CLUSTAL format seed alignment for MF_01615

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

PDXT_PYRIL      --------------------------MKAGVLALQGDVEEHIQAFKKAAQELGISIEVIQ
PDXT_PYRAE      --------------------------MKIGVLALQGDVEEHANAFKEAGREVGVDVDVVE
PDXT_PYRCJ      --------------------------MKIGILALQGDVEEHRYALEKAAAELGLSVKVVE
PDXT_HYPBU      -------------------------MVVVGVLALQGDWIEHIELLREIE-----GVEAVP
PDXT_STAMF      --------------------------MRIGVLGFQGGVYEHVYMLKKSFHELGINGKVLI
PDXT_AERPE      --------------------------MRIGVLGYQGGVYEHVYMLRRTFDRLGVHGEAVV
PDXT_SACS2      --------------------------MKIGIIAYQGSFEEHFLQLKRAFDKLSLNGEIIS
PDXT_SULTO      --------------------------MKIGIVAYQGSFEEHALQTKRALDNLKIQGDIVA
PDXT_METAC      --------------------------MKIGVIAIQGAVSEHVDALRRALAERGVEAEVVE
PDXT_METMA      --------------------------MKIGVIAIQGAVSEHVDALRRALKERGVEAEVVE
PDXT_METAR      --------------------------MRIGVIAIQGNVEEHVEAMKRALGGKG---EVVT
PDXT_ARCFU      --------------------------MKVAVVGVQGDVEEHVLATKRALKRLGIDGEVVA
PDXT_PYRAB      --------------------------MKVGVIGLQGDVSEHIDATNLALKKLGVSGEAIW
PDXT_THEKO      -------------------------MVKVGVIGLQGDVEEHIWAARRALENLGVSGDVIW
PDXT_PYRFU      -------------------------MVKIGVIGLQGDVSEHIEATKRALERLGIEGSVIW
PDXT_PYRHO      --------------------------MKVGVVGLQGDVSEHIEATKMAIEKLELPGEVIW
PDXT_METKA      --------------------------MKVAVVAVQGAVEEHESILEAAGERIGEDVEVVW
PDXT_HALMA      ------------------------MTLRAGVLAVQGDVSEHGDAIERAAAAHDRTAEVVE
PDXT_HALSA      ------------------------MTLTAGVVAVQGDVSEHAAAIRRAADAHGQPADVRE
PDXT_METTP      -------------------------MRRIGVIALQGDVSEHISAIEAAG------GQAVP
PDXT_METMJ      ------------------------MGVKVGVLALQGDVAEHIAAFREALAER-PGSSVAP
PDXT_CENSY      -----------------------MSGPSIGVLSLQGDVRENIGMIHTAISRAGVGGSVEQ
PDXT_ACIC1      -----------MTIPSN--------RPRVGVLALQGDVREHLAALGDAGA------DAVP
PDXT_NOCSJ      -----------MTTA-----------PTIGVFALQGDVREHLGMLTGLGV------EAIA
PDXT_MYCBP      -----------MSVPR------------VGVLALQGDTREHLAALRECGA------EPMT
PDXT_MYCBO      -----------MSVPR------------VGVLALQGDTREHLAALRECGA------EPMT
PDXT_MYCTU      -----------MSVPR------------VGVLALQGDTREHLAALRECGA------EPMT
PDXT_MYCA1      -----------MSAPR------------IGVLALQGDTREHLAALREAGA------ESMP
PDXT_MYCLE      -----------MSFPR------------VGVLALQGDTREHLTALREAGA------DSMP
PDXT_MYCUA      -----------MSIPR------------VGVLALQGDTREHLAALGEAGA------EPMT
PDXT_MYCSK      -----------MNAVPDGRSDK--PRSVVGVLALQGDTREHLAALTEAGA------EAVT
PDXT_MYCSS      -----------MNAVPDGRSDK--PRSVVGVLALQGDTREHLAALTEAGA------EAVT
PDXT_MYCSJ      -----------MNAVPDGRSDK--PRSVVGVLALQGDTREHLAALTEAGA------EAVT
PDXT_MYCVP      -----------MSAPQ------------VGVLALQGDTREHLAALREAGA------EART
PDXT_FRAAA      -----------MSGPR------------IGILALQGDVREHARGLTDVGA------QPVE
PDXT_NOCFA      MSAPAAEPQAAPSRPT------------IGVLALQGDVREHLAALRACGA------EPVL
PDXT_SACEN      ------MGGVSTARPV------------IGVLALQGGVAEHLTALERSGA------EARP
PDXT_STRAW      -----------MNTPV------------IGVLALQGDVREHLIALAAADA------VARE
PDXT_STRCO      ----------MSDTPV------------IGVLALQGDVREHLVALAVADA------VARP
PDXT_PAEAT      -----------MTNPLSDASSRVGSGLRIGVLALQGDFREHIHAVEAAGA------TGVG
PDXT_ARTS2      -----------MTNPPSTDYSRAGAGLRIGVLALQGDFREHLRAAEATGA------TGIG
PDXT_LEIXX      -----------MAGSP-----------RVGVLALQGDVREHLTVLWALGA------DAVR
PDXT_CORGB      --------------------------MIVGVLALQGGVEEHLTALEALGA------TTRK
PDXT_CORGL      --------------------------MIVGVLALQGGVEEHLTALEALGA------TTRK
PDXT_CORDI      --------------------------MVIGVLTLQGGFAEHIAILESLGV------EHRR
PDXT_CUTAK      ------------------------MAPLVGVVALQGGFAEHIEVLESLGA------NTRR
PDXT_TROW8      --------------------------MTVGVLSLQGSFYEHLSILSRLNT------DHIQ
PDXT_TROWT      --------------------------MTVGVLSLQGSFYEHLFILSRLNT------DHIQ
PDXT_THET2      ------------------------MRGVVGVLALQGDFREHKEALKRLGI------EAKE
PDXT_THET8      ------------------------MRGVVGVLALQGDFREHKEALKRLGI------EAKE
PDXT_DEIRA      --------------------------MTVGVLALQGAFREHRQRLEQLGA------GVRE
PDXT_ACTP2      --------------------MNDYTKYTIGVLSLQGAVSEHIAQIETLGA------KAIA
PDXT_HAEDU      --------------------MADYSRYTVGVLALQGAVTEHISQIESLGA------KAIA
PDXT_PASMU      --------------------MKDYSHLHIGVLALQGAVSEHLRQIEQLGA------NASA
PDXT_BACAH      -------------------------MVKIGVLGLQGAVREHVKSVEASGA------EAVV
PDXT_BACHK      -------------------------MVKIGVLGLQGAVREHVKSVEASGA------EAVV
PDXT_BACAN      -------------------------MVKIGVLGLQGAVREHVKSVEASGA------EAVV
PDXT_BACCZ      -------------------------MVKIGVLGLQGAVREHVKSVEASGA------EAVV
PDXT_BACC1      -------------------------MVKIGVLGLQGAVREHVKSVEASGA------EAVV
PDXT_BACCR      -------------------------MVKIGVLGLQGAVREHVKSVEASGA------EAVV
PDXT_GEOSE      --------------------------MKIGVLGLQGAVREHVRAIEACGA------EAVI
PDXT_GEOKA      --------------------------MKIGVLGLQGAVREHVRAIEACGA------EAVI
PDXT_BACSU      -------------------------MLTIGVLGLQGAVREHIHAIEACGA------AGLV
PDXT_BACLD      -------------------------MLTIGVLGLQGAVREHIRSIEACGA------AGKV
