDTPLTLSHAVNMAGLI
GCS2_SALTI       SNWQEFA-GLFRRLSYTTMIDSIKDLHWDIRPSPAFGTVEVRVMDTPLTLDHAINMAGLI
GCS2_SALTY       SNWQEFA-GLFRRLSYTTMIDSIKDLHWDIRPSPAFGTVEVRVMDTPLTLDHAINMAGLI
GCS2_SALCH       SNWQEFA-GLFRRLSYTTMIDSIKDLHWDIRPSPAFGTVEVRVMDTPLTLDHAINMAGLI
GCS2_SALPA       SNWQEFT-GLFRRLSYTTMIDSIKDLHWDIRPSPAFGTVEVRVMDTPLTLDHAINMAGLI
GCS2_BORBR       TDWYRFE-AHLAQLRASGLAESIKDLYWDIRPKPEYGTVEIRVCDTPLTVERACQLAAFA
GCS2_BORPA       TDWYRFE-AHLAQLRASGLAESIKDLYWDIRPKPEYGTVEIRVCDTPLTVERACQLAAFA
GCS2_BORPE       TDWYRFE-AHLAQLCASGLAESIKDLYWDIRPKPEYGTVEIRVCDTPLTVERACQLAAFA
GCS2_BORA1       ADWYHFE-AHIAQLRASGLAESIKDLYWDIRPKPEFGTVEIRVCDTPLTVERACQLAAFA
GCS2_TRIV2       KNWQDFT-NFFATAQNAGMFEIIRDIHWDLRPQPDFGTLEVRVMDAQPTIKESMMLAAFI
GCS2_BDEBA       ENWAQFE-DIVQKLTRSNSIGSFKDIWWDIRPSPNYGTLEIRICDGVPGIRKTTRLVAFI
GCS2_GLOVI       ENWEGYE-NLINVLLETGSIGSQREIWWDIRPHSDFGTIEVRICDATRTLAEVLALTALV
GCS22_PAEAT      ETWEAYE-SYVQDMFTTGVIDATSEIRWDIRPVANLGTIEMRICDGLATLEEVGAIAALT
GCS21_ARTS2      STWAEYE-SYVQDMFTTGVIDTISEIRWDIRPVPNLGTIEMRICDGLATLEEVGAIAALT
GCS2_LEIXX       GAWANYE-EYVQDLVTTGVVTDHSEVRWDIRPSPKWGTVEMRACDGLSTADEVGAVAALI
GCS2_MYCA1       QTWAEFE-GFVYDQKKTGIIDHVDEVRWDIRPSPHLGTLEMRICDGVSNLHELAALVALT
GCS2_MYCPA       QTWAEFE-GFVYDQKKTGIIDHVDEVRWDIRPSPHLGTLEMRICDGVSNLHELAALVALT
GCS2_MYCBO       QRWAEFE-GFVYDQKKTGIIDHMDEIRWDIRPSPHLGTLEVRICDGVSNLRELGALVALT
GCS2_MYCBP       QRWAEFE-GFVYDQKKTGIIDHMDEIRWDIRPSPHLGTLEVRICDGVSNLRELGALVALT
GCS2_MYCTU       QRWAEFE-GFVYDQKKTGIIDHMDEIRWDIRPSPHLGTLEVRICDGVSNLRELGALVALT
GCS2_MYCUA       QTWSEFE-GFVYDQKKTGIIDHINEIRWDIRPSPHLGTIELRICDGVSNLRELGALVALM
GCS21_MYCSK      QSWPEFE-RFVHDQKKTGIIDHMNEIRWDIRPSPHLGTVEIRVFDGVSNIAELGSLVALT
GCS2_MYCSS       QSWPEFE-RFVHDQKKTGIIDHMNEIRWDIRPSPHLGTVEIRVFDGVSNIAELGSLVALT
GCS21_MYCSJ      QSWPEFE-RFVHDQKKTGIIDHMNEIRWDIRPSPHLGTVEIRVFDGVSNIAELGSLVALT
GCS21_MYCVP      QEWREFE-RFVSDQKKTGIIDHMNEIRWDIRPSPHLGTIEVRIFDGVSNLHELSALVALT
GCS22_NOCFA      ENWRQFE-HFVHDELKTGVFEQLGGLHWDIRPAPKWGTIEVRICDGIPTHAELAAIAAFI
GCS22_RHOJR      ANWGQYE-DFISDQMKTGVITKIGGMHWDIRPAPRWGTIEVRVFDGISTRAELSSLVALV
GCS23_NOCSJ      ERWSEFE-AFVGDELVTGVIEELSEVRWDVRPAPRIGTLENRICDGVPDLADLSSLVALM
GCS21_COREF      QSWDEWV-SYMADQDKSGVINHTGSMHFDIRPASKWGTIEVRIADSTSNLRELSAIAALT
GCS2_CORGL       QSWDEWC-SYMADQDKSGVINHTGSMHFDIRPASKWGTIEVRVADSTSNLRELSAIVALT
GCS2_CORDI       QSWDEWE-AYMADQNKSGVINHTGSMHFDIRP-TRYGTVEVRICDST-NLRELSAAVALT
GCS2_CORJK       ENWEQWE-EFNRDQDLSGVINHTGSMHFDVRP-TKYGTVETRFADATMELWELAAIAAYT
GCS21_FRAAA      EDWPRFE-SFMETLIAAGTIETIREVWWDIRPHPNFGTVELRICDGLPTLLEVGAVAALA
GCS21_FRACC      EDWPGFE-SFMETLIVSGTIETIREVWWDIRPHPNFGTVELRVCDGLPSLMEVGAVAALA
GCS2_THEFY       AHWGAFE-EYMDTLLRAGTITSIKEVWWDIRPHPEFGTVEIRMFDGIPTVREVGMAAALS
GCS21_RUBXD      PEYAAFE-AYVDLMVECGAMDDYTFCWWDVRPHPKLGTIELRVLDSQTHLRHAVALTALT
GCS23_RUBXD      ASWEEFV-RHVERLVRAGSIRDYTFCWWDVRPHPKLGTVELRAPDAQTDPGRTAALAALC
GCS2_SOLUE       QSWSEFE-NYVNLLIHTNCIDNAKKIWWDIRPHPYFPTLEFRICDMPMRLEETIAIAALC
GCS23_PAEAT      GSLTAYR-RIVKRLLETGVIMDEGMIYFDARISRNHPTVEVRVADVCLRAEDAALMAVLV
GCS22_ARTS2      GTHSMYR-RVVTRLLDSGVLLDEGMIYFDARLSRNHPTVEVRVADVCLQAEDAALIAVLV
GCS21_PAEAT      GSADGYR-QVLSELLGTGVPLDEGMIYFDARLSRGHPTVEVRIADVCLYAEDALTIAILA
GCS22_COREF      GSADAYE-QHRAALLSAGVPLDPGMLYFDARVCEHHPTVEIRVADVCLEAEHTAVIATLV
GCS22_NOCSJ      GTAAAYQ-ELVERVLAAQVVLDQGMLYFDARASHRFPTVEIRVADVCLDVRDTVLIAALC
GCS21_STRAW      GSPERYH-RQVADMVATGVILDDGMVYFDARLSHRYPTVEIRVADVCLHPDTAQLIATLA
GCS2_STRCO       GSAERYH-RRVADMLATGTVLDDGMVYFDVRLSQRYPTVEFRVADVCLDASTAVVLAALA
GCS22_FRAAA      GSPAEYD-RVVDLLIRTGAAMDDGMIYFDVRLSHHYPTLELRVADVCLSVDDSVLLAALA
GCS21_NOCSJ      GSVAGYR-EVCRMLLDVGAARDPGMLYFDARLSTGQPTVEVRVCDVGTDPAVAVTIGALV
GCS2_RHOBA       DSLADYQ-SCVDDLVACGAIKDESFLYWDIRLPTRVPTIEFRAADVMTRVEETVGYVGMI
GCS22_STRAW      ADLADHE-KRVQQLLTCGVIFDPGQLYWQARLSSRYPTVEVRCLDVQLRADDAVMFAGIV
GCS22_MYCSJ      DSADEFD-AMVRMLLQSGAMLDEGQVYWDVRPSADFPTIEVRVADVPATVADTVLFAAIV
GCS22_MYCSK      DSADEFD-AMVRMLLQSGAMLDEGQVYWDVRPSADFPTIEVRVADVPATVADTVLFAAIV
GCS22_MYCVP      DSADEYD-AAVQMLSHTGVIRDDGMVYWDVRPSANFPTVEVRVADVPATVDETVLFAALV
GCS21_NOCFA      RTAADYD-AMVTMMLSSGIVLDEKMVYWDARPSINYPTIEVRVSDVPATVGETVLLAALV
GCS24_RHOJR      DSAAHYD-AALAKMLESGAILDNRMVFWDVRAADHPPTVEVRISDVPATVEETMTLTTLV
GCS21_SACEN      TSARHYH-YVVDCLLASGAVLDSGMLYWYARPSHRVPTLEVRVADAAATVDEAVLLAGLV
GCS21_RHOJR      DSADEYE-ATVGAMIGTGAAMDRGMIYWHVRLADKQPTIEVRIADVAMTAAHAALYAVVV
