CLUSTAL format seed alignment for MF_01611

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

FBIC_MYCBO      -------MPQPVGRKSTALPSPVVP--------PQANASALRRVLRRARDGVTLNVDEAA
FBIC_MYCTU      -------MPQPVGRKSTALPSPVVP--------PQANASALRRVLRRARDGVTLNVDEAA
FBIC_MYCPA      -------MLLTPGEEPTALPDPVVPARASSRATPKATASALRRVLRRARDGVALNIDEAA
FBIC_MYCLE      MWGSYTKVSLIESQEPIALSRPVVP--------PKPNTSALRRVLRRARDGFALNIDEAV
FBIC_NOCFA      -----------MIEGVTELATPNVPP-------APPSPSAMRRALRRARDGVSLNLDEAV
FBIC_STRCO      -----------MTTSATSGTGPADP--------AGPTENSMRRALKRARDGVALDASEAA
FBIC_STRAW      -----------MTTSATSGTGP--------------TANSMRRALKRARDGVALDVTEAA
COFG_METKA      ------------------------------------------------------------
COFG_METMP      ------------------------------------------------------------
COFG_METM7      -----------------------------------------------------MITKSEA
COFG_METM5      -----------------------------------------------------MITKNEA
COFG_METVS      -----------------------------------------------------MLTREKA
COFG_METJA      -----------------------------------------------------MISREEA
COFG_META3      -----------------------------------------------------------M
COFG_METS3      ------------------------------------------------------------
COFG_METTH      ------------------------------------------------------------
COFG_HALSA      ------------------------------------------------------------
COFG_HALS3      ------------------------------------------------------------
COFG_HALMA      ------------------------------------------------------------
COFG_METAC      ------------------------------------------------------------
COFG_METMA      ------------------------------------------------------------
COFG_METBF      ------------------------------------------------------------
COFG_METBU      ------------------------------------------------------------
COFG_METTP      ------------------------------------------------------------
COFG_ARCFU      ------------------------------------------------------------
COFG_METMJ      ------------------------------------------------------------
COFG_METB6      ------------------------------------------------------------
COFG_NOSS1      ------------------------------------------------------------
COFG_TRIV2      ------------------------------------------------------------
COFG_TRIEI      ------------------------------------------------------------
COFG_SYNP6      ------------------------------------------------------------
COFG_SYNE7      ------------------------------------------------------------
COFG_THEEB      ------------------------------------------------------------
COFG_SYNY3      ------------------------------------------------------------
COFG_GLOVI      ------------------------------------------------------------
                                                                            

FBIC_MYCBO      IAMTARGDELADLCASAARVRDAGLVSAGRHGPSGRLAISYSRKVFIPVTRLCRDNCHYC