PDXT_BACCI      --------------------------MKVGVLALQGAVAEHIRLIEAVGG------EGVV
PDXT_BACHD      -------------------------MVKIGVLALQGAVREHVRCLEAPGV------EVSI
PDXT_STAAC      --------------------------MKIGVLALQGAVREHIRHIELSGH------EGIA
PDXT_STAAM      --------------------------MKIGVLALQGAVREHIRHIELSGH------EGIA
PDXT_STAAN      --------------------------MKIGVLALQGAVREHIRHIELSGH------EGIA
PDXT_STAAR      --------------------------MKIGVLALQGAVREHIRHIELSGH------EGIA
PDXT_STAAS      --------------------------MKIGVLALQGAVREHIRHIELSGH------EGIA
PDXT_STAAW      --------------------------MKIGVLALQGAVREHIRHIELSGH------EGIA
PDXT_STAES      --------------------------MKIGVLALQGAVREHIRHIELSGY------EGIA
PDXT_STAEQ      -------------------------MIKIGVLALQGAVREHIRHIELSGY------EGIA
PDXT_OENOB      ------------------------MTVKIGVLALQGAVSEHIKALKDSGA------ETIA
PDXT_BACSK      --------------------------MKIGVLALQGAVSEHIRLLTNSGA------EAIE
PDXT_LISMF      -------------------------MKKIGVLAIQGAVDEHIQMIESAGA------LAFK
PDXT_LISMO      -------------------------MKKIGVLAIQGAVDEHIQMIESAGA------LAFK
PDXT_LISIN      -------------------------MKKIGVLALQGAVDEHIQMIESAGA------LAFK
PDXT_LISW6      -------------------------MKKIGVLALQGAVDEHIQMIKSAGA------LPSK
PDXT_OCEIH      ----------------------MCNSFRIGVLGLQGAISEHVNRLKELEQ------QPVV
PDXT_CLOAB      --------------------------MRVGVLSFQGGVVEHLEHIEKLNG------KPVK
PDXT_CALS4      --------------------------MRVGVLGVQGSVKEHMDKLKLIKGI-----EAVE
PDXT_SYNAS      -----------------MIYREDSRRNTIGVLDLQGGVCEHLEHLERLGI------ACKR
PDXT_BIFAA      ---------------------------MTGILAVQGAFAEHAAMLDHLGA------PWKL
PDXT_BIFLO      ---------------------------MTGILAVQGAFAEHAAVLDKLGA------PWKL
PDXT_STRP2      --------------------------MKIGILALQGAFAEHAKVLDQLGV------ESVE
PDXT_STRR6      --------------------------MKIGILALQGAFAEHAKVLDQLGV------ESVE
PDXT_STRPN      --------------------------MKIGILALQGAFAEHAKVLDQLGV------ESVE
PDXT_HAEIN      --------------------------MKIGILALQGAFAEHARMLEKLGI------ESVE
PDXT_METLZ      --------------------------MRIGVLALQGAFIEHIRMLERLGV------ETFE
PDXT_FRATH      ------------------------MTQKVGVLAIQGGYQKHADMFKSLGV------EVKL
PDXT_FRATO      ------------------------MTQKVGVLAIQGGYQKHADMFKSLGV------EVKL
PDXT_FRAT1      ------------------------MTQKVGVLAIQGGYQKHADMFKSLGV------EVKL
PDXT_FRATW      ------------------------MTQKVGVLAIQGGYQKHADMFKSLGV------EVKL
PDXT_FRATT      ------------------------MTQKVGVLAIQGGYQKHADMFKSLGV------EVKL
PDXT_FRATN      ------------------------MTQKVGVLAIQGGYQKHADMFKSLGV------EVKL
PDXT_PARUW      --------------------------MLIGILALQGDFFKHQEMLHSLGI------ETIQ
PDXT_SOLUE      -------------------------MKKVGVLSLQGDFAAHGAALERAGA------QPVF
PDXT_THEAC      --------------------------MNIGVLGFQGDVQEHMDMLKKLSRKN-RDLTLTH
PDXT_THEVO      --------------------------MNVGIIGFQGDVEEHIAIVKKISRRR-KGINVLR
PDXT_PICTO      --------------------------MKIGVLGIQGDVYEHYTAIRPLKNKY-K-VEAYI
PDXT_THEMA      --------------------------MKIGVLGVQGDVREHVEALHKLG------VETLI
PDXT_METST      -------------------------MITIGILDLQGDVEEHQIITEKALKEMKIDGTTKL
PDXT_METTH      -------------------------MIRIGILALQGDVSEHLEMTRRTVEEMGIDAEVVR
PDXT_METJA      --------------------------MIIGVLAIQGDVEEHEEAIKK------AGYEAKK
PDXT_METMP      -------------------------MKIIGILGIQGDIEEHEDAVKK------INCIPKR
                                             .:.  **    :                   

PDXT_PYRIL      VKKPQDLKEIA----TLAIPGGESTTIGALAKRTGLLDALRDAIKEG-LPTLGTCAGAIF
PDXT_PYRAE      VKKPGDLKDIK----ALAIPGGESTTIGRLAKRTGLLDAVKKAIEGG-VPALGTCAGAIF
PDXT_PYRCJ      VKNAQDLADIS----TLILTGGESTTIGKLAKAKGLEDNIKKAT----LPILATCAGLIY
PDXT_HYPBU      VKTEKQLESID----ALIIPGGESTTIGRLIERRGLLEPLRDRIRAG-LPVLGTCAGSIL
PDXT_STAMF      VKKPQQLHDLD----GIIIPGGESTTISILARKTNVLELLREKIVEG-LPVMGVCAGAIM
PDXT_AERPE      VKKPEDLKGLD----GVIIPGGESTTIGILAKRLGVLEPLREQVLNG-LPAMGTCAGAII
PDXT_SACS2      IKIPKDLKGVD----GVIIPGGESTTIGLVAKRLGLLDELKEKITSG-LPVLGTCAGAIM
PDXT_SULTO      VKKPNDLKDVD----AIIIPGGESTTIGVVAQKLGILDELKEKINSG-IPTLGTCAGAII
PDXT_METAC      IKHKGIVPECS----GIVIPGGESTTLCRLLAREGIGEEIKEAAARG-VPVLGTCAGLIV
PDXT_METMA      IKHKGIVPECS----GIVIPGGESTTLCRLLAREGIAEEIKEAAAKG-VPILGTCAGLIV
PDXT_METAR      IKHSGIVPTCD----AIVIPGGESTTLCRLAWREGIAQEIIEKARQG-MPIWGTCAGLIL
PDXT_ARCFU      TRRRGVVSRSD----AVILPGGESTTISKLIFSDGIADEILQLAEEG-KPVMGTCAGLIL
PDXT_PYRAB      LKKPEQLKEVS----AIIIPGGESTTISRLMQKTGLFEPVKKLIEDG-LPVMGTCAGLIM
PDXT_THEKO      LKKPEQLENIS----AIIIPGGESTTISRLMVKNGLFEPVKKLGEEG-LPIMGTCAGLIM
PDXT_PYRFU      VKRPEQLNQID----GVIIPGGESTTISRLMQRTGLFDPLKKMIEDG-LPAMGTCAGLIM
PDXT_PYRHO      LKRPEQLKGVD----AVIIPGGESTTISRLMQRTGLFEPIKKMVEDG-LPVMGTCAGLIM
PDXT_METKA      ARYPEDLEDVD----AVVIPGGESTTIGRLMERHDLVKPLLELAESD-TPILGTCAGMVI
PDXT_HALMA      IREAGLVPDCD----VLLLPGGESTTISRLIHREGIAEEIESHVEAG-KPVLATCAGLIV
PDXT_HALSA      IRTAGVVPECD----VLLLPGGESTAISRLLDREGIDAEIRSHVAAG-KPLLATCAGLIV
PDXT_METTP      VRRAGIIPTCS----GIVIPGGESTTISRQLERTGIAAEIKQAAANG-TPVLATCAGLVL
PDXT_METMJ      IRRAEDLADLD----ALAIPGGESTTISRLMGKNGLYEPVAEFEGG----VFATCAGMVL