GCS22_SACEN      PSRDAYD-REVARLVDCGALVDDRMSFWMARPSPHLPTVELRVADALITAEETVLQAALS
GCS2_JANSC       ASFDEFQ-RTVDLLVDMEMIEDSSKIWWDLRPSAAFPTLETRICDVSPRLEDQLSLSALI
GCS2_RUEPO       SSWAEYE-RTTGILVELGVIEDTTKIWWDLRPSHRFPTLETRIMDVQPRLEHALSLAAMN
GCS2_PARDP       GSWAEFD-RSVEMLTETGIIQDASKIWWDLRPSARFPTLETRVCDACPRLDDAITLVALV
GCS2_RHORT       SSFAEYQ-RHVEVLVSAGLIEDSTRIWWDIRPSHRFPTLEMRIADVCTRLDDALCVAALF
GCS2_BRADU       ESRHDYD-EYVGALQRSGVIPDESHIWWAMRPSMKHPTLELRAPDTCTFVDDAVAIASLY
GCS2_PSEAE       PDEDAYR-RHLALLRETGCIREDGQVWWMIRPSSHVPTLELRICDACPRLADALSLAGLF
GCS2_PSEAB       PDEDAYR-RHLALLREAGCIREDGQVWWMIRPSSHVPTLELRICDACPRLADALSLAGLF
GCS2_PSEE4       ADWHAYQ-RYRGLLQRTGALAEDGDFWWAIRPSRRFPTVELRICDGCPRLEDGLAIAGLY
GCS2_PSEPK       PDWAAYE-RYRALLQRTGALAADGDLWWALRPSRRYPTVELRICDGCPNLEDVLCIAALF
GCS2_PSEF5       HDHQAFD-DYLRLLRGIGALGAEDNAWWGIRPALRYPTLELRMTDACPRVADAQTLAGLF
GCS2_HALMA       DDYDAFE-TYEQRMLETGSIDDRGELWFDVRPHSGHGTVEVRAPDGQADPDRVLAFVEYV
GCS2_NATPD       EDFESFQ-SFERTMVETGSINDRGELWYDVRPHSEHGTVEVRTPDGQADPDHVLAFVEYT
GCS2_HALSA       ESYAAFQ-AFERRMVEHGGIEDRGELWYDVRPHSGHGTVEVRAPDAQADPAVVDAFVEYA
GCS2_HALWD       EDFEAYY-QLEKRMVETGSIKDRGELWYDVRPHTGHGTVEVRTPDAQADPSVTVAIVEYI
GCS22_RUBXD      GSWSAYA-GYLDFVGRPGVIRRLGEIWWDIRPHPRLSTLEIRAFDAQTDPARSEALISLA
                                            :  *      *:* *  *               

GCS2_ACIAC       QSLGAWFL-----AEQPFTPSEDDYLVYTYNRFQACRFGMQAVYVDPATGEHM-PLRDHI
GCS2_ACISJ       QSLAAWFL-----AEQPFTPTEDDYLVYTYNRFQACRFGLDAVYVDPASGDHM-PLRDHI
GCS2_VEREI       QSLGAWFL-----ADQPFMPAEDDYLVYTYNRFQACRFGLEAVYVDPAAGGHM-PLRQHI
GCS2_POLNA       QSLGSWFM-----NDQPFMPTEDDYLVYTYNRFQACRFGLDAVYVDPATGGHM-PLREHI
GCS2_POLSJ       QSLASWFM-----NEQPFMPTEDDYLVYTYNRFQACRFGLDAVYVDPATGGHM-PLREHI
GCS2_AZOSB       QALARYLM-----VERPIQPREDDYLVYTFNRFQACRFGYAGTYVDPENHTHC-SIAEAL
GCS2_BURCA       QTLARYLL-----TDRPLKLSEDDYLVYTFNRFEACRFGLEGTCVNPQTGERR-TIAEDI
GCS2_BURCH       QTLARYLL-----TDRPLKLSEDDYLVYTFNRFEACRFGLEGTCVNPQTGERR-TIAEDI
GCS2_BURCM       QTLARYLL-----TDRPLKLSEDDYLVYTFNRFEACRFGLEGTCVNPQTGERR-TIAEDI
GCS2_BURL3       QTLARYLL-----TDRPLKLSEDDYLVYTFNRFEACRFGLEGTCVNPQTGERR-TIAEDI
GCS2_BURMA       QTLARYLL-----IDRPLKLSEDDYLVYTFNRFEACRFGLEGTCVNPQTGERR-TIAEDI
GCS2_BURP1       QTLARYLL-----IDRPLKLSEDDYLVYTFNRFEACRFGLEGTCVNPQTGERR-TIAEDI
GCS2_BURPS       QTLARYLL-----IDRPLKLSEDDYLVYTFNRFEACRFGLEGTCVNPQTGERR-TIAEDI
GCS2_BURTA       QTLARYLL-----IDRPLKLSEDDYLVYTFNRFEACRFGLEGTCVNPQTGERR-TIAEDI
GCS2_PARXL       QTLARHLL-----LDKPISPKEDDYLVYTFNRFEACRFGLAGTCINPQTGERK-TISEDI
GCS2_CUPNH       QMLARYLL-----LSRPFMPQEDDYLVYTFNRFQACRFGLEGEYVHPNELTRM-PIADHI
GCS2_CUPPJ       QMLARYLL-----LSRPFMPQEDDYLVYTFNRFQACRFGLEGEYVHPNELTRR-PIAEHI
GCS2_CUPMC       QALARYLL-----LSRPFMPQEDDYLVYTFNRFQACRFGLEGEYVHPNELTRM-PIADHI
GCS2_RALSO       QALGRWLL-----LDRPFVPTEDDYLVYTFNRFQACRFGLVGEYVDPASGQRG-ALADHI
GCS2_METPP       QCICRQLR-----EEKPFEPSEDDYLVYTFNRFQACRFGLDGEIVDPKTKQRS-RLRDDI
GCS2_NITMU       QAMSRYIM-----VEQRMAPEEDDYLVYTFNRFQACRFGLEGVFIDPRTHQQR-SIREDI
GCS21_LEGPL      QALCSYLL-----ENKEPLPHEDDYLVYNYNRFQACRFGLDGTLVHPKTYEQI-LLREDI
GCS21_LEGPA      QALCSYLL-----ENKEPLPHEDDYLVYNYNRFQACRFGLDGTLVHPKTYEQI-LLREDI
GCS2_CHRVO       QMLARRCF-----EESWNDICPEPYLTYSYNRFQACRFGFDGVMVDARSKSQL-GLQEDL
GCS22_LEGPL      QALALYLL-----EEKPVELSHDLYYVYNYNRFQASRHGLEGELTVTDKDRPI-PIMDDI
GCS2_LEGPH       QALALYLL-----EEKSVQLSHDLYYVYNYNRFQASRHGLEGELTVTDKDRPI-PIMDDI
GCS22_LEGPA      QALALYLL-----EERPVQLSHDLYYVYNYNRFQASRHGLEGELTVTDKDRPI-PIMDDI
GCS2_DECAR       QSLARWLL-----RTRPPLHTAKQAHVARYNKFQACRYGFEAMISDPVNLCQT-PLKQTL
GCS2_ECOLI       QATAHWLL-----TERPFKHQEKDYLLYKFNRFQACRYGLEGVITDPHTGDRR-PLTEDT
GCS2_SHISS       QATAHWLL-----TERPFKHQEKDYLLYKFNRFQACRYGLEGVITDPHTGDRR-PLTEDT
GCS2_SHIFL       QATAHWLL-----TERPFKHQEKDYLLYKFNRFQACRYGLEGVITDPHTGDRR-PLTEDT
GCS2_SHIF8       QATAHWLL-----TERPFKHQEKDYLLYKFNRFQACRYGLEGVITDPHTGDRR-PLTEDT
GCS2_ECO57       QATAHWLL-----TERPFKHKEKDYLLYKFNRFQACRYGLEGVITDPYTGDRR-PLTEDT
GCS2_SHIBS       QATAHWLL-----TERPFKHQEKDYLLYKFNRFQACRYGLEGVITDPHTGDRR-PLTEDT
GCS2_SHIDS       QATAHWLL-----TERPFKHQEKDYLLYKFNRFQACRYGLEGVITDPYTGDRR-PLTEDT
GCS2_ECOUT       QATAHWLL-----TERPFKHQEKDYLLYKFNRFQACRYGLEGVITDPHTGDRR-SLTEAT
GCS2_ECOK1       QATAHWLL-----TERPFKHQEKDYLLYKFNRFQACRYGLEGVITDPHTGDRR-SLTEAT
GCS2_ECOL5       QATAHWLL-----TERPFKHQEKDYLMYKFNRFQACRYGLEGVITDPHTGDRR-SLTEAT