FBIC_MYCTU      IAMTARGDELADLCASAARVRDAGLVSAGRHGPSGRLAISYSRKVFIPVTRLCRDNCHYC
FBIC_MYCPA      VAMTARGDDLADLCASAARVRDAGLQSAGRRGPGGGLPITYSRKVFIPVTHLCRDNCHYC
FBIC_MYCLE      VAMTARGEDLADLCASAARVRDVGLETAGRRGADGRLPITYSRKVFIPVTHLCRDSCHYC
FBIC_NOCFA      VLLHARGDDLADLCRSAARVRDAGLESAGRPG-----TITYSRNVFIPLTRLCRDRCHYC
FBIC_STRCO      VLLQARGAHLDALTASAARVRDAGLEAAGRPG-----VITYSKSVFVPLTRLCRDKCHYC
FBIC_STRAW      VLLQARGEDLDDLTASAARVRDAGLEAAGRAG-----VITYSKSVFIPLTRLCRDKCHYC
COFG_METKA      -------------------------------------MVSYSKNVFVPLTRLCRNRCAYC
COFG_METMP      ---------------MGKINAE-----------NTSKHVTFSKNAFIPVCNWCRNVCGYC
COFG_METM7      LDFLKSDSINSILKKLTKINAQ-----------TSSKHITFSKNAFIPVCNWCRNVCGYC
COFG_METM5      LDFLKLNSINSILEKLEGINTQ-----------NSSKTITFSKNAFIPVCNWCRNVCGYC
COFG_METVS      IEFLNSNDTGPILEMLNLINGT-----------NNGKNITYSKNAFIPVCNWCRNICGYC
COFG_METJA      INFLNSTSSKDILDKLAQINNT-----------FKREYITYSKNVFIPLSKWCRNKCGYC
COFG_META3      VEFLNSKNPQDIIDKLSLINNNGNKNIGNGNKTNNKKYITYSKNVFIPICNWCKNICGYC
COFG_METS3      ------------MNKASKYREN--------------NLITYSKNIFIPLTEICKNDCGYC
COFG_METTH      --------------------------------------MTYSRNIFIPLTRACRNRCGYC
COFG_HALSA      MTETQFGGDEYDVSVSVSEAAVERALDVRPADVAPASSLTFARNVFVPLTTACRYTCTYC
COFG_HALS3      MTETQFGGDEYDVSVSVSEAAVERALDVRPADVAPASSLTFARNVFVPLTTACRYTCTYC
COFG_HALMA      ---MIPGTDAYDIAIEISDADIERLLSVMPEDVEAASALSYCRNVFLPLTTACRYTCTYC
COFG_METAC      --------------------------------------------MFIPVTNICRNRCGYC
COFG_METMA      --------------------------------------MTYSKNVFIPVTNICRNQCGYC
COFG_METBF      --------------------------------------MTYSKNVFVPVTNICRNRCGYC
COFG_METBU      ----------------------------------MPEFVTFSRNVFIPVTNICRNLCGYC
COFG_METTP      ----------------------MCAGIQAEARGAEALRATFSRNVFIPVTDLCRNACGYC
COFG_ARCFU      -----------------------------------MKIVTYSKNVFIPLTRNCRNRCDYC
COFG_METMJ      ---------------------------------MHRRVITFSKNAFLPLTTVCQNRCGYC
COFG_METB6      ---------------------------------MEPRVITYTKNVFLPLTSVCRNRCGYC
COFG_NOSS1      --------------MTVAKSTCASVSTKPAVGKPTNGIATYSPAYTIVPTYECFNRCTYC
COFG_TRIV2      --------------MTVAESTCALVSTQPSIGKPTGGIATYSPAYTIVPTYECFNRCTYC
COFG_TRIEI      ----------------------------------MSRIVTYSPAYTIVPTYECFNNCSYC
COFG_SYNP6      ---------------------MKHFSDQTWRSPQQSAVITYSPAYTLVPTYECFNRCTYC
COFG_SYNE7      ---------------------MKHFSDQTWRSPQQSAVITYSPAYTLVPTYECFNRCTYC
COFG_THEEB      ---------------------------------MGDRTITYSPAFTLVPTYECFNRCTYC
COFG_SYNY3      -----------------------------------MLSITYSPAYTLVPTYECFNRCSYC
COFG_GLOVI      ---------------------------------MRERTVTYSPAFTLVPTRECFNRCGYC
                                                              :     *   * **

FBIC_MYCBO      TFVTVPGKLRAQGSSTYMEPDEILDVARRGAEFGCKEALFTLGDRPEARWRQAREWLGER
FBIC_MYCTU      TFVTVPGKLRAQGSSTYMEPDEILDVARRGAEFGCKEALFTLGDRPEARWRQAREWLGER