PDXT_CENSY      VNDASAIKELD----GLIIPGGESTVIGGLAGGE-LLDVIRTKVRGG-MPAFGICAGLIL
PDXT_ACIC1      VRRADELATVD----ALVIPGGESTTMDKLARAFGLWEPLRARLAAG-MPAFGSCAGMIM
PDXT_NOCSJ      VRRPAELDVCA----GLVIPGGESTTMAKLARTFDLFEPIRQRIKEG-MPAFGTCAGMIM
PDXT_MYCBP      VRRRDELDAVD----ALVIPGGESTTMSHLLLDLDLLGPLRARLADG-LPAYGSCAGMIL
PDXT_MYCBO      VRRRDELDAVD----ALVIPGGESTTMSHLLLDLDLLGPLRARLADG-LPAYGSCAGMIL
PDXT_MYCTU      VRRRDELDAVD----ALVIPGGESTTMSHLLLDLDLLGPLRARLADG-LPAYGSCAGMIL
PDXT_MYCA1      VRRRGELEAVD----GLVIPGGESTTMSHLLKDLDLLEPLRGLLADG-LPAYGACAGMIL
PDXT_MYCLE      VRRRGELDEVD----ALVIPGGESTTISHLLLDCELLEPLRARLADG-LPAYGACTGMIL
PDXT_MYCUA      VRRRSELDAVD----GLVIPGGESTTISHLLCGFDLLEPLRARLAAG-LPAYGACAGMIM
PDXT_MYCSK      VRRLRELEAVD----ALVIPGGESTAMSHLLREFELLEPLRARLAEG-MPAYGSCAGMIL
PDXT_MYCSS      VRRLRELEAVD----ALVIPGGESTAMSHLLREFELLEPLRARLAEG-MPAYGSCAGMIL
PDXT_MYCSJ      VRRLRELEAVD----ALVIPGGESTAMSHLLREFELLEPLRARLAEG-MPAYGSCAGMIL
PDXT_MYCVP      VRRLDELNSVD----ALVIPGGESTAMSHLLREFGLLEPLRARLAEG-MPAYGSCAGMIL
PDXT_FRAAA      VRRAAQLAEVD----GLVLPGGESTTIGRLLQVFELLEPLRAAVVAG-LPVFGSCAGMIL
PDXT_NOCFA      VRRVGELEAVD----GLVLPGGESTAISKLLQVFDLLDPLRARLRDG-MPAFGSCAGMIL
PDXT_SACEN      VRRPEELAQVH----GLVLPGGESTAMTRLLDGFELFEPLRERLAAG-MPAFGSCAGMVL
PDXT_STRAW      VRRPEELAEVD----GLVIPGGESTTISKLAHLFGMMEPLRARVRGG-MPVYGTCAGMIM
PDXT_STRCO      VRRPEELAEVD----GLVLPGGESTTISKLAVLFGVMDPLRARVRDG-MPVYGTCAGMIM
PDXT_PAEAT      IRRPSELDDID----GLIIPGGESTTIDKLSRIFEVRDPLQKRIAEG-LPVYGSCAGMIL
PDXT_ARTS2      IRRPSELDGID----GLIIPGGESTAIDKLARAFELADPLRKLIAEG-LPVYGSCAGMIL
PDXT_LEIXX      VRRPDELETVA----GLVIPGGESSVMDKLARTVGLAGPLRNAIAGG-LPVYGTCAGLIM
PDXT_CORGB      VRVPKDLDGLE----GIVIPGGESTVLDKLARTFDVAEPLANLIRDG-LPVFATCAGLIY
PDXT_CORGL      VRVPKDLDGLE----GIVIPGGESTVLDKLARTFDVVEPLANLIRDG-LPVFATCAGLIY
PDXT_CORDI      VRVPNDLLGLD----GLIIPGGESTVMDKLARAFDLAEPLRAAINNG-LPVFATCAGLIY
PDXT_CUTAK      VRRSADLQGLD----GIVLPGGESTVIDKLMRSFSLAEPLKDAVRRG-LPVLATCAGLVV
PDXT_TROW8      VKTSEDLSRVT----RLIIPGGESTAMLALTQKSGLFDLVRDRIMSG-MPVYGTCAGMIM
PDXT_TROWT      VKTSEDLSRVT----RLIIPGGESTAMLALTQKSGLFDLVRDRIMSG-MPVYGTCAGMIM
PDXT_THET2      VRKVKDLEGLK----ALIVPGGESTTIGKLAREYGLEEAVRRRVEEGTLALFGTCAGAIW
PDXT_THET8      VRKKEHLEGLK----ALIVPGGESTTIGKLAREYGIEDEVRKRVEEGSLALFGTCAGAIW
PDXT_DEIRA      VRLPADLAGLS----GLILPGGESTTMVRLLTEGGLWHPLRDFHAAG-GALWGTCAGAIV
PDXT_ACTP2      VKSLSELQQVD----ALVLPGGESTAMRRLMHSSGLFQALKSFDKP----ILGTCAGLIL
PDXT_HAEDU      VKQVEQLNQLD----ALVLPGGESTAMRRLMEANGLFERLKTFDKP----ILGTCAGLIL
PDXT_PASMU      IKTVSELTALD----GLVLPGGESTTIGRLMRQYGFIEAIQDVAKQG-KGIFGTCAGMIL
PDXT_BACAH      VKRIEQLEEID----GLILPGGESTTMRRLIDKYDFMEPLRTFAKSG-KPMFGTCAGMIL
PDXT_BACHK      VKRIEQLEEID----GLILPGGESTTMRRLIDKYDFMEPLRTFAKSG-KPMFGTCAGMIL
PDXT_BACAN      VKRIEQLEEID----GLILPGGESTTMRRLIDKYDFMEPLRTFAKSG-KPMFGTCAGMIL
PDXT_BACCZ      VKRIEQLEEID----GLILPGGESTTMRRLIDKYDFMEPLRTFAKSG-KPMFGTCAGMIL
PDXT_BACC1      VKRIEQLEEID----GLILPGGESTTMRRLIDKYAFMEPLRTFAKSG-KPMFGTCAGMIL
PDXT_BACCR      VKRIEQLEEID----GLILPGGESTTMRRLIDKYAFMEPLRTFAKSG-KPMFGTCAGMIL
PDXT_GEOSE      VKKSEQLEGLD----GLVLPGGESTTXRRLIDRYGLXEPLKQFAAAG-KPXFGTCAGLIL
PDXT_GEOKA      VKKPEQLEGLD----GLVLPGGESTTMRRLIDRYGLMEPLKQFAAAG-KPMFGTCAGLIL
PDXT_BACSU      VKRPEQLNEVD----GLILPGGESTTMRRLIDTYQFMEPLREFAAQG-KPMFGTCAGLII
PDXT_BACLD      IKWPEELKEID----GLILPGGESTTMRRLIDTYQFMKPLQEFAASG-KPVFGTCAGLII
PDXT_BACCI      VKRAEQLAELD----GLIIPGGESTTIGKLMRRYGFIEAIRDFSNQG-KAVFGTCAGLIV
PDXT_BACHD      VKKVEQLEDLD----GLVFPGGESTTMRRLIDKYGFFEPLKAFAAQG-KPVFGTCAGLIL
PDXT_STAAC      VKKVEQLEEIE----GLILPGGESTTLRRLMNLYGFKEALQNSTL----PMFGTCAGLIV
PDXT_STAAM      VKKVEQLEEIE----GLILPGGESTTLRRLMNLYGFKEALQNSTL----PMFGTCAGLIV
PDXT_STAAN      VKKVEQLEEIE----GLILPGGESTTLRRLMNLYGFKEALQNSTL----PMFGTCAGLIV
PDXT_STAAR      VKKVEQLEEIE----GLILPGGESTTLRRLMNLYGFKEALQNSTL----PMFGTCAGLIV
PDXT_STAAS      VKKVEQLEEIE----GLILPGGESTTLRRLMNLYGFKEALQNSTL----PMFGTCAGLIV
PDXT_STAAW      VKKVEQLEEIE----GLILPGGESTTLRRLMNLYGFKEALQNSTL----PMFGTCAGLIV
PDXT_STAES      IKRVEQLDEID----GLILPGGESTTLRRLMDLYGFKEKLQQLDL----PMFGTCAGLIV
PDXT_STAEQ      IKRVEQLDEID----GLILPGGESTTLRRLMDLYGFKEKLQQLDL----PMFGTCAGLIV
PDXT_OENOB      VKDASQLEELD----GLVLPGGESTTMRRLMDKYGLFDAIKIFAKK--KAIFGTCAGLIL
PDXT_BACSK      IKRADQLAEVD----GLILPGGESTAMRRLIDKYQLFKPLREFGESG-KPILGTCAGLIL
PDXT_LISMF      VKHSSDLDGLD----GLVLPGGESTTMRKIMKRYDLMEPIRAFASEG-KAIFGTCAGLVL
PDXT_LISMO      VKHSNDLAGLD----GLVLPGGESTTMRKIMKRYDLMEPVKAFASKG-KAIFGTCAGLVL
PDXT_LISIN      VKHSNDLAGLD----GLVLPGGESTTMRKIMKRYDLMEPVKAFAKEG-KAIFGTCAGLVL
PDXT_LISW6      VKHPSDLNELD----GLVLPGGESTTMRKIMKRYDLIEPVRAFAKEG-KAIFGTCAGLVL
PDXT_OCEIH      VKKSTDLHQLD----GLIIPGGESTAIWKLIEENKLYEPIQNFANEG-KAIFGTCAGLVL
PDXT_CLOAB      VRSLEDLQKID----RLIIPGGESTTIGKFLKQSNMLQPLREKIYGG-MPVWGTCAGMIL
PDXT_CALS4      AKDKDTLLTLD----ALIIPGGESTAIGKILVDFGLKDAILKLNERK-VPIWGTCAGMIL
PDXT_SYNAS      VKEPLDFEGVA----GLILPGGESTCLSRLIRIFHLEGCILDAFQKG-MKIWGTCAGAIL
PDXT_BIFAA      LRAAEDFDDSI---DRVILPGGESTTQGKLLRSTGLFEPIAEHIAAG-KPVFGTCAGMIL
PDXT_BIFLO      LRAAEDFDESI---DRVILPGGESTTQGKLLHSTGLFEPIAAHIKAG-KPVFGTCAGMIL