GCS2_ECOL6       QATAHWLL-----TERPFKHQEKDYLLYKFNRFQACRYGLEGVITDPHTGDRR-SLTEAT
GCS2_SALTI       QATAHWLL-----TERPFKPQEQDYLLYKFNRFQACRYGLEGVLTDVYTGDRR-RLADDT
GCS2_SALTY       QATAHWLL-----TERPFKPQEQDYLLYKFNRFQACRYGLEGVLTDAYTGDRR-RLADDT
GCS2_SALCH       QATAHWLL-----TERPFKPQEQDYLLYKFNRFQACRYGLEGVLTDAYTGDRR-RLADDT
GCS2_SALPA       QATAHWLL-----TERPFKPQEQDYLLYKFNRFQACRYGLESVLIDVYTGDRR-RLADDT
GCS2_BORBR       QALAVQVA-----RDP--EPSQQAWLAYRSNHFQACRFGLHGSYVTP-DGQRV-RLVDHL
GCS2_BORPA       QALAVQVA-----RDP--EPSQQAWLAYRSNHFQACRFGLHGSYVTP-DGQRV-RLVDHL
GCS2_BORPE       QALAVQVA-----RDP--EPSQQAWLAYRSNHFQACRFGLHGSYVTP-DGQRV-RLVDHL
GCS2_BORA1       QALAVLLE-----REP--SPPTQAWLAYRSNHFQACRFGLHGSYVTP-GGQRV-RLADHL
GCS2_TRIV2       HSLIVDMYHHSQGKQTEFLLTPLPWLIERENYFRASRWGLDANYIEDEQGNSR-PIRNIV
GCS2_BDEBA       HLLAKHLQ---KRLEQGIRRQTPDDWMVRENKWRASRHGLDCEVLIDNDGMTK-NLREDI
GCS2_GLOVI       QCLAVYFR---RLYENGEEIRLLHPGIIRENKWRACRWGLEGELIDPLTLKGV-PTRKLI
GCS22_PAEAT      QCLVDEFS---SILDAGGSIPTMPPWHVQENKWRAARYGMEAIIILDAEGNEQ-LVTEHL
GCS21_ARTS2      QCLVDEFS---TILDNGGTIPTMPPWHVQENKWRAARYGLEAIIILDAEGNEQ-LVTDHL
GCS2_LEIXX       HCLTDQML---GELDDGVKPVTLQPWFVRENKWRAARYGLDAEVIVAPDGAER-LVRDEL
GCS2_MYCA1       HCLVVDLD---RRLEADESLPTMPPWHHQENKWRAARYGLDAVIILDADSNER-LVTEDL
GCS2_MYCPA       HCLVVDLD---RRLEADESLPTMPPWHHQENKWRAARYGLDAVIILDADSNER-LVTEDL
GCS2_MYCBO       HCLIVDLD---RRLDAGETLPTMPPWHVQENKWRAARYGLDAVIILDADSNER-LVTDDL
GCS2_MYCBP       HCLIVDLD---RRLDAGETLPTMPPWHVQENKWRAARYGLDAVIILDADSNER-LVTDDL
GCS2_MYCTU       HCLIVDLD---RRLDAGETLPTMPPWHVQENKWRAARYGLDAVIILDADSNER-LVTDDL
GCS2_MYCUA       HCLVVDLD---RRLDAGETLPTMPPWHVQENKWRAARYGLDAVIILDAESNER-LVTDDL
GCS21_MYCSK      HCLVVDLD---RRLDAGEQLPVMPPWHVQENKWRAARYGLDAEIILDADSNER-LVTEDL
GCS2_MYCSS       HCLVVDLD---RRLDAGEQLPVMPPWHVQENKWRAARYGLDAEIILDADSNER-LVTEDL
GCS21_MYCSJ      HCLVVDLD---RRLDAGEQLPVMPPWHVQENKWRAARYGLDAEIILDADSNER-LVTEDL
GCS21_MYCVP      HCLIVDLD---RRLDAGESLPVMPPWHVQENKWRAARYGLDAIIILDADSNER-LVTEDL
GCS22_NOCFA      HCLIVDLD---QRIEDGEQPITLPPWHVQENKWRAARYGLDAIVITDADSNER-LVTDDL
GCS22_RHOJR      HCLIVDLD---RRFEAGENLPNLQPWHVKENKWRAARYGLDAEIILDEDSNER-LVTDDL
GCS23_NOCSJ      HCLVVDLD---TRAAAGETLPTMPPWHVQENKWRAARYGLDAIVITDAESNER-LVTEDL
GCS21_COREF      HCLVVHYD---RMIDRGEQLPTLQPWHVAENKWRAARYGLDAEIIISRDTDEA-MVQDEL
GCS2_CORGL       HCLVVHYD---RMIDAGEELPSLQQWHVSENKWRAARYGLDAEIIISRDTDEA-MVQDEL
GCS2_CORDI       HCLIVDLE---RKLDRGEELPTLQDWHVAENKWRAARYGMDAEIIISRDTDEA-WVTDEL
GCS2_CORJK       HCLVVYFE---RRLDAGHELPTLQPWHVAENKWRAARYGLDALIITDRETNEA-LVTDEL
GCS21_FRAAA      QCLVDRMN---TQIDRGYRLPTPQRWLVQENKWRAARYGLDAQILIDDRGGVR-SVRDDL
GCS21_FRACC      QCLVDRMN---TQIDRGYRLPTPQRWLVQENKWRAARYGLDAQIIVDGRGGIR-PVRDDI
GCS2_THEFY       QSLVQLFE---QQLDRGYRLPSPSSWVVTDNKWRATRYGLDARIIIDERGSTV-PLRDDL
GCS21_RUBXD      QCIVAS-----SLEDEDAPKGPYHRDIALENKWRASRRGLDAAFFDVDERRNV-PARDLA
GCS23_RUBXD      QCLAAA-----AEEFE--PEDPLLTE---ENKWRATRHGLEAELYDFSGQRTV-AARRAA
GCS2_SOLUE       QAIIAKLY---RIHEQNLTFRHYSRSLIMENKWRAARYGLDGKMIDFGKQTEV-PARQLI
GCS23_PAEAT      RALVETASLEMLDGVEP---TAVPTALLRMASWQASNSGLRGDLLDF-GDFLPQPAADVV
GCS22_ARTS2      RALVESASREWRAGVDP---APVPTVLLRMAAWQASNCGLRGDLLDF-GTFRPAPAEEVV
GCS21_PAEAT      RALVETSASEWRKGEPP---SGVMTPVIRMANWKASRFGVTNQLLHP-LEQAPFAAADVA
GCS22_COREF      RALVETVAREWAAGMPA---PDVPASVLQLWSWRASRYGTEEELIDQ-ATGQPAPAAEVL
GCS22_NOCSJ      RALVETSAARWAAGEAP---PQVPAVLLRLATWHASRWGVSADLLDP-MTARPLPAAEVV
GCS21_STRAW      RGLVESAARDWRAGREP---EDHSVSLLRLAAWQAARAGLSGELLHP-VTMRRLRAESVV
GCS2_STRCO       RALVDTAAREWRAGAEP---AEHSVSLLRLAAWRAARSGLTSELLHP-ATMRRMPAESVV
GCS22_FRAAA      RALVATAARQWAAGEPV---PTVRPELLRAAGWRASRHGVSGELVDL-ERGELVPARALV
GCS21_NOCSJ      RALVETAAEEWADGRPA---AHWRAEALRAAHWRASRFGMADSLVHP-LARGLRPARSVV
GCS2_RHOBA       RAIVMLAISEEEQGKPI---VPIRPSVLSYAIWHAARYGMNEQLVDP-ESREMIPASELL
GCS22_STRAW      RALVATAINDAKAGVPV---PSCPPELLQGANWHAARHGLSGSLIDY-EGR-RRSAGDVL
GCS22_MYCSJ      RATVMTLLGDERDGAGV---PRISAHALDAAYWRSARDGLDGIAIDLAESHAPMPARDLL
GCS22_MYCSK      RATVMTLLGDERDGAGV---PRISAHALDAAYWRSARDGLDGIAIDLAESHAPMPARDLL
GCS22_MYCVP      RGCVMTALEDERHGDPV---LPLAPYALKAAYWKAARNGVDGDGVDL-ENHVPAPVSDLL
GCS21_NOCFA      RATVHTARRFLAEGNTA---PAVPAEVLRAAYWKAARSGIGGDAVAPLDGRV-LPARDLL
GCS24_RHOJR      HALVITAADAIERGTPA---PTVDHEALRGACWRAARDGLSGHGFDLTTMGL-IPAPRLI
GCS21_SACEN      RGLVGVALSD--RPGPV---RPVDDAVLRAACWCSAHHGLEGFSLDVGTGRL-VPSWHLV