FBIC_MYCPA      TFVTVPGKLRARGAGLYLEPDEILDIARRGGELGCKEALFTLGDRPEDRWPEAREWLEAR
FBIC_MYCLE      TFVTAPDMLRTQGAGMYLEPNEILNLARRGSELGCKEALFTLGDRPEDRWAQARDWLAER
FBIC_NOCFA      TFVTVPGKLRAEGKGMFLEPDEVLDIARRGAALGCKEALFTLGDRPEDRWPEAAQWLDER
FBIC_STRCO      TFVTVPGKLRRAGHGMFMSPDEVLDIARKGAALGCKEALITLGDKPEDRWPEAREWLDAH
FBIC_STRAW      TFVTVPGKLRRAGHGMFMSPDEVLDIARKGAALGCKEALITLGDKPEDRWPEAREWLDAH
COFG_METKA      TFRREPEEVRSP----YLSPEEVFEIVEKGKEAGCKEVLFTFGERPEERYDEALEWLEEH
COFG_METMP      TFRNE--------NFKLLKMDEMKEILTKADTFGCREALFTFGENVDE-NEKVKEELKKM
COFG_METM7      TFRNE--------NFKLLKMNEMNEILTKADTFGCREALFTFGENVDE-NEKVKEELKKM
COFG_METM5      TFRNE--------NFKLLKMDEMKEILTKANAFGCREALFTFGENVDE-NEKVKEELKKM
COFG_METVS      TFRAE--------NFKIMTKNEVKEILLKADSLGCREALFTFGENVDE-NELVREKLIKM
COFG_METJA      IFRED--------KPSLMKPNEVKEILLKGDRLGCREALFTFGEHVDE-NKEIKEQLKSM
COFG_META3      TFRRE--------NYKLMNKQEIKEILLTGNKHGCREALFTFGETVDE-NPKIKEDLKKM
COFG_METS3      NFKKTPD---DPSAIILKTKEEVLASLKEAERYGCSEALFTFGEDADE-EESVQQKLAEF
COFG_METTH      TFRSDTP------EPPLLEPEDVMGEVRRALSLGCTEALFTFGEDAHE-FPGVRDKLESL
COFG_HALSA      TYYDVPGE------ASLLTPEEIREQCRVGADAGCTEALFTFGDQPDDRYTAIHEQLGEW
COFG_HALS3      TYYDVPGE------ASLLTPEEIREQCRVGADAGCTEALFTFGDQPDDRYTAIHEQLGEW
COFG_HALMA      TYYDPPGQ------AELMDREEIRETCRRGADAGCTEALFTFGDDPDDRYTAVHDQLAEW
COFG_METAC      GFRREPGQP----GARLMKPAEVISILKNGVRAGCTEVLFTFGEYAEEM-PGYNLMLDEI
COFG_METMA      GFRREPGQP----GARLMKPEEVISVLENGVRAGCTEALFTFGERAEEV-PGYGEMLEEI
COFG_METBF      GFRREPGQP----GARLMKPEEILPVLENGAKAGCTEALFTFGEYAEEV-SEYRKWLKKL
COFG_METBU      TFRRDAGHP----EAHLMSMSEIRPILERGEKAGCTEALFVFGEYAEEV-PEYLLELEKL
COFG_METTP      SFRRDPDR------ARVISRSEAQRLMERAQSAGCSEALFSMGDRPWEV-RGDRLEL---
COFG_ARCFU      GFRSE--------EIGVMSAEEVRKIL--SAARGAKEALFTFGERPDEVYPEFKAMLLEM
COFG_METMJ      CFRTPVRE------GCVMAPTEAIRTLEASAALGCTEALFTFGERPGAV-PGFNEMLGRL
COFG_METB6      SFRTPVQE------GCVMLPEEVEAVLAQGQAAGCTEALFTFGEHPEEE-EGFRAYLEKT
COFG_NOSS1      NFRTDPGE------SSWMTLSAAEDIFQRLQNEQVCEILILSGEVHPH----------SP
COFG_TRIV2      NFRTDPGE------SSWMSLSAAEDIFKRLQNEQVCEILILSGEVHPN----------SP
COFG_TRIEI      NFRSDPGK------SSWLSLSEAEKQLLSLKNKGTIEILTLSGEVHPN----------SK
COFG_SYNP6      NFRRDPGM------DEWLSLSTAQQRLLTVRDRGVCEVLILSGEVHPQ----------SP
COFG_SYNE7      NFRRDPGM------DEWLSLSTAQQRLLTVRDRGVCEVLILSGEVHPQ----------SP
COFG_THEEB      NFRQDIGT------RGWLTLKAAAKQLAELDPQRVREILILSGEVAPN----------SP
COFG_SYNY3      NFRQEPRK------DQWLTESVAKQRLESLAGRGIREILILAGEVHPQ----------SS
COFG_GLOVI      NFRADRG-------AAWLQPAEVRALLLPLVGSGVVEILVLSGEVHPH----------DP
                 :                                  * *   *:                

FBIC_MYCBO      GYDSTLSYVRAMAIRVLEQTGLLPHLNPGVMSWSEMSRLKPVAPSMGMMLETTSRRLFET
FBIC_MYCTU      GYDSTLSYVRAMAIRVLEQTGLLPHLNPGVMSWSEMSRLKPVAPSMGMMLETTSRRLFET
FBIC_MYCPA      GYDSTLSYVRAMAIRVLEETGLLPHLNPGVMSWSEMARLKPVAPSMGMMLETTSRRLFET
FBIC_MYCLE      GYDSTLSYLRAMAIRVLEETGLLPHLNPGVMSWSELSRLKPVAPSMGMMLETTSRRLFET