PDXT_STRP2      LRNLDDFQQDQSDLSGLILPGGESTTMGKLLRDQNMLLPIREAILSG-LPVFGTCAGLIL
PDXT_STRR6      LRNLDDFQQDQSDLSGLILPGGESTTMGKLLRDQNMLLPIREAILSG-LPVFGTCAGLIL
PDXT_STRPN      LRNLDDFQQDQSDLSGLILPGGESTTMGKLLRDQNMLLPIREAILSG-LPVFGTCAGLIL
PDXT_HAEIN      LRNLKNFQQHYSDLSGLILPGGESTAIGKLLRELYMLEPIKQAISSG-FPVFGTCAGLIL
PDXT_METLZ      IRNLSDLKEIP---DGLILPGGESTVMSKLLQDLGLFEKLRSLIMTG-TPVMGTCAGLIL
PDXT_FRATH      VKFNNDFDSID----RLVIPGGESTTLLNLLNKHQIFDKLYNFCSS--KPVFGTCAGSII
PDXT_FRATO      VKFNNDFDSID----RLVIPGGESTTLLNLLNKHQIFDKLYNFCSS--KPVFGTCAGSII
PDXT_FRAT1      VKFNNDFDSID----RLVIPGGESTTLLNLLNKHQIFDKLYNFCSS--KPVFGTCAGSII
PDXT_FRATW      VKFNNDFDSID----RLVIPGGESTTLLNLLNKHQIFDKLYNFCSS--KPVFGTCAGSII
PDXT_FRATT      VKFNNDFDSID----RLVIPGGESTTLLNLLNKHQIFDKLYNFCSS--KPVFGTCAGSII
PDXT_FRATN      VKFNNDFDSID----RLVIPGGESTTLLNLLNKHQIFDKLYNFCSS--KPVFGTCAGSIV
PDXT_PARUW      VKTRNELDFCD----ALIIPGGESTVMMRQLETTNLKELLVHFAIH--KPVFGTCAGLIL
PDXT_SOLUE      VREREQLNQIE----GLILPGGESTTMLKLLRYEDLFDDVAEFGRT--KPVFGTCAGAIL
PDXT_THEAC      VKRVIDLEHVD----ALIIPGGESTTIYKLTLEYGLYDAIVKRSAEG-MPIMATCAGLIL
PDXT_THEVO      IRRKEDLDRSD----SLIIPGGESTTIYKLISEYGIYDEIIRRAKEG-MPVMATCAGLIL
PDXT_PICTO      IRSPEEINEMD----GIIIPGGESTTITRFLSRY--INIINENVRNG-MKIMGTCAGAII
PDXT_THEMA      VKLPEQLDMVD----GLILPGGESTTMIRILKEMDMDEKLVERINNG-LPVFATCAGVIL
PDXT_METST      VNTLDDIKDCN----GLIISGGESSTIGMHLEKTGLSNYLKETGI----PILGTCAGLVL
PDXT_METTH      VRTAEEASTVD----AIIISGGESTVIGRLMEETGIKDVIIREKK----PVMGTCAGMVL
PDXT_METJA      VKRVEDLEGID----ALIIPGGESTAIGKLMKKYGLLEKIKNSNL----PILGTCAGMVL
PDXT_METMP      IRTVDDLEGID----ALIIPGGESTTIGKLMVSYGFIDKIRNLKI----PILGTCAGMVL
                 .              : ..****:              :            . *:* : 

PDXT_PYRIL      LAKEVRDSVVG----ETKQPILGLMDIAVVRNAFGRQRESFEVDLQVGELGTV-------
PDXT_PYRAE      MAKEVKDAVVG----ATGQPVLGVMDIAVVRNAFGRQRESFEAEVVLENLGKL-------
PDXT_PYRCJ      LAKEAVDRRVG----KTRQSLLGLLDVSVVRNAFGRQRESFQTELEVRGFGKV-------
PDXT_HYPBU      LAKKVRDRVVG----PVEQPLLAVMDIAVLRNAFGRQMNSFEAEVHIEGVGTV-------
PDXT_STAMF      LAKEVVDQVVG----ETKQPLLGVMDIAVTRNYFGRQRESFELDIVLDELDDKP------
PDXT_AERPE      LAGKVRDKVVG----EKSQPLLGVMRVEVVRNFFGRQRESFEADLEIEGLDGR-------
PDXT_SACS2      LAKEVSDAKVG----KTSQPLIGTMNISVIRNYYGRQKESFEAIVDLSKIGKDK------
PDXT_SULTO      LAKDVTDAKVG----KKSQPLIGSMDISVIRNYYGRQRESFEATVDLSEIGGGK------
PDXT_METAC      LAKEGDRQVE-----KTGQELLGIMDTRVNRNAFGRQRDSFEAELDVVILDSP-------
PDXT_METMA      IAKEGDRQVE-----KTGQELLGIMDTRVNRNAFGRQRDSFEAELEVFILDSP-------
PDXT_METAR      LASRGDEEVT-----KTKQQLFGLMDITVNRNAFGRQIDSFEAPLAIAGFDEP-------
PDXT_ARCFU      LSKYGDEQVE-----KTNTKLLGLLDAKVKRNAFGRQRESFQVPLDVKYVGK--------
PDXT_PYRAB      LSREVLGATP-------EQRFLEVLDVRVNRNAYGRQVDSFEAPVRLSFDDEP-------
PDXT_THEKO      LSKEVIGATP-------EQKFLELLDVKVNRNAYGRQVDSFEAPIKLAFSGEP-------
PDXT_PYRFU      LAKEVIGATP-------EQKFLEVLDVKVNRNAYGRQVDSFEAPVKLAFDDKP-------
PDXT_PYRHO      LAKEVLGATP-------EQKFLEVLDVKVNRNAYGRQVDSFEAPVKLAFDDEP-------
PDXT_METKA      LAREVVPQAHPGTEVEIEQPLLGLMDVRVVRNAFGRQRESFEVDIEIEGLEDR-------
PDXT_HALMA      SATDAQDDRVDT---------LNVIDVSVERNAFGRQRDSFEAPLDVTGLN---------
PDXT_HALSA      SSTDANDDRVET---------LDVLDVTVDRNAFGRQVDSFEAPLDVDGLA---------
PDXT_METTP      AAKEIDAGDVKP---------LGLIDISVGRNAFGPQRESFEAEINVEGFD---------
PDXT_METMJ      SADRVDDPRVRP---------LSLIPMHVARNAFGRQVDSRETMLEVAGLA---------
PDXT_CENSY      LSKGATDRTVGR--T--GQPLLDLLDVRVERNAFGRQKESFETELSMTSCGI--------
PDXT_ACIC1      LAARVVDAAP----GQE---TLGVLDITVRRNAFGRQVDSFEADIPLTGLDGG-------
PDXT_NOCSJ      LADRIEDGTR----DQE---TLGGLDITVRRNAFGRQVESFEGEIDVVGLDA--------
PDXT_MYCBP      LASEILDAGA----AGRQALPLRAMNMTVRRNAFGSQVDSFEGDIEFAGLDD--------
PDXT_MYCBO      LASEILDAGA----AGRQALPLRAMNMTVRRNAFGSQVDSFEGDIEFAGLDD--------
PDXT_MYCTU      LASEILDAGA----AGRQALPLRAMNMTVRRNAFGSQVDSFEGDIEFAGLDD--------
PDXT_MYCA1      LASEILDAGA----GGREALPLRAIDMTVRRNAFGRQVDSFEGDIAFAGLDV--------
PDXT_MYCLE      LASEILDAGV----CGREALPLGAIDITVRRNAFGRQVDSFEGDIGFAGLVD--------
PDXT_MYCUA      LASEILDAGV----RGRQALPLRGIDMTVRRNAFGRQVDSFEGDIAFTGLDH--------
PDXT_MYCSK      LATEILDAGA----AGREATPLKGIDMSVRRNAFGRQVDSFEGDIPFVGLDS--------
PDXT_MYCSS      LATEILDAGA----AGREATPLKGIDMSVRRNAFGRQVDSFEGDIPFVGLDS--------
PDXT_MYCSJ      LATEILDAGA----AGREATPLKGIDMSVRRNAFGRQVDSFEGDIPFVGLDS--------
PDXT_MYCVP      LATEIADAGV----AGREALPLGGIDMTVRRNAFGRQVDSFEEDVEFEGLDG--------
PDXT_FRAAA      LARDVVDGR-------PDQPLIGGLDMVVRRNAFGRQVDSFEVDLDVDGVEGP-------
PDXT_NOCFA      LASEVLDTR-------PDAQHLSGIDMTVRRNAFGRQVDSFETDLDFAGLDDG-------
PDXT_SACEN      LAGTVLDDRVEQ--DTPPVRPFGAIDMAVRRNAFGRQVDSFEADLDFAGVTDG-------
PDXT_STRAW      LADKILDPR-------SGQETIGGIDMIVRRNAFGRQNESFEATVDVKGVGGD-------
PDXT_STRCO      LADKILDPR-------SGQETVGGIDMIVRRNAFGRQNESFEAAVDVEGVEGE-------
PDXT_PAEAT      LADEIADPATDL--DGNPQQTFGGLDITVRRNAFGRQRESFETDLDFKGLDFSAGES---
PDXT_ARTS2      LADEIADPATDL--AGNPQQTFGGLDITVRRNAFGRQRESFEIDLEFKGLGFSDTGS---
PDXT_LEIXX      LADTIVD---GI--AG--QRSLGGLDVAVRRNAFGSQAESFETDLSFPTL----------
PDXT_CORGB      LAKHLDNPAR-------GQQTLELLDVVVRRNAFGTQRESFDTTVDVSFDGAT-------