GCS21_RHOJR      KGLVGWALQSLDDGLTV---PWLRAELLRAQLWRAARDGLDGECTSPAADRV-LPIRRQL
GCS22_SACEN      RALVRAALDDLAAGREG---DEVSDQVAAAAVWNASRYGLRGPAVDP-VPARRVPALEMV
GCS2_JANSC       QCLTRMLMRLRGSNQRW---RVYDRFLINENRWRAQRYGVSDGLIDF-GRGAVVPLPELV
GCS2_RUEPO       QALMRMLCRMKARNLRW---RHYDRFLVGENRWRAQRYGVGEGLIDF-GDRSLKPMTVLM
GCS2_PARDP       QATLRMLWRLSRQNLRW---RQYDNFLLGENRWRATRYGSTEGLIDF-GSRRILPFDEIA
GCS2_RHORT       RCLLRMLYRLRRANQRW---RHYARLLIAENRWRAQRYGLDGGLVDF-GRGEVVPFADLI
GCS2_BRADU       RCLTRHLYRRPHLSKTV---TVVERAIAVENKWRAQRYGTDCIFASK-DGP--ITISELL
GCS2_PSEAE       RALVGEALGADPRALPV---ARDA--CLEENYWQALRYGCAGRYLV---EGRCVGAGDWL
GCS2_PSEAB       RALVGEALGAGPRTLPV---ARDA--CLEENYWQALRYGCAGRYLV---GGRAVGAGDWL
GCS2_PSEE4       RHLVQHALA-RHDGMAV---SREIRWITQENYWRAARYGRRGTFIGA-VDQQPVSAEGWL
GCS2_PSEPK       RHLVEHSIAYRHDPLPC---SRELRWIAQENYWRAMRHGRHAQFIGC-HEQQPVTAQGWL
GCS2_PSEF5       AVMVRHACLLPAAGSQY---TQAQRWLLKENRVQARRRGAQGRYLMS-PDQAPMNLGQWL
GCS2_HALMA       HELVVDLAERYEDGE---SGRRLRREFLDENKWRAIRHGQSAELLSR-------------
GCS2_NATPD       QALVEDLSARYEDGE---SGANHRRELLDENKWRALRHGHDAELLDR-------------
GCS2_HALSA       HALVTEYAQRYDDHPDPFSVTGLRRELLDANKWRAMRDGHDASFVAR-------------
GCS2_HALWD       HALVMDFAARYADGE---SGTKVRREILDANKWHAMRYGRDAEFIIP-------------
GCS22_RUBXD      AATCDMLC---AEYESGELRPARPVREIEDNKWSAQRHGLDGLFVDHETHEPV-PARWAV
                                                   : . *                     

GCS2_ACIAC       LQTIDHIARHATVTGASGALHLLRSEAAAGQNDARWLRDRQRDEQL--------------
GCS2_ACISJ       LQTLDHVARYAGTHGASGALHMLRGETALGQNDARWLRERQREEQL--------------
GCS2_VEREI       LATMDEMASHAAAQGASSALHLLRTEVEAGQNDARWLRERQREEQL--------------
GCS2_POLNA       LMTMAQIERHAHRLDASASIHLLRTSVERNDNDARWLRERQGEERL--------------
GCS2_POLSJ       LMTMERIARHAGAVGAGASLHLLQTSVERSDNDARWLREKQGEERL--------------
GCS2_AZOSB       EASFTRIEQHAIELGAEAAIGRLRADVASGRNDAWWLRGQLGPQVT--------------
GCS2_BURCA       LDTLDRIAPHAAALGSRAALDEIGALAKARVNDASWLRTVFKQEKS--------------
GCS2_BURCH       LDTLDRIAPHAAALGSRAALDEIGALAKARVNDASWLRTVFKQEKS--------------
GCS2_BURCM       LDTLDRIAPHAAALGSRAALDEIGALAKARVNDASWLRTVFKQEKS--------------
GCS2_BURL3       LDTLDRIAPHAAALGSRAALDEIGALANARVNDASWLRTVFKQEKS--------------
GCS2_BURMA       LDTLDRIAPHAAALGSRAALDEIGALAKARVNDASWLRTIFKQEKS--------------
GCS2_BURP1       LDTLDRIAPHAAALGSRAALDEIGALAKARVNDASWLRTIFKQEKS--------------
GCS2_BURPS       LDTLDRIAPHAAALGSRAALDEIGALAKARVNDASWLRTIFKQEKS--------------
GCS2_BURTA       LDTLDRIAPHAAALGSRAALDEIGALAKARVNDASWLRTIFKQEKS--------------
GCS2_PARXL       LETLDRIAPHAEALGSGNALAEIGAIARSQVNDATWLRGVVEREKS--------------
GCS2_CUPNH       LSICDALVPHAEALGSLEALANIRALAERRDGDAEWLRQVDADARS--------------
GCS2_CUPPJ       LSICDALVPHAEALGSMQALANIRALAENRNGDAEWLRQVDADART--------------
GCS2_CUPMC       LSICDALEPHAEALGSLEALSNIRALAASRSNDAHWVRAANRDAHS--------------
GCS2_RALSO       LETSKLLAPHAEALASEGALDMVREVVERRDSDAEWIRATEGETRN--------------
GCS2_METPP       LRTLTRLDEHALDLEALDATQLLRDSLFEG-NDARWLRTQRAAMLP--------------
GCS2_NITMU       MEMLEHISDHARELHAVEAMERIREILIVG-NGTSWQRRAYASEHN--------------
GCS21_LEGPL      LTTLRRLKPYANQLNSTMALEHIYEITHKG-SDASFLREKYAEHRT--------------
GCS21_LEGPA      LTTLRRLKPYANQLNSTMALEHIYEITHKG-SDASFLREKYAEHRT--------------
GCS2_CHRVO       LDTLRALEPHAEALGSQHQLAALRQRALKCHSDSRWLRQIFEQSGS--------------
GCS22_LEGPL      LETIKKIEQYINELGNNEYIEELYSDVINKQNDSVLINKMYKQDGS--------------
GCS2_LEGPH       LETIKKIEQYINGLGNSEYIEELYSDVINKQNDSVLINKIYKQDGS--------------
GCS22_LEGPA      LETIKKIEQYINGLGNGEYIEELCSDVINKQNDSVLINKIYKQDGS--------------
GCS2_DECAR       ADLLEAVSEDARELDCADWLSPLKQAVAENTGDAAWLRARENQHGN--------------
GCS2_ECOLI       LRLLEKIAPSAHKIGASSAIEALHRQVVSGLNEAQLMRDFVADGGS--------------
GCS2_SHISS       LRLLEKIAPSAHKIGASSAIEALHRQVVSGLNEAQLMRDFVADGGS--------------
GCS2_SHIFL       LRLLEKIAPSAHKIGASSAIEALHRQVVSGLNEAQLMRDFVADGGS--------------
GCS2_SHIF8       LRLLEKIAPSAHKIGASSAIEALHRQVVSGLNEAQLMRDFVADGGS--------------
GCS2_ECO57       LRLLEKIAPSAHKIGASSAIEALHRQVVSGLNEAQLMRDFVADGGS--------------
GCS2_SHIBS       LRLLEKIAPSAHKIGASSAIEALHRQVVSGLNEAQLMRDFVADGGS--------------
GCS2_SHIDS       LRLLEKIAPSAHKIAASSAIEALHRQVVSGLNEAQLMRDFVADGGS--------------
GCS2_ECOUT       LRLLEKIAPSAHKIGASSAIEALHRQVVSGLNEAQLMRDFVADGGS--------------
GCS2_ECOK1       LRLLEKIAPSAHKIGASSAIEALHRQVVSGLNEAQLMRDFVADGGS--------------