FBIC_NOCFA      GYDSTLDYLRAVSILVLEETGLLPHLNPGVMSWAEIARLKPVAQSMGMMLETTATRLFTE
FBIC_STRCO      GYDDTIAYVRAVSIRILEETGLLPHLNPGVMTWTDFQRLKPVAPSMGMMLETTATRLWSE
FBIC_STRAW      GYDDTIAYVRAISIRILEETGLLPHLNPGVMSWTDFQRLKPVAPSMGMMLETTATRLWSE
COFG_METKA      GYSSTVEYLVDLCRRCVEEYDMLPHSNPGVITKREMRKLRRWNASMGLMMEILSERLCEE
COFG_METMP      GYSGILEYLYEISAWCLENTNLIPHTNCGILSYDELKYLREVNASMGLMLENSSARLC--
COFG_METM7      GYSGILEYLYEISAWCLDNTDLLPHTNCGILSYDELKYLREVNASMGLMLENSSARLC--
COFG_METM5      GYYGILEYLYEISAWCLENTNLLPHTNCGILSYDELEYLREVNASMGLMLENSSARLC--
COFG_METVS      GYKNILEYLYDLCDWCLSNTNILPHTNCGILNYDELKYLRKVNVSMGLMLENSSERLC--
COFG_METJA      GYDNILEYLYDLEEWTLNNTSLLPHTNCGILNYDELKMLKDVNASMGLMLENASERLM--
COFG_META3      GYNNILEYLYDISDWCLTNTDLLPHTNCGILSYEELKTLKEVNASMGLMLENSSDRLY--
COFG_METS3      GYENIVDYVFDICKMTLEETSLLPHTNGGNFSYESLKKLKEVNASMGMMLESTSVRLM--
COFG_METTH      GFGDMTDYTYHLCELTL-DAGLLPHTNMGVIGYRELRMLKEVNASMGLMLESASPRLM--
COFG_HALSA      GYDSIHEYLRAACEIAL-EAGLLPHANPGDQTRAQMATVADVNASMGVMLETTA------
COFG_HALS3      GYDSIHEYLRAACEIAL-EAGLLPHANPGDQTRAQMATVADVNASMGVMLETTA------
COFG_HALMA      GHDSIHEYLREACEIAL-EEGLLPHANPGDQTREQMAHVADLNASMGVMLETTT------
COFG_METAC      GYSSTLDYLLFLCETAI-ETGILPHTNAGVMTRSELEALKPLNASMGLMLESTA------
COFG_METMA      GYSSTLEYLVFLCETAI-DIGILPHTNAGIMTRSELEALKPLNASMGLMLESTA------
COFG_METBF      GYSSTLEYLLFLCEASI-DIGILPHTNAGIMTRTELKALKPLNASMGLMLESTA------
COFG_METBU      GYSTTVEYVADLCKLAI-EIGLLPHTNAGILNRKELEILKPLNISMGLMLETTA------
COFG_METTP      -----LEYLVELCELAL-EMGLLPHTNAGILTREELELLAPYNASMGLMLESTA------
COFG_ARCFU      GYKSMVDYILEMNKIAV-EMGFLPHTNAGILSKEEMRKLKPYNASMGLMLEQAV------
COFG_METMJ      GYADILDYVYHLSLAAI-ERDLLPHTNAGILTYAELDRLREVNASMGLMLETTA------
COFG_METB6      GYDTILDYCEAMCRLAL-RYGILPHTNAGILTYDEMKRLRPTNASMGLMLETTA------
COFG_NOSS1      KRQAWFQRIYDLCKLAL-TSGFLPHTNAGPLSFAEMQELKSVNVSMGLMLEQLTPK---L
COFG_TRIV2      KRQVWFQRIYDLCKLAL-TLGFLPHTNAGPLSFAEMQELKSVNVSMGLMLEQLTPK---L
COFG_TRIEI      YRKAWFQLIYKLCQLAL-SLGFLPHTNVGILTRSEMEELKQVNVSMGLMLEQITPK---L
COFG_SYNP6      RRAAWRQRLIELAELAL-DMGFLPHTNAGPLNRAEMIALQNVNVSLGLMLEQLTPQ---L
COFG_SYNE7      RRAAWRQRLIELAELAL-DMGFLPHTNAGPLNRAEMIALQNVNVSLGLMLEQLTPQ---L
COFG_THEEB      QRSKWLERLYDLAALAL-DQGFLPHTNAGPLTRAEMTALKAVNVSMGLMLEQLTPK---L
COFG_SYNY3      RRKAWFELIYNLGKIAL-DLGFYPHTNAGPLSRSEIARLKEVNFSLGLMLEQVSPR---L
COFG_GLOVI      RRGEWFAMIEDICAVAL-ELGFLPHTNCGVLSFEEMRALQQLNVSLGLMLEIDSNR---L
                                :   .: ** * *     .:  :     *:*:*:*         

FBIC_MYCBO      KGLAHYGSPDKDPAVRLRVLTDAGRLSIPFTTGLLVGIGETLSERADTLHAIRKSHKEFG
FBIC_MYCTU      KGLAHYGSPDKDPAVRLRVLTDAGRLSIPFTTGLLVGIGETLSERADTLHAIRKSHKEFG
FBIC_MYCPA      KGLAHYGSPDKDPAVRLRTLTDAGRLSIPFTTGLLVGIGETPAERADTLHAIRKSHKEFG
FBIC_MYCLE      KGLAHYGSLDKDPTVRLRVLTDAGRLSIPFTTGLLVGIGETLAERADTLHEIRKSNKEFG
FBIC_NOCFA      KGQCHHGSPDKDPAVRLRAITDAGRLSVPYTTGILVGIGETLTERAESIMAIRKQHKAFG
FBIC_STRCO      PGGPHHGSPDKEPAVRLRVLEDAGRSSVPFTSGILIGIGETYEERAESLFALRRVSRSYH