PDXT_CORGL      LAKHLDNPAR-------GQQTLAVVDVVVRRNAFGAQRESFDTTVDVSFDGAT-------
PDXT_CORDI      LGT-VENPAK-------GQQTLGCLDVVVRRNAFGRQVDSFDAVVDVEGIDA--------
PDXT_CUTAK      LATDLEDAAK-------GQHTLSLLDVTVRRNAFGSQLDSFEGTLDIDGVGD--------
PDXT_TROW8      LSTFVEDFPN--------QKTLSCLDIAVRRNAFGRQINSFESEVSFLNSK---------
PDXT_TROWT      LSTFVEDFPN--------QKTLSCLDIAVRRNAFGRQINSFESEVSFLNSK---------
PDXT_THET2      LAREILG--------YPEQPRLGVLDAAVERNAFGRQVESFEEDLEVEGL----------
PDXT_THET8      LAKEIVG--------YPEQPRLGVLEAWVERNAFGRQVESFEEDLEVEGL----------
PDXT_DEIRA      LAREVMGGSP----SLPPQPGLGLLDITVQRNAFGRQVDSFTAPLDIAGLD---------
PDXT_ACTP2      LANKLEGGEP---------PHLAKMNIQVQRNAFGRQVDSFQTDLMIKGFADS-------
PDXT_HAEDU      LADEIIGGEQ---------VHLAKMAIKVQRNAFGRQIDSFQTPLTVSGLDKP-------
PDXT_PASMU      LAKQLENDPT---------VHLGLMDICVQRNAFGRQVDSFQTALEIEGFATT-------
PDXT_BACAH      LAKTLIGYDE---------AHIGAMDITVERNAFGRQKDSFEAALSIKGVGED-------
PDXT_BACHK      LAKTLIGYDE---------AHIGAMDITVERNAFGRQKDSFEAALSIKGVGED-------
PDXT_BACAN      LAKTLIGYDE---------AHIGAMDITVERNAFGRQKDSFEAALSIKGVGED-------
PDXT_BACCZ      LAKTLIGYDE---------AHIGAMDITVERNAFGRQKDSFEAALSIKGVGED-------
PDXT_BACC1      LAKTLIGYDE---------AHIGAMDITVERNAFGRQKDSFEAALSIKGVGED-------
PDXT_BACCR      LAKTLIGYEE---------AHIGAMDITVERNAFGRQKDSFEAALSIEGVGED-------
PDXT_GEOSE      LAKRIVGYDE---------PHLGLXDITVERNSFGRQRESFEAELSIKGVGDG-------
PDXT_GEOKA      LAKRIVGYDE---------PHLGLMDITVERNSFGRQRESFEAELSIKGVGDG-------
PDXT_BACSU      LAKEIAGSDN---------PHLGLLNVVVERNSFGRQVDSFEADLTIKGLDEP-------
PDXT_BACLD      LAKNIAGTND---------AHLGVLDVTVERNSFGRQVDSFEADLTVKGLEGP-------
PDXT_BACCI      IADKIAGQEE---------AHLGLMDMTVQRNAFGRQRESFETDLPVKGIDRP-------
PDXT_BACHD      MATRIDGEDH---------GHLELMDMTVQRNAFGRQRESFETDLIVEGVGDD-------
PDXT_STAAC      LAQDIVG-EE---------GYLNKLNITVQRNSFGRQVDSFETELDIKGIATD-------
PDXT_STAAM      LAQDIVG-EE---------GYLNKLNITVQRNSFGRQVDSFETELDIKGIATD-------
PDXT_STAAN      LAQDIVG-EE---------GYLNKLNITVQRNSFGRQVDSFETELDIKGIATD-------
PDXT_STAAR      LAQDIVG-EE---------GYLNKLNITVQRNSFGRQVDSFETELDIKGIATD-------
PDXT_STAAS      LAQDIVG-EE---------GYLNKLNITVQRNSFGRQVDSFETELDIKGIATD-------
PDXT_STAAW      LAQDIVG-EE---------GYLNKLNITVQRNSFGRQVDSFETELDIKGIATD-------
PDXT_STAES      LAKNVEN-ES---------GYLNKLDITVERNSFGRQVDSFESELDIKGIAND-------
PDXT_STAEQ      LAKNVEN-ES---------GYLNKLDITVERNSFGRQVDSFESELDIKGIAND-------
PDXT_OENOB      MAKEIEGRKG---------PHLGLLDIDVKRNAFGSQVDSFESDLKIDHVAES-------
PDXT_BACSK      MAKTLSGEQD---------GHLGFIDMVVERNAFGRQRDSFEATLDVKGVAEK-------
PDXT_LISMF      LSKEIEGGE----------ESLGLIEATAIRNGFGRQKESFEAELNVEAFGEPA------
PDXT_LISMO      LSKEIEGGE----------ESLGLIEATAIRNGFGRQKESFEAELNVEAFGEPA------
PDXT_LISIN      LSKEIEGGE----------ESLGLLEATAIRNGFGRQKESFEAELTVEVFDDSP------
PDXT_LISW6      LSKEIEGGE----------ESLGLIDTTAVRNGFGRQKESFEAELNVEIFSDAP------
PDXT_OCEIH      LSKTTIGRDYT--------PTLKLMDITVQRNGFGRQKDSFEATIQAKYMDDS-------
PDXT_CLOAB      LARKIENSEV---------NYINAIDITVRRNAYGSQVDSFNTKALIEEISLNE------
PDXT_CALS4      MAKHIVNDER---------RHLGIMDITVRRNAYGSQINSFKTRLIIPAISENE------
PDXT_SYNAS      LATGILG-ER---------PHLGLIDMDIERNGFGSQLDSFCIEAALPELSADP------
PDXT_BIFAA      LARKLDNDDN---------VYFGALDAVVRRNAYGRQLGSFAATADFGS--SSGDSAVVV
PDXT_BIFLO      LAKKLDNDDN---------VYFGALDAVVRRNAYGRQLGSFQATADFGA--ADD------
PDXT_STRP2      LAKEITSQKE---------SHLGTMDMVVERNAYGRQLGSFYTEAECKG--VGK------
PDXT_STRR6      LAKEITSQKE---------SHLGTMDMVVERNAYGRQLGSFYTEAECKG--VGK------
PDXT_STRPN      LAKEITSQKE---------SHLGTMDMVVERNAYGRQLGSFYTEAECKG--VGK------
PDXT_HAEIN      LAKEITSQKE---------SHFGTMDIVVERNAYGRQLGSFYTEADCKG--VGK------
PDXT_METLZ      LAKYIEGGSP---------S-LGTMDITAVRNAYGRQLGSFQATAPFAG--AGN------
PDXT_FRATH      LSK-----GE---------GYLNLLDLEVQRNAYGRQVDSFVADISFN---DKN------
PDXT_FRATO      LSK-----GE---------GYLNLLDLEVQRNAYGRQVDSFVADISFN---DKN------
PDXT_FRAT1      LSK-----GE---------GYLNLLDLEVQRNAYGRQVDSFVADISFN---DKN------
PDXT_FRATW      LSK-----GE---------GYLNLLDLEVQRNAYGRQVDSFVADISFN---DKN------
PDXT_FRATT      LSK-----GE---------GYLNLLDLEVQRNAYGRQVDSFVADISFN---DKN------
PDXT_FRATN      LSK-----GE---------GYLNLLDLEVQRNAYGRQVDSFVADISFN---DKN------
PDXT_PARUW      MSSHVQNSAM---------MPLGLLHIAVERNAFGRQVDSFQVDVSVY---LKPGDE---
PDXT_SOLUE      MAKGVTNPAQ---------ESFGLVDIEVERNAYGRQTDSRIAQVRPFPDFENRTAP---
PDXT_THEAC      VSKNTNDERV---------RGMGLLDVTIRRNAYGRQVMSFETDIEINGIGM--------
PDXT_THEVO      ISKDTNDDRV---------PGMNLLDVTIMRNAYGRQVNSFETDIDIKGIGT--------
PDXT_PICTO      LSKDTGDPRV---------HGTGIMDIKIQRNAYGRQIDSFIDAVNIKNIGT--------
PDXT_THEMA      LAKRIKNYSQ---------EKLGVLDITVERNAYGRQVESFETFVEIPAVGKDP------
PDXT_METST      LSKKTDQDQP----------LLGLIDSTVKRNGFGRQRMSFESEIKFNN-----------
PDXT_METTH      LADETDYEQP----------LLGLIDMKVKRNAFGRQRDSFEDEIDILG-----------
PDXT_METJA      LSKGTGINQI----------LLELMDITVKRNAYGRQVDSFEKEIEFKDL----------
PDXT_METMP      LSKGTGKEQP----------LLEMLNVTIKRNAYGSQKDSFEKEIDLGG-----------
                 .                            ** :* *  *                    