GCS2_ECOL5       LRLLEKIAPSAHKIGASSAIEALHRQVVSGLNEAQLMRDFVADGGS--------------
GCS2_ECOL6       LRLLEKITPSAHKIGASSAIEALHRQVVSGLNEAQLMRDFVADGGS--------------
GCS2_SALTI       LRLLDNVTPSARKLGADSAIDALRLQVKKGGNEAQYMREFIADGGS--------------
GCS2_SALTY       LRLLDNVTPSARKLGADSAIDALRLQVKKGGNEAQYMREFIADGGS--------------
GCS2_SALCH       LRLLDNVTPSARKLGADSAIDALRLQVKKGGNEAQYMREFIADGGS--------------
GCS2_SALPA       LRLLDNVTLSARKLGADSAIDALRLQVKKGGNEAQYMREFIADGGS--------------
GCS2_BORBR       RALFDRLAPVAEELGTGDMLQTLRDEILRNGNDARWLRGQFLKVRE--------------
GCS2_BORPA       RALFDRLAPVAEELGTGDMLQTLRDEILRNGNDARWLRGQFLKVRE--------------
GCS2_BORPE       RALFERLAPVAEELGTGDMLQTLRDEILRNGNDARWLRGQFLKVRE--------------
GCS2_BORA1       KALFVRLMPVAEELGTTDILQSLRDEMQRGGNDARWLRAQFHRTRE--------------
GCS2_TRIV2       KDILNVLAETADTLGNSSYLFQLEKRLDQGASYIRQRR-VFESTGS--------------
GCS2_BDEBA       KDLLAAMKEDAAEMGYTEYLKQLVEEDLTH-PSYEIQRALFEKTGS--------------
GCS2_GLOVI       EQTVGEMQSLAAELGCSAYLAAIPAILASG-NGATRQRRIYSQSRS--------------
GCS22_PAEAT      AETVSRLEPVAAKLGCSEELADVLKIIQRGASYQRQRRVAAEHNGD--------------
GCS21_ARTS2      LETLNRLEPVAAKLGCSDELADVEKIISRGAGYQRQRRVAAEHGGD--------------
GCS2_LEIXX       AELTETLAPIAERLGCAEQLAQVHTILRTGASYQRQLAVAEANGGS--------------
GCS2_MYCA1       DDVLNRLEPVARKLQCADELAAVADIPRHGASYQRQRRVAEEHDGD--------------
GCS2_MYCPA       DDVLNRLEPVARKLQCADELAAVADIPRHGASYQRQRRVAEEHDGD--------------
GCS2_MYCBO       ADVLTRLEPVAKSLNCADELAAVSDIYRDGASYQRQLRVAQQHDGD--------------
GCS2_MYCBP       ADVLTRLEPVAKSLNCADELAAVSDIYRDGASYQRQLRVAQQHDGD--------------
GCS2_MYCTU       ADVLTRLEPVAKSLNCADELAAVSDIYRDGASYQRQLRVAQQHDGD--------------
GCS2_MYCUA       DDVLTRLEPVARSLSCADELAAVAEIPRVGASYQRQRRVAEEHDGD--------------
GCS21_MYCSK      DDLLTRLQPVARSLDCADELAGVAEIYRHGASYQRQRRVAEEHDGD--------------
GCS2_MYCSS       DDLLTRLQPVARSLDCADELAGVAEIYRHGASYQRQRRVAEEHDGD--------------
GCS21_MYCSJ      DDLLTRLQPVARSLDCADELAGVAEIYRHGASYQRQRRVAEEHDGD--------------
GCS21_MYCVP      DDLLERLQPVAKRLSCVEELSRVPDIYHNGASYQRQRRVAEEHDGD--------------
GCS22_NOCFA      MDLLNRLEPTAKRLGCADELAYVATIPERGASYQRQRKVAAASQGD--------------
GCS22_RHOJR      NDLLEKLAPTAVRLGCADELAAVAEIPRRGASYQRQRQVAEATGGD--------------
GCS23_NOCSJ      ADHLERLAPVADRLGCSEELAQVAQIPVRGASYQRQRAVAERTGGD--------------
GCS21_COREF      RRLVDRLTPLAAELGCLRELDLVLEIIERGGGYERQRRAYQRTGT---------------
GCS2_CORGL       RRLVAQLMPLANELGCARELELVLEILERGGGYERQRRVFKETGS---------------
GCS2_CORDI       RSLVERLSPLARELGCYDELQGVLTICQTGASYQRQRAIYKETGS---------------
GCS2_CORJK       DAWVDRLAPLSEELGCAAELQDVRKLIARGGDYALQRAAARKHGAAPEPGTRTRGDDGVE
GCS21_FRAAA      VDLVEDLLPVAHRLDCAQQLADVLVILETGASYTRQRAVARRADGD--------------
GCS21_FRACC      TDLVEDLLPVAHRLGCSSELSDTLTILRTGASYIRQRDAARRAGGD--------------
GCS2_THEFY       YELLHELRPIAERLGCAEDLDVVAEILHYGASYERQRAIIRQ-GGV--------------
GCS21_RUBXD      RAAVERLRPHAQQLGCEEELLGVLEIVEGGSGSRRQREIYEKSGDF--------------
GCS23_RUBXD      EELVGRLLPVARELGCEAELEGVLEISRSATGADRQRAVLAREGSL--------------
GCS2_SOLUE       EEILEFVSDVVPELGSREEIAYIRRIMEHGNGADRQLRVFHETGDL--------------
GCS23_PAEAT      WALVDYLSPVLDDQGELELVKAGISDVLDRGNGAHEQRETAVRYNKR-QHDGQTQPGSPP
GCS22_ARTS2      EALVDYVAPVLAEQDELELAWEGVRRILDRGTGSEQQR----------LAMQECLAGNPE
GCS21_PAEAT      GALLRHIRRALTESGDLALARTGVANILRRGTGERLQR----------------------
GCS22_COREF      AGFLSYLRPVLSEYGELEVVEATVADILREGTGARRQR----------------------
GCS22_NOCSJ      GRLVEHARPALRRSGDDGLVADGIARILEHGNGATWQR----------------------
GCS21_STRAW      RALLEHVGDALADAGDLDLAHEAVAELLERGNGARVQR----------------------
GCS2_STRCO       RDLLEHAGEALAAAGDLERVREGVEKLLRHGNGARVQR----------------------
GCS22_FRAAA      DRFVEWVGPELSATGDGDAVAALVDNLFARGTGADRQR----------------------
GCS21_NOCSJ      AALVEAVEPALAAAGDLELVDVQLERAVN-DNGATRQR----------------------
GCS2_RHOBA       NRLMTAIDPALKATGEARPVEAFANQLIKSGTGADRQRRG--------------------
GCS22_STRAW      SQLMDHIGPALDAADDSREVASLVHRLLREGTPADRQRRAL-------------------
GCS22_MYCSJ      GVLVDRITPALRAVGDHDLVRDGLARLDDEGNGAMRQR----------------------
GCS22_MYCSK      GVLVDRITPALRAVGDHDLVRDGLARLDDEGNGAMRQR----------------------
GCS22_MYCVP      GYLTERTRPALEAAGDHELVTAGLARVTDLGNGATRQR----------------------
GCS21_NOCFA      DELLETVDPALEELGDRGFVSDALTALLARGNGAQRQV----------------------
GCS24_RHOJR      YQLLTHVKPVLVELGECGQVTGSLAAVLEHGNGAIRQR----------------------