FBIC_STRAW      PGGPHHGSPDKEPAVRLRVLEDAGRSSVPFTSGILIGIGETYEERAESLFALRKISRAYH
COFG_METKA      SG-PHEHSPGKRPEERLKVLKYAGELKVPFTTGILIGIGETWEERVKTLEEIQRMHERYG
COFG_METMP      GTIAHEKSPGKDPKLRIEMIENAGKLKIPFTTGILIGIGETFEERVNSIFEIKRIHEKYG
COFG_METM7      GTIAHEKSPGKDPKLRIEMIENAGKLKIPFTTGILIGIGETLEERIDSIFEIKRIHENYG
COFG_METM5      STIAHEKSPGKDPNLRIEMIENAGKLKIPFTTGILIGIGETLEERIDSIFEIKRIHEKYG
COFG_METVS      KTVAHEKSPGKNPKLRIEMIENAGKLKIPFTTGILIGIGETFEERINSIFEIKRMHEKYG
COFG_METJA      NTIAHKHSPGKHPKLRIEMIENAGKLKIPFTTGLLIGIGETNEEIVDSLFKIKEIHEKYG
COFG_META3      NTIAHKDSPGKEPKKRLKMIEDAGKLKIPFTTGILVGIGETNEEIVQSLVDINNIHKKYG
COFG_METS3      NTVAHNKSPGKNPEIRLKTISNAGKLKIPYTTGILIGIGETKEEIADSLLAIRDLYDKYG
COFG_METTH      ETEAHRESPGKNPRLRIKMIEDAGRLRIPFTTGLLIGIGETIEERAESLLELRRIQDRYG
COFG_HALSA      DVQAHGGPRAKSPEQRLHTIDVAGDLGVPFTTGILVGIGEDWRDRAESLLAIRALHERHD
COFG_HALS3      DVQAHGGPRAKSPEQRLHTIDVAGDLGVPFTTGILVGIGEDWRDRAESLLAIRALHERHD
COFG_HALMA      EVQAHGGPRAKNPGQRLNTLRVAGELGVPFTTGILVGIGEDWHHRAESLLAIREMHERYG
COFG_METAC      SLEAHKDCPGKIPERRLETIREAGKLQIPYTSGLLIGIGESREDRIESLEAITSLHREYG
COFG_METMA      VLAAHKDCPGKIPERRLETIREAGKLKIPYTTGLLIGIGESRDDRIESLEAIAALHREYG
COFG_METBF      TLDAHKDCPGKLPELRLNTIREAGKLQIPYTTGLLIGIGEIREDRIESLEAIAGLHREYG
COFG_METBU      ELKAHSESPGKKPSTRIEMIRTAGKLKIPFTTGILVGIGETKDDRKRSLNTIADIHKEFG
COFG_METTP      HLKIHERSPGKRPEVRIRTISDAGALRIPFTTGILVGIGESSEDRIRSLEVIAELHRRYG
COFG_ARCFU      ELECHANSPGKKPEVRIKMIRDAGKLQIPFTTGILVGIGEGREDRLYSLEIIAEIQDNYG
COFG_METMJ      DVPAHRNSPGKDPAVRIEMIENAGKLSIPFTTGILLGIGETEDDREESLRVIADLHRRYG
COFG_METB6      RIPAHQGSKGKEPEVRLAMMEDAGRLKIPFTTGLLLGIGETAAGREDSLIAIRDIHKKYG
COFG_NOSS1      LETVHRHAPSKLPELRLQQLEWAGDLQIPFTTGLLLGIGEGIDDCWETLETISKLHQRYH
COFG_TRIV2      LETVHRHAPSKLPELRLQQLEWAGELQIPFTTGLLLGIGETNDDCWETLEAISKLHQRYH
COFG_TRIEI      LKIVHKNSPSKIPHLRLQQLEWAGELRIPFTTGLLLGIGETVTDWKDTLEAISNIHQKWG
COFG_SYNP6      QRTVHRAAPSKDPQLRLQQLEQAGELGIPFTTGLLLGIGETSRDRLETLEAIAACHDRWG
COFG_SYNE7      QRTVHRAAPSKDPQLRLQQLEQAGELGIPFTTGLLLGIGETSRDRLETLEAIAACHDRWG
COFG_THEEB      LQGVHRHAPSKDPQLRLHQLEQAGELGIPFTTGLLLGIGEAPQDWAETLTAIAEGHRRWG
COFG_SYNY3      LTTVHRQAPSKEPQLRLEQLRLAGELGIPFTTGLLLGIGETDQEVEESLMAIANVQQEYG
COFG_GLOVI      LGGVHRHAPSKIPALRTAQLEWAGALGIPFTTGLLLGIGETPAEREDTLRTIARLQDRHG
                    *     * *  *   :  **   :*:*:*:*:****       ::  :        

FBIC_MYCBO      HIQEVIVQNFRAKEHTAMAAFPDAGIEDYLATVAVAR-LVLGPGMRIQAPPNLVSGDE-C
FBIC_MYCTU      HIQEVIVQNFRAKEHTAMAAFPDAGIEDYLATVAVAR-LVLGPGMRIQAPPNLVSGDE-C
FBIC_MYCPA      HVQEVIVQNFRAKEHTAMAAVPDAGIEDYLATVAVAR-LVLGPGMRIQAPPNLVSRDE-C
FBIC_MYCLE      HVQEVIVQNFRAKEHTAMAAVPDARIEDYLATVAVAR-LVLGPAMRIQAPPNLVSREE-C
FBIC_NOCFA      HIQEVIVQNFRAKDDTAMRDAPDAGFDEFRATIAVTR-LLLGPDVPVQAPPNLVSQQE-C
FBIC_STRCO      GIQELIIQNFRAKPDTAMRGMPDAELDELVAAVAVAR-HIMGPSACLQAPPNLVD-AE-Y
FBIC_STRAW      GIQELIIQNFRAKPDTAMRGMPDAELDELIATVAVAR-HIMGPRACLQAPPNLVD-SE-Y
COFG_METKA      HVQEVIVQNFRTKPGIPMEDHPEPTPADLLRTVATAR-LIL-PDVPVQVPPNLNRETG-Q
