CLUSTAL format seed alignment for MF_01614

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

NAMA_BACAN      -MNSELFSPYTIKDVTLKNRIVMSPMCMYSSENEDGQVTNFHLIHYGTRAAGQVGLVMIE
NAMA_BACHK      -MNSELFSPYTIKDVTLKNRIVMSPMCMYSSENEDGQVTNFHLIHYGTRAAGQVGLVMIE
NAMA_BACCZ      -MNSELFSPYTIKDVTLKNRIVMSPMCMYSSENEDGQVTNFHLVHYGTRAAGQVGLVMIE
NAMA_BACC1      -MNYKLFSPYTIKDVTLKNRIVMSPMCMYSSENGDGQVTNFHLIHYGTRAAGQVGLVMIE
NAMA_BACCR      -MNSKLFSPYTIKNVTLKNRIVMSPMCMYSSGNEDGRVTNFHLIHYGTRAAGQVGLVMVE
NAMA_ALKHC      -MEHKLFSSYVVKGVTLKNRIVMSPMCMYSSDQKDGKIRPFHISHYESRAAGQVGLIIVE
NAMA_BACSU      -MARKLFTPITIKDMTLKNRIVMSPMCMYSSHEKDGKLTPFHMAHYISRAIGQVGLIIVE
NAMA_BACLD      MSNRKLFTPWSLKGVTLKNRIVMSPMCMYSSHEKDGKVQPFHMTHYISRAVGQVGLIMVE
NAMA_LISMF      --MSKLFSEYKLKDVTLKNRIVMSPMCMYSVENKDGIATDFHFAHYVSRAAGGTGLVILE
NAMA_LISMO      --MSKLFSEYKLKDVTLKNRIVMSPMCMYSVENKDGIATDFHFAHYVSRAAGGTGLVILE
NAMA_LISIN      --MSKLFSEYKLKDVTLKNRIVMSPMCMYSVENKDGIATDFHFAHYVSRAAGGTGLVILE
NAMA_GEOKA      -MNTMLFSPYTIRGLTLKNRIVMSPMCMYSCDTKDGAVRTWHKIHYPARAVGQVGLIIVE
NAMA_CLOAB      ---MKIFEAYTIKNMCLKNRIVMPPMCMYSSDN-TGNINDFHLVHYTTRSIGGVGFIIVE
                     :*    ::.: *******.******     *    :*  ** :*: * .*::::*

NAMA_BACAN      ATAVLPEGRISNKDLGIWDDSLIEGLHKTTTFIHDNGAKAAIQLAHAGRKAE-LETDALA
NAMA_BACHK      ATAVLPEGRISNKDLGIWDDSLIEGLHKTTTFIHDNGAKAAIQLAHAGRKAE-LETDALA
NAMA_BACCZ      ATAVLPEGRISNKDLGIWDDSLIEGLHKTTTFIHDNGAKAAIQLAHAGRKAE-LETDALA
NAMA_BACC1      ATAVLPEGRISNKDLGIWDDSLIEGLHKTTTFIHDNGAKAAIQLAHAGRKAE-LETDALA
NAMA_BACCR      ATAVLAEGRISNNDLGIWDDNLIEGLHKTTTFIHDNGAKAAIQLAHAGRKAE-LDTNAFA
NAMA_ALKHC      ATAVTPQGRISPYDLGIWSDDHISGLTETVERIHAHGAKAAIQLAHAGRKAE-LDGPIIA
NAMA_BACSU      ASAVNPQGRITDQDLGIWSDEHIEGFAKLTEQVKEQGSKIGIQLAHAGRKAE-LEGDIFA
NAMA_BACLD      ATAVTPQGRISDQDLGIWDDAHIDGLAALTSQIKTYGSKTAIQLAHAGRKAE-VEGTIYG
NAMA_LISMF      ATAVQEVGRISEFDLGLWNDEQVPALKKLVDGLHYHGAKAGIQLAHAGRKAV-LPGEIVA
NAMA_LISMO      ATAVQEVGRISEFDLGLWNDEQVPALKKLVGGLHYHGAKAGIQLAHAGRKAV-LPGEIVA
NAMA_LISIN      ATAVQEVGRISEFDLGLWNDEQVPALKRLVDGLHYHGAKAGIQLAHAGRKAV-LPGEIVA
NAMA_GEOKA      ATGVTPQGRISERDLGIWSDDHIAGLRELVGLVKEHGAAIGIQLAHAGRKSQ-VPGEIIA
NAMA_CLOAB      ATGITPNGRISDKDLGIWSEKHAEGLSFLVKEVKKYGSKIAIQLNHSGRKYEGTSGEPVA
                *:.:   ***:  ***:*.:    .:   .  ::  *:  .*** *:***         .