GCS21_SACEN      DDLVEHVRPVLERYGDLDAVRALLAKLRENGSAARRQR----------------------
GCS21_RHOJR      ELLNDCVAPGLGPS-DRAFLESGLDTVLREGTGAERQR----------------------
GCS22_SACEN      ERLLRRVGPALEQTGDSALVREALAHVTGVGTGSERQR----------------------
GCS2_JANSC       DELIELTEQDAEALG-CVDEVQRLRDLAVETSS-DRQRKIYKGT--------------RA
GCS2_RUEPO       DELMGMLSEDAEALG-TLPEIARLRQIAEHGNSATRQRRVHAEA--------------LA
GCS2_PARDP       ESWLAAIAEDADALD-SQPAVAGLRDMIARGSAAERQRALFASA--------------IT
GCS2_RHORT       EELLELIAPDAAVFG-CQAEVLHARTILHRGTSAHNQLRVFAEA--------------RA
GCS2_BRADU       SRLIDDIVEDADALN-CAAEVEHCRTIVERGSSAEFQLRAYRENG----NDIAAVSRWIA
GCS2_PSEAE       EMAWRQCRPQARQG--NEWAYQHACGLLEE-TSAARQLRRYRRL--------------RE
GCS2_PSEAB       EMAWRQCRPQARQG--NEWAYEHARGLLGE-TSASRQLRRYQTL--------------RA
GCS2_PSEE4       AQLQSWLPADSAEA---ERSFMQARRILREGTSADRQREAYALA--------------RE
GCS2_PSEPK       AQLQAQIPIDSADA---ERACQHALHVLRHGTHADQQLRCLAQA--------------RA
GCS2_PSEF5       -ELAEQVFGDTAQALGEEPLFERARQLLRGGCSAERQLSCHAAQ--------------PA
GCS2_HALMA       DLSTTRSVEELVEIESDRLGVDGLWELYHRESGAERQR----------------------
GCS2_NATPD       SLEESVPLGELVESECQRLGVSGIRDVYEAESGAEKQR----------------------
GCS2_HALSA       ETQGAVDLGTVVDRECDRLGVSGIRDVYDDVSGAQQQR----------------------
GCS2_HALWD       GSMETVTLSEFVDRETNRLGVDGLTTLLAREGGAKKQR----------------------
GCS22_RUBXD      ERLAELAASSSRRD------LSSLERLLEEPTESERQLLVWRETGS--------------
                                                                             

GCS2_ACIAC       --------LGEVSRQAALRFRGAPA-----------------------------------
GCS2_ACISJ       --------LAEVSRQAALRFRGHDI-----------------------------------
GCS2_VEREI       --------LAEVCRQAAQRFRGLAL-----------------------------------
GCS2_POLNA       --------LAEVIRQAADRFRGGVDHEPGGFS----------------------------
GCS2_POLSJ       --------LAEVIRQAAQRFRGGVTHTQLP------------------------------
GCS2_AZOSB       --------LPEVVMAQCRRWMNGEGM----------------------------------
GCS2_BURCA       --------LNETVRQQCLRWRE--------------------------------------
GCS2_BURCH       --------LNETVRQQCLRWRE--------------------------------------
GCS2_BURCM       --------LNETVRQQCLRWRE--------------------------------------
GCS2_BURL3       --------LNETVRQQCLRWRE--------------------------------------
GCS2_BURMA       --------LNETVRQQCLRWRE--------------------------------------
GCS2_BURP1       --------LNETVRQQCLRWRE--------------------------------------
GCS2_BURPS       --------LNETVRQQCLRWRE--------------------------------------
GCS2_BURTA       --------LNETVRQQCLRWRE--------------------------------------
GCS2_PARXL       --------LHEAVRQQCLEWRA--------------------------------------
GCS2_CUPNH       --------QRETVRKACDRWAA--------------------------------------
GCS2_CUPPJ       --------QRETVRQACERWAA--------------------------------------
GCS2_CUPMC       --------LRDMVRQTCEQWGGG-------------------------------------
GCS2_RALSO       --------LHETVRRGCGRWAQVASLPA--------------------------------
GCS2_METPP       --------LPAVVEAAARRWGE--------------------------------------
GCS2_NITMU       --------LADVMQLQAELWMGN-------------------------------------
GCS21_LEGPL      --------LESVVNESLKQFRSSK------------------------------------
GCS21_LEGPA      --------LESVVNESLKQFRSSK------------------------------------
GCS2_CHRVO       --------LSEVVRRQSEHWMYAEPGVGVN------------------------------
GCS22_LEGPL      --------FSKLVAAQCELWLSDSKDRKWMTQPS--------------------------
GCS2_LEGPH       --------FSKLVAAQCELWLSDSKDRKWMTQPS--------------------------
GCS22_LEGPA      --------FSKLVAAQCELWLSDSKDRKWMTQPS--------------------------
GCS2_DECAR       --------LNDVVREASKRLMGKNDQFQEKTK----------------------------
GCS2_ECOLI       --------LIGLVKKHCEIWAGD-------------------------------------
GCS2_SHISS       --------LIGLVKKHCEIWADD-------------------------------------
GCS2_SHIFL       --------LIGLVKKHCEIWAGD-------------------------------------
GCS2_SHIF8       --------LIGLVKKHCEIWAGD-------------------------------------
GCS2_ECO57       --------LIGLVKKHCEIWAGD-------------------------------------
GCS2_SHIBS       --------LIGLVKKHCEIWAGD-------------------------------------
GCS2_SHIDS       --------LIGLVKKHCEIWAGD-------------------------------------
GCS2_ECOUT       --------LIGLVKKHCEIWAGE-------------------------------------