PDXT_PYRIL      -------------------RAVFIRAPAFIKA-WGDARLAAPLKHPEL-----------G
PDXT_PYRAE      -------------------KAVFIRAPAFVRA-WGSAKLLAPLRHNQL-----------G
PDXT_PYRCJ      -------------------NAVFIRAPAVVKI-GPSVEPLASLRHVDY-----------G
PDXT_HYPBU      -------------------HAAFIRAPIIEET-WGEARPIAKLNHPLL-----------G
PDXT_STAMF      ------------------FRAVFIRAPAITKY-WGATKPIGIINYNG------------E
PDXT_AERPE      ------------------FRGVFIRSPAITAA-ESPARIISWLDYNG------------Q
PDXT_SACS2      ------------------AHVVFIRAPAIAKV-WGKAQSLAELNG---------------
PDXT_SULTO      ------------------TRVVFIRAPAIVKT-WGDAKPLSKLND---------------
PDXT_METAC      ------------------FTGVFIRAPGIISC-GPGVRVLSRLED---------------
PDXT_METMA      ------------------FTGVFIRAPGIVSC-GPGVKVLSRLEG---------------
PDXT_METAR      ------------------FNAVFIRAPAIVSA-GQNVKVLAKYDD---------------
PDXT_ARCFU      ------------------FDAVFIRAPAITEV-GKDVEVLATFEN---------------
PDXT_PYRAB      ------------------FIGVFIRAPRIVELLSDRVKPLAWLED---------------
PDXT_THEKO      ------------------FPGVFIRAPRIVELLSERVKPIAWLGD---------------
PDXT_PYRFU      ------------------FIGVFIRAPRIVELLSDKVKPLAWLED---------------
PDXT_PYRHO      ------------------FIGVFIRAPRIVELLSEKVKPLAWLED---------------
PDXT_METKA      ------------------FRAVFIRAPAVDEVLSDDVKVLAEYGD---------------
PDXT_HALMA      ----------------ESFPAVFIRAPVIDYVG-EDVEVLATWD----------------
PDXT_HALSA      ----------------DPFPAVFIRAPVIDEVG-ADATVLASWD----------------
PDXT_METTP      ----------------RPYRAVFIRAPVVLRCG-EGVEKLARFG----------------
PDXT_METMJ      ----------------EPFRAVFIRAPVATEAG-DGVEVLARIP----------------
PDXT_CENSY      ----------------EEFRGVFIRAPVITEAG-PGVQVIAEYD----------------
PDXT_ACIC1      -----------------PLRAVFIRAPWVEETG-PDVEVLGRVP----SGRH-------A
PDXT_NOCSJ      -----------------PLHAVFIRAPWVEAVG-DSVEVLARVE----QGEA-------A
PDXT_MYCBP      -----------------PVRAVFIRAPWVERVG-DGVQVLARA----------------A
PDXT_MYCBO      -----------------PVRAVFIRAPWVERVG-DGVQVLARA----------------A
PDXT_MYCTU      -----------------PVRAVFIRAPWVERVG-DGVQVLARA----------------A
PDXT_MYCA1      -----------------PVRAVFIRAPWVERAG-DGVEVLARA----------------A
PDXT_MYCLE      -----------------PVRAVFIRAPWVERAG-DGVQVLAQA----------------A
PDXT_MYCUA      -----------------PVRAVFIRAPWVERVG-AGVTVLARA----------------G
PDXT_MYCSK      -----------------PVHAVFIRAPWVERIG-DGVEVLARA----------------D
PDXT_MYCSS      -----------------PVHAVFIRAPWVERIG-DGVEVLARA----------------D
PDXT_MYCSJ      -----------------SVHAVFIRAPWVERIG-DGVEVLARA----------------D
PDXT_MYCVP      -----------------PVHAVFIRAPWVERVG-PDVEVLARA----------------G
PDXT_FRAAA      -----------------PVHAVFIRAPWVEKAG-DAVEVLARVA----EAP---------
PDXT_NOCFA      -----------------PVRAVFIRAPWVERAG-DGVQVLATVP----DGPS-------R
PDXT_SACEN      -----------------PVHAVFIRAPWVDKVG-ADVRVLASVA----PSGHGSEVTAPA
PDXT_STRAW      -----------------PVEGVFIRAPWVESVG-AEAEVLAEH----------------G
PDXT_STRCO      -----------------PVEGVFIRAPWVESVG-AAAEVLAEH----------------D
PDXT_PAEAT      --------------GVDPVHAVFIRGPWVERVG-SGVEVLAQV---DPDHASHTATLHGV
PDXT_ARTS2      --------------GVAPVHAVFIRGPWVERVG-PGVEVLAQVEPADPAHASHAAALQGT
PDXT_LEIXX      --------------GAEPMHAVFIRAPIVESVG-PRATVLARVP---------------D
PDXT_CORGB      ---------------FPGVQASFIRAPIVTAFG-PTVEAIAALN---------------G
PDXT_CORGL      ---------------FPGVQASFIRAPIVTAFG-PTVEAIAALN---------------G
PDXT_CORDI      -------------------NVAFIRAPEVISCG-AGVTVTARV----------------G
PDXT_CUTAK      -----------------GVSATFIRAPVITRVG-PGVEVIAQLPD---------EAGNVS
PDXT_TROW8      ------------------ITVPFIRAPKITQIG-EGVDVLSRLE---------------S
PDXT_TROWT      ------------------ITVPFIRAPKITQIG-EGVDVLSRLE---------------S
PDXT_THET2      ----------------GPFHGVFIRAPVFRRLG-EGVEVLARL----------------G
PDXT_THET8      ----------------GSFHGVFIRAPVFRRLG-EGVEVLARL----------------G
PDXT_DEIRA      ----------------APFPAVFIRAPVITRVG-PAARALATL----------------G
PDXT_ACTP2      ------------------FPAVFIRAPYISRIG-SEVEVLAEWQ----------------
PDXT_HAEDU      ------------------FPAVFIRAPYITEVG-ENVEVLAEWQ----------------
PDXT_PASMU      ------------------FPAVFIRAPHIAQVNHEKVQCLATFQ----------------
PDXT_BACAH      ------------------FVGVFIRAPYVVDVA-DDVEVLSTHG----------------
PDXT_BACHK      ------------------FVGVFIRAPYVVDVA-DDVEVLSTHG----------------
PDXT_BACAN      ------------------FVGVFIRAPYVVDVA-DDVEVLSTHG----------------
PDXT_BACCZ      ------------------FVGVFIRAPYVVNVA-DDVEVLSTHG----------------
PDXT_BACC1      ------------------FVGVFIRAPYVVNVA-DNVEVLSTHG----------------
PDXT_BACCR      ------------------FVGVFIRAPYVVEVA-DNVEVLSKHG----------------
PDXT_GEOSE      ------------------FVGVFIRAPHIVEAG-DGVDVLATYN----------------
PDXT_GEOKA      ------------------FVGVFIRAPHIVEAG-DGVDVLATYN----------------
PDXT_BACSU      ------------------FTGVFIRAPHILEAG-ENVEVLSEHN----------------
PDXT_BACLD      ------------------FTGVFIRAPHILEAG-ADVEVLSEHN----------------
PDXT_BACCI      ------------------VRAVFIRAPLIDQVG-NGVDVLSEYN----------------
PDXT_BACHD      ------------------VRAVFIRAPLIQEVG-QNVDVLSKFG----------------
PDXT_STAAC      ------------------IEGVFIRAPHIEKVG-QGVDILCKVN----------------
PDXT_STAAM      ------------------IEGVFIRAPHIEKVG-QGVDILCKVN----------------
PDXT_STAAN      ------------------IEGVFIRAPHIEKVG-QGVDILCKVN----------------
PDXT_STAAR      ------------------IEGVFIRAPHIEKVG-QGVDILCKVN----------------
PDXT_STAAS      ------------------IEGVFIRAPHIEKVG-QGVDILCKVN----------------
PDXT_STAAW      ------------------IEGVFIRAPHIEKVG-QGVDILCKVN----------------
PDXT_STAES      ------------------IEGVFIRAPHIAKVD-NGVEILSKVG----------------
PDXT_STAEQ      ------------------IEGVFIRAPHIAKVD-NGVEILSKVG----------------
PDXT_OENOB      ------------------FDGVFIRAPYIKKVG-PGVEILSTYN----------------
PDXT_BACSK      ------------------LTAVFIRAPLVKEVG-PDVDILSEYN----------------
PDXT_LISMF      ------------------FEAIFIRAPYLIEPS-NEVAVLATVE----------------
PDXT_LISMO      ------------------FEAIFIRAPYLIEPS-NEVAVLATVE----------------
PDXT_LISIN      ------------------FEAVFIRAPYLIEPS-DEVSVLATVE----------------
PDXT_LISW6      ------------------FEAVFIRAPYLIEPS-PEVSVLATFE----------------
PDXT_OCEIH      ------------------YHAVFIRAPYIESVG-EGVEVIASYN----------------
PDXT_CLOAB      ------------------MPLVFIRAPYITRIG-ETVKALCTID----------------