NAMA_BACAN      PSAVPFNETMKIPVEMSIHQIKNTILAFQQAAIRSKQAGFDVIEIHGAHGYLINEFLSPL
NAMA_BACHK      PSAIPFNETMKIPVEMSIQQIKNTILAFQQAAVRSKQAGFDVIEIHGAHGYLINEFLSPL
NAMA_BACCZ      PSAIPFNETMKTPVEMSKHQIKDTILAFQQAAIRSKQAGFDVIEIHGAHGYLINEFLSPL
NAMA_BACC1      PSAIPFNETMKMPIEMSKHQIKDTVLAFQQAAVRSKQAGFDVIEIHGAHGYLINEFLSPL
NAMA_BACCR      PSAIPFNDKMKIPVEMNIQQIKETILAFQRAALRSKQAGFDVIELHGAHGYLINEFLSPL
NAMA_ALKHC      PSAISY-DKMKTPDAMTEEQISETIEAFKLGALRAKKAGFDIIEIHGAHGYLINEFLSPL
NAMA_BACSU      PSAIAFDEQSATPVEMSAEKVKETVQEFKQAAARAKEAGFDVIEIHAAHGYLIHEFLSPL
NAMA_BACLD      PSAIPFDENSRTPVEMTKEDIKETVQAFKKGAERAKAAGFDIIEIHGAHGYLINEFLSPL
NAMA_LISMF      PSAIAFDEKSDKPVELTKEAIKEVVADFKRAAYRAKEAGFDVIEIHAAHGYLIHQFLSPI
NAMA_LISMO      PSAIAFDEKSDKPVELTKEAIKEVVADFKRAAYRAKEAGFDVIEIHAAHGYLIHQFLSPI
NAMA_LISIN      PSAIPFDEKSAKPVELTKEAIKEVVADFKRAAYRAKEAGFDVIEIHAAHGYLIHQFLSPI
NAMA_GEOKA      PSAVPFDDSSPTPKEMTKADIEETVQAFQNGARRAKEAGFDVIEIHAAHGYLINEFLSPL
NAMA_CLOAB      PSALAFDENSKTPKELTKNEIKEIILAFKAAAKRAEKAGFDAIEIHGAHGYLINQFLSPL
                ***:.: :    *  :.   :.: :  *: .* *:: **** **:*.******::****:

NAMA_BACAN      SNKRTDEYGGSPENRYRFLREIIDSINEVW--NGPLFVRISANDYHPD-GLTVQDYVQYT
NAMA_BACHK      SNKRTDEYGGSPEKRYRFLREIIDSINEVW--NGPLFVRISANDYHPD-GLTVQDYIQYT
NAMA_BACCZ      SNKRTDEYGGSPENRYRFLREIIDSINEVW--NGPLFVRISANDYHPD-GLTVQDYVQYT
NAMA_BACC1      TNKRTDEYGGSPENRYRFLREIIDSINEVW--NGPLFVRISANDYHPD-GLTVQDYVQYT
NAMA_BACCR      TNKRTDKYGGSPENRYRFLREIIDSVNEVW--DGPIFVRISANDYHPD-GLTVQDYVQYT
NAMA_ALKHC      TNKRTDAYGGSLENRYRLLREIISEIQTVW--DGPLFVRISAAEYAEG-GNELSDFITLA
NAMA_BACSU      SNHRTDEYGGSPENRYRFLREIIDEVKQVW--DGPLFVRVSASDYTDK-GLDIADHIGFA
NAMA_BACLD      SNKREDEYGGSPENRYRLLREVIDAVKEVW--AGPLFVRVSASDYKTK-GLDVADYVGFA
NAMA_LISMF      TNRREDNYGGPAGNRYKILSDIIKAVKEVW--DGPIIVRVSATDYAHG-GLQLEDHIPFA
NAMA_LISMO      TNRREDNYGGPAGNRYKILSDIIKAVKEVW--DGPIIVRVSATDYAHG-GLQLEDHIPFA
NAMA_LISIN      SNRREDNYGGPAGNRYKILSDIIKAVKEVW--DGPIIVRVSATDYAHG-GLQLEDHIPFA
NAMA_GEOKA      SNRRQDEYGGSPENRYRFLGEVIDAVREVW--DGPLFVRISASDYHPD-GLTAKDYVPYA
NAMA_CLOAB      SNFRDDEYGGSTENRTRFLKEVLEAVREVWPKEKPILLRVSAEDYRGGSGITPNEMVNII
                :* * * ***.  :* ::* :::. :. **    *:::*:** :*    *    : :   