COFG_METMP      HIQEVIVQNFRSKPQIPMENYKEPSPVEMFKMIILSKLILED--ISIQVPPNLNRETG-Q
COFG_METM7      HIQEVIVQNFRVKPGIPMENYKEPSPVEMFKMIILSKLILED--ISIQVPPNLNRETG-Q
COFG_METM5      HIQEVIVQNFRSKPLIPMENYKEPSPIEMFKMIILSKLILEG--ISIQVPPNLNRETG-Q
COFG_METVS      HIQEVIIQNFRVKKGIPMENFIEPSPIEMFKMVMISKLILED--ISIQVPPNLNRETG-Q
COFG_METJA      HIQEVIIQNFRAKKGIPMENFKEPSPIKMLKVIILAKLILDD--ISIQIPPNLNRETG-Q
COFG_META3      HIQEVIIQNFRAKESIPMSNYEEPTPLKMLKVLIVAKLILKD--ISIQVPPNLNSETG-Q
COFG_METS3      HIQEVIIQNFTTSPGIEMENWEEPTFLDMVRTVIAGKLLFRDTDVSIQVPPNLNHDTA-Q
COFG_METTH      HIQEIIIQNFRSKPGIPMENQREPSLLEMVKMVAAAKIMFPD--VSIQVPPNLNRETG-E
COFG_HALSA      HVQEVIVQPVRPNARWQGE---PPGAETMRRVVAMARAVLPA-EVGVQVPPNLTDV----
COFG_HALS3      HVQEVIVQPVRPNARWQGE---PPGAETMRRVVAMARAVLPA-EVGVQVPPNLTDV----
COFG_HALMA      HIQEVIIQPVVENERWQGG---SPDLATMRRVTAMARAALPE-EVSVQVPPNLAPA----
COFG_METAC      HIQEVIIQNFAPKPGTPMESFPEPTVEEMMDAVVLARHVLPS-DVSVQVAPNLIDP----
COFG_METMA      HIQEVIIQNFAPKPGTEMENFPEPAVEEMMDSVELAARILPG-DVAVQVAPNLIDP----
COFG_METBF      HIQEVIIQNFAPKPGTPMENFPAPSIEEIIDTICLARQILPS-DIAVQVAPNLIDP----
COFG_METBU      HIQEVIIQNFMPKPDTPMADHAPPSKEEMIDTVAIAREILPS-DVAVQVAPNLIDP----
COFG_METTP      HIQEVIIQPLDPKPGTESEGMHPPAMTDMVKLVSIARRILPL-EISIQVPPNLMDP----
COFG_ARCFU      HIQEVIVQNFKPKKGTPMENTPPPTLEEMLEAVKAAREILPQ-EVAIQIPPNLVDDI---
COFG_METMJ      HIQEVIVQNFCPKPGTAMEGAAVPGPDEIGAAISLAREILPA-DVAVQIPPNLADA----
COFG_METB6      HIQEIILQNFCPKNNTPMAAFRVPDTQEICNTILMARRILPE-EISIQVAPNLIDA----
COFG_NOSS1      HIQEVILQPHSPG-NQQTFDAPAFNPHQLPEVIAKARQILPP-DITIQIPPNLVQDEQWL
COFG_TRIV2      HIQEVILQPHSPG-NQQTFNAPAFNPHQLPEVIAKARQILPS-DITIQIPPNLVKDERWL
COFG_TRIEI      HIQEVIIQPYSPG-SENKWVSDGFNVNLLPEVIAIANEVLPS-NITLQIPPNLVKKPEIL
COFG_SYNP6      HIQEVILQPHSPG-RQQAIQHPPLAPDELIDCVAIARQVLPT-SIAIQVPPNLLTQPQQL
COFG_SYNE7      HIQEVILQPHSPG-RQQAIQHPPLAPDELIDCVAIARQVLPT-SIAIQVPPNLLTQPQQL
COFG_THEEB      HIQEVILQPHSPG-QQQAERLPPFDLKQLPQVVQWARSLLPE-DITIQIPANLVTEPEVF
COFG_SYNY3      HIQEVILQPHSPG-QKQTDNISAYSPQKLVQVITLARAILPA-EITLQIPPNLVPNFSDL
COFG_GLOVI      HIQEVILQPHSPG-GSQSWAGEPLGDAQLLGVVRLARQILPA-EITIQIPPNLVGDP---
                 :**:*:*                               .      :* ..**       

FBIC_MYCBO      RALVGAGVDDWGGVSPLTPDHVNPERPWPALDELAAVTAEAGYDMVQRLTAQPKYVQAGA
FBIC_MYCTU      RALVGAGVDDWGGVSPLTPDHVNPERPWPALDELAAVTAEAGYDMVQRLTAQPKYVQAGA
FBIC_MYCPA      RALIAAGVDDWGGVSPLTPDHVNPERPWPALDELAAVTAESGYELVQRLTAQPKYVQAGA
FBIC_MYCLE      LALVTAGVDDWGGVSPLTPDHVNPERPWPALHELAAVTAEAGYTLVQRLTAQPKYVQAGA
FBIC_NOCFA      LALIEAGIDDWGGVSPVTPDHVNPERPWPNLDTLRELTEASGFTLVERTSAHPKYVRAGN
FBIC_STRCO      ERLIGAGIDDWGGVSPLTIDHVNPERPWPQIDELAATSRAAGFELRERLCVYPEFVRRGE
FBIC_STRAW      GRLIGAGIDDWGGVSPLTIDHVNPERPWPQIDLLREQSAQAGFELRERLCVYPEFVQRGE
COFG_METKA      LALL-AGANDWGGVSPVTKDYVNPEAPWPEIEELKRLTEDVGFRLRERLPIYPEYVRRG-
COFG_METMP      LFLM-AGIDDWGGVSPLTKDFVNPEAPWPDIEELNIFSKELGFTLKERLPVYEKYITEE-
COFG_METM7      LFLM-AGIDDWGGVSPLTKDFVNPEAPWPDIDELNIFSKELGFNLKERLPVYEKYITKE-
