CLUSTAL format seed alignment for MF_01621

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

FADB_ECO55      MLYKGDTLYLDWLEDGIAELVFDAPG-SVNKLDTATVASLGEAIGVLEQQSDLKGLLLRS
FADB_ECOLC      MLYKGDTLYLDWLEDGIAELVFDAPG-SVNKLDTATVASLGEAIGVLEQQSDLKGLLLRS
FADB_ECO8A      MLYKGDTLYLDWLEDGIAELVFDAPG-SVNKLDTATVASLGEAIGVLEQQSDLKGLLLRS
FADB_SHIB3      MLYKGDTLYLDWLEDGIAELVFDAPG-SVNKLDTATVASLGEAIGVLEQQSDLKGLLLRS
FADB_ECODH      MLYKGDTLYLDWLEDGIAELVFDAPG-SVNKLDTATVASLGEAIGVLEQQSDLKGLLLRS
FADB_ECOLI      MLYKGDTLYLDWLEDGIAELVFDAPG-SVNKLDTATVASLGEAIGVLEQQSDLKGLLLRS
FADB_SHISS      MLYKGDTLYLDWLEDGIAELVFDAPG-SVNKLDTATVASLGEAIGVLEQQSDLKGLLLRS
FADB_ECOSE      MLYKGDTLYLDWLEDGIAELVFDAPG-SVNKLDTATVASLGEAIGVLEQQSDLKGLLLRS
FADB_ECO24      MLYKGDTLYLDWLEDGIAELVFDAPG-SVNKLDTATVASLGEAIGVLEQQSDLKGLLLRS
FADB_ESCF3      MLYKGDTLYLDWLEDGIAELVFDAPG-SVNKLDTATVASLGEAIGVLEQQSDLKGLLLRS
FADB_ECO57      MLYKGDTLYLDWLEDGIAELVFDAPG-SVNKLDTATVASLGEAIGVLEQQSDLKGLLLRS
FADB_ECO5E      MLYKGDTLYLDWLEDGIAELVFDAPG-SVNKLDTATVASLGEAIGVLEQQSDLKGLLLRS
FADB_SHIDS      MLYKGDTLYLDWLEDGIAELVFDAPS-SVNKLDTATVASLGEAIGVLEQQSDLKGLLLRS
FADB_ECOSM      MLYKGDTLYLDWLEDGIAELVFDAPG-SVNKLDTATVASLGEAIGVLEQQSDLKGLLLRS
FADB_SHIFL      MLYKGDTLYLDWLEDGIAELVFDAPG-SVNKLDTATVASLGEAIGVLEQQSDLKGLLLRS
FADB_SHIF8      MLYKGDTLYLDWLEDGIAELVFDAPG-SVNKLDTATVASLGEAIGVLEQQSDLKGLLLRS
FADB_ECOHS      MLYKGDTLYLDWLEDGIAELVFDAPG-SVNKLDTATVASLGEAIGVLEQQSDLKGLLLRS
FADB_ECOUT      MLYKGDTLYLDWLEDGIAELVFDTPG-SVNKLDTATVASLGEAIGVLEQQSDLKGLLLRS
FADB_ECO45      MLYKGDTLYLDWLEDGIAELVFDTPG-SVNKLDTATVASLGEAIGVLEQQSDLKGLLLRS
FADB_ECO81      MLYKGDTLYLDWLEDGIAELVFDAPG-SVNKLDTATVASLGEAIGVLEQQSDLKGLLLRS
FADB_ECOL6      MLYKGDTLYLDWLEDGIAELVFDAPG-SVNKLDTATVASLGEAIGVLEQQSDLKGLLLRS
FADB_ECOL5      MLYKGDTLYLDWLEDGIAELVFDAPG-SVNKLDTATVASLGEAIGVLEQQSDLKGLLLRS
FADB_ECO27      MLYKGDTLYLDWLEDGIAELVFDAPG-SVNKLDTATVASLGEAIGVLEQQSDLKGLLLRS
FADB_ECOLU      MLYKGDTLYLDWLEDGIAELVFDAPG-SVNKLDTATVASLGEAIGVLEQQSDLKGLLLRS