NAMA_BACAN      KWMKEQGVDLIDCSSGAVVPARIDVYPGYQVQYAKHIKEHANIATGAVGLITTGAQAEQI
NAMA_BACHK      KWMKEQGVDLIDCSSGAVVPARIDVYPGYQVQYAKHIKEHANIATGAVGLITTGAQAEQI
NAMA_BACCZ      KWMKEQGVDLIDCSSGAVVPARIDVYPGYQVQYAKHIKEHANIATGAVGLITTGAQAEQI
NAMA_BACC1      KWMKEQGVDLIDCSSGAVVPARIDVYPGYQVQYAKHIKEHANIATGAVGLITTGAQAEQI
NAMA_BACCR      KWMKEQGIDLIDCSSGAVVPAHIDVYPGYQVQYAKHIKEHTNIATGAVGLITTGSQAEQI
NAMA_ALKHC      KWMKKQGIDLIDCSSGAVVPAPIPVYPGYQVPLAEAIRHEANIATGAVGLITSGIQAEEI
NAMA_BACSU      KWMKEQGVDLIDCSSGALVHADINVFPGYQVSFAEKIREQADMATGAVGMITDGSMAEEI
NAMA_BACLD      KWMKEQGVDLIDVSSGAVVPADINVFPGYQVGFADTIRAQAEIQTGAVGLITSGLQAEEI
NAMA_LISMF      KWMKADGVELIDVSTGGLVNVAPPVFPGYQVPFADEIRRGAGIATGALGLITRGEQAEEI
NAMA_LISMO      KWMKADGVELIDVSTGGLVNVAPPVFPGYQVPFADEIRRGAGIATGALGLITRGEQAEEI
NAMA_LISIN      KWMKADGVELIDVSTGGLVNVEPPVFPGYQVPFADEIRRGAGIATGALGLITRGEQAEEI
NAMA_GEOKA      KRMKEQGVDLVDVSSGAIVPARMNVYPGYQVPFAELIRREADIPTGAVGLITSGWQAEEI
NAMA_CLOAB      NIVKDL-IDVVDVSSGGVAPAHINLYPGYQVKLSEVIKNECNVPTIAVGLICDINMVEEI
                : :*   ::::* *:*.:. .   ::*****  :. *:    : * *:*:*     .*:*

NAMA_BACAN      LNNNEADLIFIGRELLRNPYFPRIAANELGFELEEPHQYERAPGKISTNK
NAMA_BACHK      LTNNEADLIFIGRELLRNPYFPRIAANELGFELEEPYQYERAPGKISTNK
NAMA_BACCZ      LNNNEADLIFIGRELLRNPYFPRIAANELGFELEEPHQYERAPGKISTNK
NAMA_BACC1      LNNNEADLIFIGRELLRNPYFPRIAANELGFELEEPYQYERAPGKISTNK
NAMA_BACCR      LNNNEADLIFIGRELLRNPYFPRIAANELGFELQEPHQYKRAPGKIHTNK
NAMA_ALKHC      LQNERADLIFVARELLRNPYWPREAALELGTTISGPSQYDRAWL------
NAMA_BACSU      LQNGRADLIFIGRELLRDPFFARTAAKQLNTEIPAPVQYERGW-------
NAMA_BACLD      LQNGRADLIFVARELLRDPYWPKTAAKQLNTKIEGPVQYDRAW-------
NAMA_LISMF      LCNERADLIIVGRELLRNPYFAKDAAKQLGETIEGPKQYSRAWK------
NAMA_LISMO      LCNERADLIIVGRELLRNPYFAKDAAKQLGETIEAPKQYSRAWK------
NAMA_LISIN      LCNERADLIIIGRELLRNPYFAKEAAETLGETIEAPKQYSRAWK------
NAMA_GEOKA      LQNGRADLVFLGRELLRNPYWPYAAARELGAKISAPVQYERGWRF-----
NAMA_CLOAB      LSNNRADLVALGRELLRNPYFVLSSARLKNINIDFPKPYERAFN------
                * * .***: :.*****:*::   :*   .  :  *  *.*.