PDXT_CALS4      ------------------IEAVFIRAPYIESVG-DGVRILAKYE----------------
PDXT_SYNAS      ------------------VPLTFIRAPKIRRVG-SDVRILLQLQ----------------
PDXT_BIFAA      APGEHVPQDAPADIVLKDFPLVFIRGPFVAEVG-PAATVETSVD----------------
PDXT_BIFLO      ------PQR------ITDFPLVFIRGPYVVSVG-PEATVETEVD----------------
PDXT_STRP2      ------------------IPMTFIRGPIISSVG-EGVEILAIVN----------------
PDXT_STRR6      ------------------IPMTFIRGPIISSVG-EGVEILAIVN----------------
PDXT_STRPN      ------------------IPMTFIRGPIISSVG-EGVEILATVN----------------
PDXT_HAEIN      ------------------IPMTFIRGPIISSVG-KKVNILATVN----------------
PDXT_METLZ      ------------------IQMTFIRAPMITHVG-KNVKVLAEVD----------------
PDXT_FRATH      ------------------ITGVFIRAPKFIVVG-NQVDILSKYQ----------------
PDXT_FRATO      ------------------ITGVFIRAPKFIVVG-NQVDILSKYQ----------------
PDXT_FRAT1      ------------------ITGVFIRAPKFIVVG-NQVDILSKYQ----------------
PDXT_FRATW      ------------------ITGVFIRAPKFIVVG-NQVDILSKYQ----------------
PDXT_FRATT      ------------------ITGVFIRAPKFIVVG-NQVDILSKYQ----------------
PDXT_FRATN      ------------------ITGVFIRAPKFIVVG-NQVDILSKYQ----------------
PDXT_PARUW      ----------------ICFPAFFIRAPRIRTSE-TPVQILASYE----------------
PDXT_SOLUE      ----------------GELKAVFIRAPIIRRIE-DGVRVLASYQ----------------
PDXT_THEAC      ------------------FPAVFIRAPVIEDSG-K-TEVLGTLD----------------
PDXT_THEVO      ------------------FHAVFIRAPRIKEYG-N-VDVMASLD----------------
PDXT_PICTO      ------------------FNAVFIRAPVIDDPG-K-TSVLGEYN----------------
PDXT_THEMA      ------------------FRAIFIRAPRIVETG-KNVEILATYD----------------
PDXT_METST      ----------------EDYHGIFIRAPYISQI-SDDVEVLSKYD----------------
PDXT_METTH      ----------------RKFHGIFIRAPAVLEV-GEGVEVLSELD----------------
PDXT_METJA      ----------------GKVYGVFIRAPVVDKILSDDVEVIARDG----------------
PDXT_METMP      ----------------KKINAVFIRAPQVGEILSKDVEIISKDD----------------
                                      ***.*         .                       

PDXT_PYRIL      QIYAAAFQGHMVATAFHPELS--TTVVHKYMLNLAKK-----------------------
PDXT_PYRAE      LVYAAAVQNNMVATAFHPELT--TTAVHKWVINMALGRF---------------------
PDXT_PYRCJ      EVYAAVRQGSVLATAFHPELT--TTAFHKWLIREAKR-----------------------
PDXT_HYPBU      EVTVAARQKAIIATVFHPEITG-DSKLHKLLVAAAKGRAF--------------------
PDXT_STAMF      KVVVAARENNKLALSFHPELTS-DTRIHRYFIEKIIKK----------------------
PDXT_AERPE      RVGVAAVQGPLLATSFHPELTG-DTRLHELWLRLVKR-----------------------
PDXT_SACS2      -VTVFAEENNMLATTFHPELSD-TTSIHEYFLHLVKG-----------------------
PDXT_SULTO      -VIIMAMERNMVATTFHPELSS-TTVIHEFLIKMAKK-----------------------
PDXT_METAC      -MIIAAEQGNVLALAFHPELTD-DLRIHQYFLNKVLSC----------------------
PDXT_METMA      -MIVAAEQGNVLALAFHPELTD-DLRIHQYFLDKVLNC----------------------
PDXT_METAR      -FIVAARQQNLLVSAFHPELTD-DLRFHWYFLEMVPGWKN--------------------
PDXT_ARCFU      -LIVAARQKNVLGLAFHPELTD-DTRIHEFFLKLGETS----------------------
PDXT_PYRAB      -RVVGVEQDNIIGLEFHPELTD-DTRVHEYFLKKAL------------------------
PDXT_THEKO      -RVVGVEQDNIIGLEFHPELTD-DTRVHEYFLRKAV------------------------
PDXT_PYRFU      -RVVGVEQGNVIGLEFHPELTD-DTRIHEYFLKKIV------------------------
PDXT_PYRHO      -RVVGVEQENIIGLEFHPELTN-DTRIHEYFLRKVI------------------------
PDXT_METKA      -YIVAVEQDHLLATAFHPELTD-DPRLHAYFLEKV-------------------------
PDXT_HALMA      DRPVAVRDGPVVGTSFHPELT-EDPRIHDLAFFDSVES----------------------
PDXT_HALSA      GRPVAIRDGPVVATSFHPELT-ADVRLHELAFFDRTPSAQAGDA----------------
PDXT_METTP      GRTVAVRQGNVIGLAFHPELT-GDLRFHKMLLEA--------------------------
PDXT_METMJ      EGIVAVRHGRHMAFAFHPELG-GDLRLHRVFLEGLEV-----------------------
PDXT_CENSY      NKKVAVQQGSVLGVSFHPELT-NDPSLHQYFLKMCA------------------------
PDXT_ACIC1      GRIVAVRQGAVLATAFHPELT-ADRRLHAFFVAMVAAQARV-------------------
PDXT_NOCSJ      GRIVAVRQGSLMATSFHPEVG-GDSRVHRLFVDLVTEER---------------------
PDXT_MYCBP      GHIVAVRQGAVLATAFHPEMT-GDRRIHQLFVDIVTSAA---------------------
PDXT_MYCBO      GHIVAVRQGAVLATAFHPEMT-GDRRIHQLFVDIVTSAA---------------------
PDXT_MYCTU      GHIVAVRQGAVLATAFHPEMT-GDRRIHQLFVDIVTSAA---------------------
PDXT_MYCA1      GHVVAVRQGARLATAFHPEMT-GDRRIHRLFVDLVTGVV---------------------
PDXT_MYCLE      GHAVAVRQGSMLATAFHPEMT-SDRRIHQLFVDIVNGIA---------------------
PDXT_MYCUA      DHIVAVREGSVLATAFHPEVT-GDRSIHRLFVDIVNGKA---------------------
PDXT_MYCSK      GHIVAVRQGRMLATAFHPEVT-GDRRVHKLFVDMVSE-----------------------
PDXT_MYCSS      GHIVAVRQGRMLATAFHPEVT-GDRRVHKLFVDMVSE-----------------------
PDXT_MYCSJ      GHIVAVRQGRMLATAFHPEVT-GDRRVHKLFVDMVSE-----------------------
PDXT_MYCVP      GHPVAVRQGKMLATAFHPEVT-GDRRVHRLFVASLS------------------------
PDXT_FRAAA      ---VAVRQGSLLATAFHPELT-GDSRMHRLFVDIVRSSGSGR------------------
PDXT_NOCFA      GRIVAVRQGNVLATSFHPEVT-GDLRVHRMFVDIVRAAGDRAGNVHTPDVQPT-------
PDXT_SACEN      GRIVAVQQGPVLATAFHPELVSGDERVHRYFVQTVRAS----------------------
PDXT_STRAW      GHIVAVRQGNALATSFHPELT-GDHRVHGLFVDMVRANRTPESL----------------
PDXT_STRCO      GHIVAVRQGNALATSFHPELT-GDHRVHRLFADMVRANRAAQSL----------------
PDXT_PAEAT      ARIVAVRSGQLLATSFHPEVT-GEKRVHELFIRMIRGEA---------------------
PDXT_ARTS2      ARIVAVRSGHLLATSFHPEVT-GEKRVHELFIRMIRGEA---------------------
PDXT_LEIXX      GRVVAVEQDNLLGTAFHPELS-GDKRFHEYFLVKVHGRV---------------------
PDXT_CORGB      GEVVGVRQGNIIALSFHPEET-GDYRIHQAWLNLIGKRTELAI-----------------
PDXT_CORGL      GEVVGVRQGNIIALSFHPEET-GDYRIHQAWLDLVRKHAELAI-----------------
PDXT_CORDI      DHVVGVRQGKIHAYAFHPESA-GEVRLHQAWLASI-------------------------
PDXT_CUTAK      GAIVGVRQRNVLALSFHPEET-DDDRVHRTWLRQVSEEV---------------------
PDXT_TROW8      GDIVAVRQGNVMATAFHPELT-GGAAVHEYFLHLGLE-----------------------
PDXT_TROWT      GDIVAVRQGNVMATAFHPELT-GGAAVHEYFLHLGLE-----------------------
PDXT_THET2      DLPVLVRQGKVLASSFHPELT-EDPRLHRYFLELAGV-----------------------
PDXT_THET8      DLPVLVRQGKVLASSFHPELT-EDPRLHRYFLELAGV-----------------------
PDXT_DEIRA      DRTAHVQQGRVLASAFHPELT-EDTRLHRVFLGLAGERAY--------------------
PDXT_ACTP2      GNVVFAKQGNLLACAFHPELT-SDTRVVELFLQQLKE-----------------------
PDXT_HAEDU      GNVVLAKQGHFFACAFHPELT-NDNRIMALLLAQL-------------------------
PDXT_PASMU      GHVVLAKQQNLLACAFHPELT-TDLRVMQHFLEMC-------------------------
PDXT_BACAH      DRMVAVRQGPFLAASFHPELT-DDHRVTAYFVEMVKEAKMKKVV----------------