FADB_ECO7I      MLYKGDTLYLDWLEDGIAELVFDAPG-SVNKLDTATVASLGEAIGVLEQQSDLKGLLLRS
FADB_SALG2      MLYKGDTLYLDWLEDGIAELVFDAPG-SVNKLDTATVASLGQALEVLEKQHDLKGLLLRS
FADB_SALTI      MLYKGDTLYLDWLEDGIAELVFDAPG-SVNKLDTATVASLGQALEVLEKQHDLKGLLLRS
FADB_SALEP      MLYKGDTLYLDWLEDGIAELVFDAPG-SVNKLDTATVASLGQALEVLEKQHDLKGLLLRS
FADB_SALA4      MLYKGDTLYLDWLEDGIAELVFDAPG-SVNKLDTATVASLGQALEVLEKQHDLKGLLLRS
FADB_SALCH      MLYKGDTLYLDWLEDGIAELVFDAPG-SVNKLDTATVASLGQALEVLEKQHDLKGLLLRS
FADB_SALPB      MLYKGDTLYLDWLEDGIAELVFDAPG-SVNKLDTATVASLGQALEVLEKQHDLKGLLLRS
FADB_SALNS      MLYKGDTLYLDWLEDGIAELVFDAPG-SVNKLDTATVASLGQALEVLEKQHDLKGLLLRS
FADB_SALTY      MLYKGDTLYLDWLEDGIAELVFDAPG-SVNKLDTATVASLGQALEVLEKQHDLKGLLLRS
FADB_SALPA      MLYKGDTLYLDWLEDGIAELVFDAPG-SVNKLDTATVASLGQALEVLEKQHDLKGLLLRS
FADB_SALPK      MLYKGDTLYLDWLEDGIAELVFDAPG-SVNKLDTATVASLGQALEVLEKQHDLKGLLLRS
FADB_SALSV      MLYKGDTLYLDWLEDGIAELVFDAPG-SVNKLDTATVASLGQALEVLEKQHDLKGLLLRS
FADB_CITK8      MLYKGDTLYLDWLEDGIAELVFDAPG-SVNKLDTATVASLGQALDVLEKQTDLKGLLLRS
FADB_ENTCL      MLYKGDTLYLNWLEDGIAELVFDAPG-SVNKLDTATVASLGQALDVLEKQPELKGMLLRS
FADB_ENT38      MLYKGDTLYVDWLEDGIAELVFDAPG-SVNKLDTATVASLGHALDVLEKQSDLKGLLLRS
FADB_KLEP3      MLYKGDTLYLDWLEDGIAELVFDAPG-SVNKLDTATVASLGHALDVLEKQNDLKGLLLRS
FADB_KLEP7      MLYKGDTLYLDWLEDGIAELVFDAPG-SVNKLDTATVASLGHALDVLEKQSDLKGLLLRS
FADB_CROS8      MLYKGDTLYLNWLEDGIAELVFDAPG-SVNKLDTATVASLGHALDVLEKQHDLKALLLRS
FADB_PECAS      MLYQGESLYLNWLEDGIAELVFSAPG-SVNTLDTRTVASLGKALDVLAEQPNLKGLLLRS
FADB_YERPE      MLYQSETLQLHWLENGIAELVFDAPG-SVNKLDTKTVANLGEALNVLEKQSELKGLLLRS
FADB_YERPY      MLYQSETLQLHWLENGIAELVFDAPG-SVNKLDTKTVANLGEALNVLEKQSELKGLLLRS
FADB_YERPP      MLYQSETLQLHWLENGIAELVFDAPG-SVNKLDTKTVANLGEALNVLEKQSELKGLLLRS
FADB_YERPG      MLYQSETLQLHWLENGIAELVFDAPG-SVNKLDTKTVANLGEALNVLEKQSELKGLLLRS
FADB_YERPA      MLYQSETLQLHWLENGIAELVFDAPG-SVNKLDTKTVANLGEALNVLEKQSELKGLLLRS
FADB_YERPN      MLYQSETLQLHWLENGIAELVFDAPG-SVNKLDTKTVANLGEALNVLEKQSELKGLLLRS