COFG_METM5      LFLM-AGIDDWGGVSPLTKDFVNPEAPWPDIEELNSFSKELGFELKERLPVYEKYISKE-
COFG_METVS      LFLM-GGIDDFGGVSPLTKDYVNPEAPWPDILELERFSNELGFKLKERLPIYEKYINEN-
COFG_METJA      LFLL-AGVDDWGGVSPLTRDYVNPEAEWPEIKELREWTEELGLKLKMRLPVYDKYISEE-
COFG_META3      LFLF-AGVDDWGGVSPITKDFVNPEAPWPKIEELKKYTEEFGYSLKERLPVYEKYINEN-
COFG_METS3      IFLL-CGADDWGGVSPVSPDYVNPTSPWPTLDELNRLTQDAGFELIERMCVYEKYVNDK-
COFG_METTH      IFLL-AGADDWGGVSPISRDYVNPEAPWPEIDELKRITESAGFALEERLPVYRKFISRE-
COFG_HALSA      RGLVDCGVDDLGGVSPVTKDHINPDYAWPALDELSAIADHAGVPLRERLPVYERFLPADG
COFG_HALS3      RGLVDCGVDDLGGVSPVTKDHINPDYAWPALDELSAIADHAGVPLRERLPVYERFLPADG
COFG_HALMA      RDLTDCGIDDLGGVSPVTVDHINPEYEWPALQELTAVAEAAEVPLSERLPVYDHFV----
COFG_METAC      KALIGKGVTDLGGISPLTIDWINPEAEWPDVRDLQKKL--GDIPLRERLPVYPQYVK---
COFG_METMA      KSLIAKGVTDLGGISPLTIDWINPEAEWPDVKNLQKKL--GDIPLKERLPVYPPYVK---
COFG_METBF      KALIAKGVTDLGGISPLTIDWINPEAEWPDIKELQRKL--SPILLKERLPIYPQYVR---
COFG_METBU      YSLIKAGASDLGGISPTTIDWINPEAEWPDVIELQKMI--KEIELRERLPIYPQHIK---
COFG_METTP      VPLLRAGADDLGGISPVTPDWINPERRWPEIDELR------GVVLVERLPVYPRYVK---
COFG_ARCFU      YPFLKAGANDVGGISNVTHDYINPESPWPEVERLERALR-GEFILKERLPIYPRFVK---
COFG_METMJ      SRLIGCGVNDLGGVSPLTIDYVNPEHPWPQLDELRRIA--GDAELRERLCIYPQYIE---
COFG_METB6      SRLIGCGVSDLGGISPVTIDYVNPEHPWPAFNDLKKIV--GDATLQERLCIYPRFIR---
COFG_NOSS1      VACVEAGARDLGGIGPK--DEVNPDYPHLQAEELREILQPVGWELVPRLPVYPQFDG---
COFG_TRIV2      LACVEAGARDLGGIGPK--DEVNPDYPHLQAEELREILQPAGWDLMPRLPVYPQFDG---
COFG_TRIEI      LACLENGARDLGGIGPF--DEINPDYPHPHYQALIKVLESRGWQLTKRLPVYSKYDD---
COFG_SYNP6      ADCLGAGARDLGGIVPY--DEVNPDYQHHDLDELREALAQQGWQLQPRLPVYPHLVD---
COFG_SYNE7      ADCLGAGARDLGGIVPY--DEVNPDYQHHDLDELREALAQQGWQLQPRLPVYPHLVD---
COFG_THEEB      RACLEAGARDLGGIVPL--DHVNPDYPHTDLAVLKEQLQAWGWELVPRLPVYPQFVD---
COFG_SYNY3      LACLAAGVRDLGGIVPI--DEVNPDYHHQSVNQLSQLLEENGYLLQPRFPVYPTYFS---
COFG_GLOVI      VPLLEAGARDLGGIGPV--DVVNPDYAHPVVERLGERLAAAGWRLEPRLPVYPHLDK---
                      *  * **:     * :**         *          :  *            

FBIC_MYCBO      -----AWIDPRVRGHVVALADPATGLAR-DVNPVGMPWQEPDD-VASWGRVDLGAAIDTQ
FBIC_MYCTU      -----AWIDPRVRGHVVALADPATGLAR-DVNPVGMPWQEPDD-VASWGRVDLGAAIDTQ
FBIC_MYCPA      -----AWIDPRVSGHVRALADPVTGLAR-DVNPVGLPWQEPDD-VGSSGRVDLNAAIDTQ
FBIC_MYCLE      -----AWIDPRVRGHVVALADPVTGLAR-DVNPVGMPWQEPDD-VESAGRMDINTAIDTE
FBIC_NOCFA      -----PWIDPRIGAHVAALTDPVTGLAKADALPVGLPWQEPDESWESAGRTDLNIAIDTE
FBIC_STRCO      -----PWLDPRLRPHVAALADPETGLAREDAVVEGHAWQEPDEAFTATGRTDLHATIDTE
FBIC_STRAW      -----PWLDPRLLPHVRALADPASGLAHADATVEGHPWQEPEEAFVAQGRTDLHHSIDTE
COFG_METKA      ------WYHANISEVVERLSDDE-GFAR--------------------------------
COFG_METMP      ------WVDKKILEKIKK------------------------------------------
COFG_METM7      ------WLDKKILEKIEK------------------------------------------
COFG_METM5      ------WLDKKVLEKIKK------------------------------------------