GCS2_ECOK1       --------LIGLVKKHCEIWAGE-------------------------------------
GCS2_ECOL5       --------LIGLVKKHCEIWAGE-------------------------------------
GCS2_ECOL6       --------LIGLVKKHCEIWAGE-------------------------------------
GCS2_SALTI       --------LIGLVQKHCEIWAGQ-------------------------------------
GCS2_SALTY       --------LIGLVQKHCEIWAGQ-------------------------------------
GCS2_SALCH       --------LIGLVQKHCEIWAGQ-------------------------------------
GCS2_SALPA       --------LIGLVQKHCEIWAGQ-------------------------------------
GCS2_BORBR       --------LPLVVESMAQNWRGQ-GVQDTPPSAVRRRIRATSEPVGGVCALSTPQGDPLP
GCS2_BORPA       --------LPLVVESMAQNWRGQ-GVQDTPPSAVRRRIRATSEPVGGVCALSTPQGDPLP
GCS2_BORPE       --------LPLVVESMAQNWRGQ-GVQDTPPSAVRRRIRATSEPVGGVCALSTPQGDPLP
GCS2_BORA1       --------LSGTVEAMTQVFRGESAAQRRAPQAARRRIRASSEPLG-----------PMS
GCS2_TRIV2       --------VKAVVASLVSELEAELAIKSRQEAVAYGWL----------------------
GCS2_BDEBA       --------LEHVVDSLCDVFEKDLDVV---------------------------------
GCS2_GLOVI       --------LVAVVADLEAGLAT--------------------------------------
GCS22_PAEAT      --------LQAVVMDLVQQMRKGPDA----------------------------------
GCS21_ARTS2      --------LRAVVLDLVKQMRNGPTA----------------------------------
GCS2_LEIXX       --------LQEVVSSLTNELRNGLG-----------------------------------
GCS2_MYCA1       --------LRAVVDALVAELEI--------------------------------------
GCS2_MYCPA       --------LRAVVDALVAELEI--------------------------------------
GCS2_MYCBO       --------LRAVVDALVAELVI--------------------------------------
GCS2_MYCBP       --------LRAVVDALVAELVI--------------------------------------
GCS2_MYCTU       --------LRAVVDALVAELVI--------------------------------------
GCS2_MYCUA       --------LRAVVDALIAELDI--------------------------------------
GCS21_MYCSK      --------LLAVVDALVAELEL--------------------------------------
GCS2_MYCSS       --------LLAVVDALVAELEL--------------------------------------
GCS21_MYCSJ      --------LLAVVDALVAELEL--------------------------------------
GCS21_MYCVP      --------LRAVVDALVSELVL--------------------------------------
GCS22_NOCFA      --------LVAVVDALVHELDR--------------------------------------
GCS22_RHOJR      --------LVAVVDALVKELGT--------------------------------------
GCS23_NOCSJ      --------LVAVVDSVVRELRAGLG-----------------------------------
GCS21_COREF      --------WIAAVDLACDELNELRPLEAE-------------------------------
GCS2_CORGL       --------WKAAVDLACDELNDLKALD---------------------------------
GCS2_CORDI       --------WLPVVDAVLAEM----------------------------------------
GCS2_CORJK       GGFTQPEAWIAAVDLTVDSLRKSL------------------------------------
GCS21_FRAAA      --------LTRVVDTLLEEMNTGRPVVAG-------------------------------
GCS21_FRACC      --------LTRVVDTLLEEMNTGRPVVDG-------------------------------
GCS2_THEFY       --------LKDVVDALVKEFRAGAPAVGSSHGRTDPSRNGGPSHAGA-------------
GCS21_RUBXD      ---------LDVVAFLIEGTRPALAGEPS-------------------------------
GCS23_RUBXD      ---------KSVVDYLAEATA---------------------------------------
GCS2_SOLUE       ---------KKVVDYMIEETEYGLFAPAFTAAGEGQ------------------------
GCS23_PAEAT      TNEALAAVVGHAAKVTVRGAAADAHKDPAPMLTRVRRP----------------------
GCS22_ARTS2      AAAGLAAVVAHAVDVSMRRTEAVTAREKAPVLLRVRQS----------------------
GCS21_PAEAT      QAYGRRFRLSDVVSTAIASTHNYGERSDAGLLSR--------------------------
GCS22_COREF      AAYAARGRLVDVITTALDITHRR-------------------------------------
GCS22_NOCSJ      DVFAGSGRLDEVVSALALVTSGGA------------------------------------
GCS21_STRAW      ELLERTGSLRDTVTECVRQTQG--------------------------------------
GCS2_STRCO       ELLARTGSLREVVAACVRRTQAA-------------------------------------
GCS22_FRAAA      AAYARRGRIDDVVDLVIRETTTMASP----------------------------------
GCS21_NOCSJ      AAFERTGSVRGVVDDVIARTEASWQDHDSHAGRL--------------------------
GCS2_RHOBA       ------GELSSVVANVVAETVPSAILA---------------------------------
GCS22_STRAW      ----LRGGLRAVTDLIITESAVT-------------------------------------
GCS22_MYCSJ      AAWRRRGEIADVIDAVAEATLA--------------------------------------
GCS22_MYCSK      AAWRRRGEIADVIDAVAEATLA--------------------------------------
GCS22_MYCVP      RAWRRNHDVDDVLAEAAAATLEDG------------------------------------
GCS21_NOCFA      RAFGADHDVAAVIAELGAATLEGCAPEPANSGGGEHVPVEGRH-----------------