FADB_YERPS      MLYQSETLQLHWLENGIAELVFDAPG-SVNKLDTKTVANLGEALNVLEKQSELKGLLLRS
FADB_YERPB      MLYQSETLQLHWLENGIAELVFDAPG-SVNKLDTKTVANLGEALNVLEKQSELKGLLLRS
FADB_YERP3      MLYQSETLQLHWLENGIAELVFDAPG-SVNKLDTKTVANLGEALNVLEKQSELKGLLLRS
FADB_YERE8      MLYQSETLQLHWLENGIAELVFDAPG-SVNKLDTQTVANLGEALVVLEKQSELKGLLLRS
FADB_SERP5      MLYQGETLQLHWLDNGIAELVFNAPG-SVNKLDTRTVASLGEALAVLEKQTELKGLLLRS
FADB_PHOLL      MLYQSETIQVSWLKDGIAELVFNAPA-AINKLDTKTVASLDKAIASLEQQTGLKGVLLRS
FADB_ALIF1      MIYQGENLSVDYIEPGIAHLVFNAKG-SVNKLNLATLQSVGEAIDALYSQKDLQGLLLSS
FADB_ALIFM      MIYQGENLSVDYIEPGIAHLVFNAKG-SVNKLNLATLQSVGEAIDALYSQKDLQGLLLSS
FADB_ALISL      MIYQGENLSVDYIENGIAHLVFNAAG-SVNKLNIATLRSLGEAIDVLYKQKDLQALLLSS
FADB_PHOPR      MIYQGETLSVRYLDDGIAELNLNAPG-AVNKFDLKTLECLNEALNALYQQSDLKGLLITS
FADB_VIBCH      MIYQAKTLQVKQLANGIAELSFCAPA-SVNKLDLHTLESLDKALDALAADSSVKGLLLSS
FADB_VIBCM      MIYQAKTLQVKQLANGIAELSFCAPA-SVNKLDLHTLESLDKALDALAADSSVKGLLLSS
FADB_VIBC3      MIYQAKTLQVKQLANGIAELSFCAPA-SVNKLDLHTLESLDKALDALAADSSVKGLLLSS
FADB_VIBCB      MIYQAETLQVKEVQDGIAELSFCSPK-SVNKLDLATLESLDKALDALKAHQGLKGLMLTS
FADB_VIBPA      MIYQADTLQVKEIQDGIAELSFCSPK-SVNKLDLATLESLDKALDALTSHQGLKGLMLTS
FADB_VIBVU      MIYQAETLQVKEVQDGVAEILFCAPN-SVNKLDLATLASLDKALDALTAHSGLKGVMLTS
FADB_VIBVY      MIYQAETLQVKEVQDGVAEILFCAQN-SVNKLDLATLASLDKALDALTAHSGLKGVMLTS
FADB_VIBTL      MIYQANTLQVKELQDGIAELSFCAPA-SVNKLDLATLESLDKALDALNAHAGLRGLILTS
FADB_AERHH      MIYQGETLTVSYLEDGIAELRFDAPG-SVNKLDRATLLSLSEAIAALQQERELKGLILTS
FADB_AERS4      MIYQGETLSVSYLENGIAELRFDAPG-SVNKLDRATLLSLSEAIAALQQQADLKGLILTS
FADB_SHEB8      MIYQSPTIQVELLEDNIAKLCFNAPG-SVNKFDRETLASLDAALDSIKQDSNIKALVLTS
FADB_SHEB2      MIYQSPTIQVELLEDNIAKLCFNAPG-SVNKFDRETLASLDAALDSIKQDSNIKALVLTS
FADB_SHEB9      MIYQSPTIQVELLEDNIAKLCFNAPG-SVNKFDRETLASLDAALDSIKQDSNIKALVLTS
FADB_SHEB5      MIYQSPTIQVELLEDNIAKLCFNAPG-SVNKFDRETLTSLDAALDSIKQDSNIKALVLTS