PDXT_BACHK      DRMVAVRQGPFLAASFHPELT-DDHRVTAYFVEMVKEAKMKKVV----------------
PDXT_BACAN      DRMVAVKQGPFLAASFHPELT-DDHRVTAYFVEMVKEAKMKKVV----------------
PDXT_BACCZ      DRMVAVRQGPFLAASFHPELT-DDHRVTAYFVEMVKEAKMKKVV----------------
PDXT_BACC1      DRMVAVRQGPFLAASFHPELT-DDHRVTAYFVEMVKEAKMKKVV----------------
PDXT_BACCR      DRMVAVRQNQFLAASFHPELT-DDHRVTAYFVEMVKEAKMKKVV----------------
PDXT_GEOSE      DRIVAARQGQFLGCSFHPELT-DDHRLXQYFLNXVKEAKXASSLK---------------
PDXT_GEOKA      DRIVAARQGQFLGCSFHPELT-DDHRLMQYFLNMVKEAKMASSLK---------------
PDXT_BACSU      GRIVAAKQGQFLGCSFHPELT-EDHRVTQLFVEMVEEYKQKALV----------------
PDXT_BACLD      GRIVAAKQGNLLGCSFHPELT-DDHRMTKLFVEMVEKHKREAVV----------------
PDXT_BACCI      GQIVAARQGHLLAASFHPELT-DDSSMHAYFLDMIREAR---------------------
PDXT_BACHD      DEIVVARQGHLLGCSFHPELT-DDRRFHQYFVQMVKEAKTIAQS----------------
PDXT_STAAC      EKIVAVQQGKYLGVSFHPELT-DDYRVTDYFINHIVKKA---------------------
PDXT_STAAM      EKIVAVQQGKYLGVSFHPELT-DDYRVTDYFINHIVKKA---------------------
PDXT_STAAN      EKIVAVQQGKYLGVSFHPELT-DDYRVTDYFINHIVKKA---------------------
PDXT_STAAR      EKIVAVQQGKYLGVSFHPELT-DDYRVTDYFINHIVKKA---------------------
PDXT_STAAS      EKIVAVQQGKYLGVSFHPELT-DDYRVTDYFINHIVKKA---------------------
PDXT_STAAW      EKIVAVQQGKYLGVSFHPELT-DDYRVTDYFINHIVKKA---------------------
PDXT_STAES      GKIVAVKQGQYLGVSFHPELT-DDYRITKYFIEHMIKH----------------------
PDXT_STAEQ      GKIVAVKQGQYLGVSFHPELT-DDYRITKYFIEHMIKH----------------------
PDXT_OENOB      QHIVACRQGRFLACAFHPELT-GDTRFHEYFVKITKENK---------------------
PDXT_BACSK      GEIVAVKQGSFLACSFHPELT-DDARLHQAFIKMVAERSVLEAH----------------
PDXT_LISMF      NRIVAAKQANILVTAFHPELT-NDNRWMNYFLEKMV------------------------
PDXT_LISMO      NRIVAAKQANILVTAFHPELT-NDNRWMNYFLEKMV------------------------
PDXT_LISIN      NRIVAAKQANILVTAFHPELT-NDNRLMKYFLEKMV------------------------
PDXT_LISW6      DKIVAAKEANILVTAFHPELT-NDNRFMRFFIEKMV------------------------
PDXT_OCEIH      DKIVAARQKNVLVCAFHPELT-DDDRFLEMFLTMISSNKNFNHV----------------
PDXT_CLOAB      KNIVAAKSNNVLVTSFHPELA-DNLEFHEYFMKL--------------------------
PDXT_CALS4      GKIVAAQQDNLLATAFHPELT-DDLSFYRYFLRLNS------------------------
PDXT_SYNAS      DYIVAAENDRVLVTVFHPELT-PCIVFHKHFVHKCGICCTPEDDLADSDAQWNSRSWMRL
PDXT_BIFAA      GNVVGLRQGKILATAFHPELT-DDTRIHELFLSL--------------------------
PDXT_BIFLO      GHVVGLRQGNILATAFHPELT-DDTRIHELFLSL--------------------------
PDXT_STRP2      NQIVAAQEKNMLVSSFHPELT-DDVRLHQYFINMCKEKS---------------------
PDXT_STRR6      NQIVAAQEKNMLVSSFHPELT-DDVRLHQYFINMCKEKS---------------------
PDXT_STRPN      NQIVAAQEKNMLVSSFHPELT-DDVRLHQYFINMCKEKS---------------------
PDXT_HAEIN      NKIVAAQEKNMLVTSFHPELT-NNLSLHKYFIDICKVA----------------------
PDXT_METLZ      GVVVAAREDNQLVLSFHPELG-EDTFVHQYFLEMIAGTN---------------------
PDXT_FRATH      NSPVLLRQANILVSSFHPELT-QDPTVHEYFLAM--------------------------
PDXT_FRATO      NSPVLLRQANILVSSFHPELT-QDPTVHEYFLAM--------------------------
PDXT_FRAT1      NSPVLLRQANILVSSFHPELT-QDPTIHEYFLAM--------------------------
PDXT_FRATW      NSPVLLRQANILVSSFHPELT-QDPTIHEYFLAM--------------------------
PDXT_FRATT      NSPVLLRQANILVSSFHPELT-QDPTIHEYFLAM--------------------------
PDXT_FRATN      DSPVLLRQANILVSSFHPELT-QDPTIHEYFLAM--------------------------
PDXT_PARUW      GEPILVRQGHHLGASFHPELT-VNPSIHLYFLEMVKENLENHKK----------------
PDXT_SOLUE      GDPVLIEQGRFLVATFHPELT-DDARVHSLFLSKL-------------------------
PDXT_THEAC      GKPVIVKQGNVIGMTFHPELT-GDTRLHEYFINMVRGRGGYISTADVKR-----------
PDXT_THEVO      GYPVMVRSGNILGMTFHPELT-GDVSIHEYFLSM--GGGGYISTATG-------------
PDXT_PICTO      GKPVIVENENAIAMTFHPELT-GDLRVHEYFLRKVMGN----------------------
PDXT_THEMA      YDPVLVKEGNILACTFHPELT-DDLRLHRYFLEMVK------------------------
PDXT_METST      DKIIAVKQNQYIGIAFHPELTED-TLIHKLFILEVESCVV--------------------
PDXT_METTH      DMIIAVKDGCNLALAFHPELGED-TGLHEYFIKEVLNCVE--------------------
PDXT_METJA      DKIVGVKQGKYMALSFHPELSEDGYKVYKYFVENCVKK----------------------
PDXT_METMP      ENIVGIKEGNIMAISFHPELSDDGVIAYEYFLKNFVEKR---------------------
                               ****                                         

PDXT_PYRIL      ----
PDXT_PYRAE      ----
PDXT_PYRCJ      ----
PDXT_HYPBU      ----
PDXT_STAMF      ----
PDXT_AERPE      ----
PDXT_SACS2      ----
PDXT_SULTO      ----
PDXT_METAC      ----
PDXT_METMA      ----
PDXT_METAR      ----
PDXT_ARCFU      ----
PDXT_PYRAB      ----
PDXT_THEKO      ----
PDXT_PYRFU      ----
PDXT_PYRHO      ----
PDXT_METKA      ----
PDXT_HALMA      ----
PDXT_HALSA      ----
PDXT_METTP      ----
PDXT_METMJ      ----
PDXT_CENSY      ----
PDXT_ACIC1      ----
PDXT_NOCSJ      ----
PDXT_MYCBP      ----
PDXT_MYCBO      ----
PDXT_MYCTU      ----
PDXT_MYCA1      ----
PDXT_MYCLE      ----
PDXT_MYCUA      ----
PDXT_MYCSK      ----
PDXT_MYCSS      ----
PDXT_MYCSJ      ----
PDXT_MYCVP      ----
PDXT_FRAAA      ----
PDXT_NOCFA      ----
PDXT_SACEN      ----
PDXT_STRAW      ----
PDXT_STRCO      ----
PDXT_PAEAT      ----
PDXT_ARTS2      ----
PDXT_LEIXX      ----
PDXT_CORGB      ----
PDXT_CORGL      ----
PDXT_CORDI      ----
PDXT_CUTAK      ----
PDXT_TROW8      ----
PDXT_TROWT      ----
PDXT_THET2      ----
PDXT_THET8      ----
PDXT_DEIRA      ----
PDXT_ACTP2      ----
PDXT_HAEDU      ----
PDXT_PASMU      ----
PDXT_BACAH      ----
PDXT_BACHK      ----
PDXT_BACAN      ----
PDXT_BACCZ      ----
PDXT_BACC1      ----
PDXT_BACCR      ----
PDXT_GEOSE      ----
PDXT_GEOKA      ----
PDXT_BACSU      ----
PDXT_BACLD      ----
PDXT_BACCI      ----
PDXT_BACHD      ----
PDXT_STAAC      ----
PDXT_STAAM      ----
PDXT_STAAN      ----
PDXT_STAAR      ----
PDXT_STAAS      ----
PDXT_STAAW      ----
PDXT_STAES      ----
PDXT_STAEQ      ----
PDXT_OENOB      ----
PDXT_BACSK      ----
PDXT_LISMF      ----
PDXT_LISMO      ----
PDXT_LISIN      ----
PDXT_LISW6      ----
PDXT_OCEIH      ----
PDXT_CLOAB      ----
PDXT_CALS4      ----
PDXT_SYNAS      APHV
PDXT_BIFAA      ----
PDXT_BIFLO      ----
PDXT_STRP2      ----
PDXT_STRR6      ----
PDXT_STRPN      ----
PDXT_HAEIN      ----
PDXT_METLZ      ----
PDXT_FRATH      ----
PDXT_FRATO      ----
PDXT_FRAT1      ----
PDXT_FRATW      ----
PDXT_FRATT      ----
PDXT_FRATN      ----
PDXT_PARUW      ----
PDXT_SOLUE      ----
PDXT_THEAC      ----
PDXT_THEVO      ----
PDXT_PICTO      ----
PDXT_THEMA      ----
PDXT_METST      ----
PDXT_METTH      ----
PDXT_METJA      ----
PDXT_METMP      ----