GCS24_RHOJR      RTLARHGRVADVIAECARRTFEGCLTEPDDALPL--------------------------
GCS21_SACEN      EVFRRHRDIGEVVEHVLVETVPDENAALPGRSISPSA-----------------------
GCS21_RHOJR      AEFTRVGTLAAVVDLLTREVVS--------------------------------------
GCS22_SACEN      -AAAAAGGPREVVAMLAAATAPGRADRLRT------------------------------
GCS2_JANSC       AGGSHQAAMRSVVEHLLEDFHVDL------------------------------------
GCS2_RUEPO       RG---EDAGRAVVRHLIEEFHADL------------------------------------
GCS2_PARDP       AGATPQEAFRSIVGWLIDEFRRDL------------------------------------
GCS2_RHORT       GGMTRDEALVAVVDHLIAQTVAPLGADAGAPGP---------------------------
GCS2_BRADU       ASTISGRALRSDAPRLRRHSARASFGNDNGIPEFAVSRAVSWRKA---------------
GCS2_PSEAE       AGQERHPALRRLVEELLEENLQPALAG---------------------------------
GCS2_PSEAB       AGQERHVALRRLVEELLEENLQPALAGPAGKRAHEGGRSFRPAAGAPMSIRGQE------
GCS2_PSEE4       NGLAGREALRAVARQVMAEHFPGAGLPQGEIE----------------------------
GCS2_PSEPK       DGLGKGQALRAVVAAGTCI-----------------------------------------
GCS2_PSEF5       E-SDREARCRAVVDLLLWESRDSEPESTNAPP----------------------------
GCS2_HALMA       -RLRSEEGVMALADSLRLS-----------------------------------------
GCS2_NATPD       -RLLESEGMDALCGSLSVEWDSS-------------------------------------
GCS2_HALSA       -RILDTHGEKRLYNHLSL------------------------------------------
GCS2_HALWD       -RLHASDNIDTLLESLCLDTDT--------------------------------------
GCS22_RUBXD      --------VKEVARDIARRTRAAIPAT---------------------------------
                                                                             

GCS2_ACIAC       -------
GCS2_ACISJ       -------
GCS2_VEREI       -------
GCS2_POLNA       -------
GCS2_POLSJ       -------
GCS2_AZOSB       -------
GCS2_BURCA       -------
GCS2_BURCH       -------
GCS2_BURCM       -------
GCS2_BURL3       -------
GCS2_BURMA       -------
GCS2_BURP1       -------
GCS2_BURPS       -------
GCS2_BURTA       -------
GCS2_PARXL       -------
GCS2_CUPNH       -------
GCS2_CUPPJ       -------
GCS2_CUPMC       -------
GCS2_RALSO       -------
GCS2_METPP       -------
GCS2_NITMU       -------
GCS21_LEGPL      -------
GCS21_LEGPA      -------
GCS2_CHRVO       -------
GCS22_LEGPL      -------
GCS2_LEGPH       -------
GCS22_LEGPA      -------
GCS2_DECAR       -------
GCS2_ECOLI       -------
GCS2_SHISS       -------
GCS2_SHIFL       -------
GCS2_SHIF8       -------
GCS2_ECO57       -------
GCS2_SHIBS       -------
GCS2_SHIDS       -------
GCS2_ECOUT       -------
GCS2_ECOK1       -------
GCS2_ECOL5       -------
GCS2_ECOL6       -------
GCS2_SALTI       -------
GCS2_SALTY       -------
GCS2_SALCH       -------
GCS2_SALPA       -------
GCS2_BORBR       GWAERLH
GCS2_BORPA       GWAERLH
GCS2_BORPE       GWAERLH
GCS2_BORA1       MWPERLH
GCS2_TRIV2       -------
GCS2_BDEBA       -------
GCS2_GLOVI       -------
GCS22_PAEAT      -------
GCS21_ARTS2      -------
GCS2_LEIXX       -------
GCS2_MYCA1       -------
GCS2_MYCPA       -------
GCS2_MYCBO       -------
GCS2_MYCBP       -------
GCS2_MYCTU       -------
GCS2_MYCUA       -------
GCS21_MYCSK      -------
GCS2_MYCSS       -------
GCS21_MYCSJ      -------
GCS21_MYCVP      -------
GCS22_NOCFA      -------
GCS22_RHOJR      -------
GCS23_NOCSJ      -------
GCS21_COREF      -------
GCS2_CORGL       -------
GCS2_CORDI       -------
GCS2_CORJK       -------
GCS21_FRAAA      -------
GCS21_FRACC      -------
GCS2_THEFY       -------
GCS21_RUBXD      -------
GCS23_RUBXD      -------
GCS2_SOLUE       -------
GCS23_PAEAT      -------
GCS22_ARTS2      -------
GCS21_PAEAT      -------
GCS22_COREF      -------
GCS22_NOCSJ      -------
GCS21_STRAW      -------
GCS2_STRCO       -------
GCS22_FRAAA      -------
GCS21_NOCSJ      -------
GCS2_RHOBA       -------
GCS22_STRAW      -------
GCS22_MYCSJ      -------
GCS22_MYCSK      -------
GCS22_MYCVP      -------
GCS21_NOCFA      -------
GCS24_RHOJR      -------
GCS21_SACEN      -------
GCS21_RHOJR      -------
GCS22_SACEN      -------
GCS2_JANSC       -------
GCS2_RUEPO       -------
GCS2_PARDP       -------
GCS2_RHORT       -------
GCS2_BRADU       -------
GCS2_PSEAE       -------
GCS2_PSEAB       -------
GCS2_PSEE4       -------
GCS2_PSEPK       -------
GCS2_PSEF5       -------
GCS2_HALMA       -------
GCS2_NATPD       -------
GCS2_HALSA       -------
GCS2_HALWD       -------
GCS22_RUBXD      -------