FADB_SHEPC      MIYQSPTIQVELLEDNIAKLCFNAPG-SVNKFDRETLASLDAALDSIKQNSNIKALVLTS
FADB_SHESW      MIYQSPTIQVELLEDNIAKLCFNAPG-SVNKFDRETLASLDAALDSIKQNSNIKALVLTS
FADB_SHESA      MIYQSPTIQVELLEDNIAKLCFNAPG-SVNKFDRETLASLDAALDSIKQQSNIQALVLTS
FADB_SHESR      MIYQSPTIQVELLEDNIAKLCFNAPG-SVNKFDRETLASLDAALDSIKQQSNIQALVLTS
FADB_SHESM      MIYQSPTIQVELLEDNIAKLCFNAPG-SVNKFDRETLASLDAALDSIKQQSNIQALVLTS
FADB_SHEON      MIYQSPTIQVELLEDNIAKLCFNAPG-SVNKFDRETLASLDAALDSIKQQSNIQALVLTS
FADB_SHEFN      MIYQSPTIQVELLEDNIAKLCFNAQG-SVNKFDRETIASLDAALDSIKQNTNIKALLLTS
FADB_SHEHH      MIYQSPTIEVELLEDNIAHLCFKAQG-SVNKFDRETIDSLNAALDSIKQDTSIKALMLSS
FADB_SHEPA      MIYQSPTIEVELLEDNIAHLCFKAQG-SVNKFDRETIDSLNAALDSIKQDSSIKALMLSS
FADB_SHEPW      MIYQSPTIEVELLEDNIAHLCFNAQG-SVNKFDRETIDSLNAALDSIKQNNSIKGLMLTS
FADB_SHESH      MIYQSPTIQVELLEDNIARLCFNASG-SVNKLDRETINSLDAALDAIQQDSHIQALVLTS
FADB_SHEWM      MIYQSPTIQVELLEDNIARLCFNAAG-SVNKLDRETIDSLNAALDAIKQDTNIQGLVLTS
FADB_SHEAM      MIYQSPTIQVELTADKIARLCFNAPG-SVNKFDRETLASLNAALDVLK-DSDAKAAVLTS
FADB_SHELP      MIYQSPTIQVELLEDNIARLCFNAEG-SVNKFDRETLNSLNDALDALAQTQGVKGLMLTS
FADB_COLP3      MIYQGKSLSAQLLEDGIVEFKFDAQG-SVNKFDQATFEEYIAVVAAINNCSEAKGVIVTS
FADB_IDILO      MIYQGESIRVDFIEPGFAELQFDAKG-SVNKFDQATLEEFSEALTKLQNTDDLRGVIVTS
FADB_PSEF5      MIYEGKAITVKALESGIVELNFDLKGESVNKFNRLTLNELRQAVDTIKADASIKGVIVSS
FADB_PSEPF      MIYEGKAITVKALESGIVELKFDLKGESVNKFNRLTLNELRQAVDTIKADASIKGVIVSS
FADB_PSEFR      MIYEGKAITVTALESGIVELKFDLKGESVNKFNRLTLNELRQAVDAIKADASVKGVIVSS
FADB_PSEP1      MIYEGKAITVKALESGIVELKFDLKGESVNKFNRLTLNELRQAVDAIRADASVKGVIVSS
FADB_PSEPK      MIYEGKAITVKALESGIVELKFDLKGESVNKFNRLTLNELRQAVDAIRADASVKGVIVRS
FADB_PSEPG      MIYEGKAITVKALESGIVELKFDLKGESVNKFNRLTLNELRQAVEAIQADASVKGVIVSS
FADB_PSEPW      MIYEGKAITVKALESGIVELKFDLKGESVNKFNRLTLDELRQAVEAIKADASVKGVIVSS
FADB_PSEPU      MIYEGKAITVKALESGIVELKFDLKGESVNKFNRLTLNELRQAVDAIKADASVKGVIVSS
FADB_PSEOL      MIYQGKAITVKALESGIVELKFDLKGESVNKFNRLTLNELRQAVDAIQADASVKGVIVSS