COFG_METVS      ------WIDSEILKKLI-------------------------------------------
COFG_METJA      ------WLSEKVYNKIIEMGWLKE------------------------------------
COFG_META3      ------WLSCKVLEKIK-------------------------------------------
COFG_METS3      ------WLNETLLEKIANLS----------------------------------------
COFG_METTH      ------FLSPRVMERIEELYPRFIETL---------------------------------
COFG_HALSA      GTADDGWVSQRIWRAIED----GDRYEAVRAE----------------------------
COFG_HALS3      GTADDGWVSQRIWRAIED----GDRYEAVRAE----------------------------
COFG_HALMA      ---DDGWLSAPIEAAIEADNDAGDRFRSILDRGVNPVTL---------------------
COFG_METAC      ----RGWYSERIGSLIERLSDNEGYRKQPAIENAEDLEK---------------------
COFG_METMA      ----KGWYSERIGSLIKRLSDNSGYRKQPGTENAEDSEK---------------------
COFG_METBF      ----KKWYSDRIGGLIEQLSDTDGYRKKP-------------------------------
COFG_METBU      ----KGWYSNNLSYLIETLTDKNGFKRKQR------------------------------
COFG_METTP      ----LGWYGSRTKDLIKRLADERGLRRT--------------------------------
COFG_ARCFU      ----LKWYGEALEPLIEKYSDADGYARP--------------------------------
COFG_METMJ      ----KGRYSPLLEPLIRRLAERIAAPGRDAGA----------------------------
COFG_METB6      ----PGWYDPGLQPLINRLNQRISRGSSQP------------------------------
COFG_NOSS1      ------WLSKELQASVRRWRELVIYF----------------------------------
COFG_TRIV2      ------WLSGELQASVRRWRELVIGNW---------------------------------
COFG_TRIEI      ------WLPINLKNIVSEWRIKLSIY----------------------------------
COFG_SYNP6      ------RLPQRLQTHVAAWLNRFNSQSRSS------------------------------
COFG_SYNE7      ------RLPQRLQTHVAAWLNRFNSQSRSS------------------------------
COFG_THEEB      ------WLPPPLKEKVKEIPV---------------------------------------
COFG_SYNY3      ------WLNCDLQQRLSVFIN---------------------------------------
COFG_GLOVI      ------RVATALQPLLGEHRARLCQAAVT-------------------------------
                               :                                            

FBIC_MYCBO      GRNTAVRSDLA>
FBIC_MYCTU      GRNTAVRSDLA>
FBIC_MYCPA      GRNSETCSDID>
FBIC_MYCLE      GRNTEARSDLD>
FBIC_NOCFA      GRNTEARSDAA>
FBIC_STRCO      GRTSDRRDDFD>
FBIC_STRAW      GRTGDRRDDFD>
COFG_METKA      ------------
COFG_METMP      ------------
COFG_METM7      ------------
COFG_METM5      ------------
COFG_METVS      ------------
COFG_METJA      ------------
COFG_META3      ------------
COFG_METS3      ------------
COFG_METTH      ------------
COFG_HALSA      ------------
COFG_HALS3      ------------
COFG_HALMA      ------------
COFG_METAC      ------------
COFG_METMA      ------------
COFG_METBF      ------------
COFG_METBU      ------------
COFG_METTP      ------------
COFG_ARCFU      ------------
COFG_METMJ      ------------
COFG_METB6      ------------
COFG_NOSS1      ------------
COFG_TRIV2      ------------
COFG_TRIEI      ------------
COFG_SYNP6      ------------
COFG_SYNE7      ------------
COFG_THEEB      ------------
COFG_SYNY3      ------------
COFG_GLOVI      ------------