FADB_PSEE4      MIYEGKAITVKALESGIVELKFDLKGESVNKFNRLTLNELRQAVDAIKADASVKGVIVSS
FADB_PSE14      MIYEGKAITVKALESGIVELNFDLKGESVNKFNRLTLNELRQAVDAIKADASVKGVIVSS
FADB_PSESM      MIYEGKAITVKALESGIVELNFDLKGESVNKFNRLTLNELRQAVDAVKADASVKGVIVTS
FADB_PSEU2      MIYEGKAITVKALESGIVELNFDLKGESVNKFNRLTLNEFRQAVDAVKADASVKGVIVTS
FADB_PSEAE      MIYQGKAITVKPLEGGIVELNFDLKGESVNKFNRLTLSELRAAVDAIKADASVKGVIVTS
FADB_PSEAB      MIYQGKAITVKPLEGGIVELNFDLKGESVNKFNRLTLSELRAAVDAIKADASVKGVIVTS
FADB_PSEA8      MIYQGKAITVKPLEGGIVELNFDLKGESVNKFNRLTLSELRAAVDAIKADASVKGVIVTS
FADB_PSEA7      MIYQGKAITVKPLEGGIVELNFDLKGESVNKFNRLTLSELRAAVDAIKADAAVKGVIVTS
FADB_PSEMY      MIYEGKAITVKALESGIVELNFDLKGESVNKFNRLTLNELRASVDAIKADGSIKGVIVTS
FADB_PSEU5      MIYEGKAITVKALESGIVELNFDLKGESVNKFNRLTLNDLRQAVDAIKADASVKGVIVTS
FADB_ACIB5      MIHAGNAITVQMLADGIAEFRFDLQGESVNKFNRATIEDFKAAIAAVKANNDIKGLVVTS
FADB_ACIB3      MIHAGNAITVQMLADGIAEFRFDLQGESVNKFNRATIEDFKAAIAAVKANNDIKGLVVTS
FADB_ACIBY      MIHAGNAITVQMLADGIAEFRFDLQGESVNKFNRATIEDFKAAIAAVKANNDIKGLVVTS
FADB_ACIBC      MIHAGNAITVQMLADGIAEFRFDLQGESVNKFNRATIEDFKAAIAAVKANNDIKGLVVTS
FADB_ACIBS      MIHAGNAITVQMLADGIAEFRFDLQGESVNKFNRATIEDFKAAIAAVKANNDIKGLVVTS
FADB_ACIAD      MIHAGNAITVQMLSDGIAEFRFDLQGESVNKFNRATIEDFQAAIEAVKNHPEVKGLIVTS
FADB_PSYA2      MVYQGNRITVTMLEDGIANMQYNAENESVNKFDTETNKQFAEVVNALEKADDVKGLIVTS
FADB_PSYCK      MVYQGNRITVTMLEDGIANMQYNAENESVNKFDTETNKQFAEVVNALEKADDIKGLIVTS
FADB_PSYWF      MIYQGNRITVSLLDDGIANMQFNAEGESVNKFDAETNKQFDEAVSALEKADNVKGLIVTS
                *:: .  :        ...:       ::*.::  *       :  :      :. :: *

FADB_ECO55      NKAAFIVGADITEFLSLFLVPEEQLSQWLHFANSVFNRLEDLPVPTIAAVNGYALGGGCE
FADB_ECOLC      NKAAFIVGADITEFLSLFLVPEEQLSQWLHFANSVFNRLEDLPVPTIAAVNGYALGGGCE
FADB_ECO8A      NKAAFIVGADITEFLSLFLVPEEQLSQWLHFANSVFNRLEDLPVPTIAAVNGYALGGGCE
FADB_SHIB3      NKAAFIVGADITEFLSLFLVPEEQLSQWLHFANSVFNRLEDLPVPTIAAVNGYALGGGCE
FADB_ECODH      NKAAFIVGADITEFLSLFLVPEEQLSQWLHFANSVFNRLEDLPVPTIAAVNGYALGGGCE
FADB_ECOLI      NKAAFIVGADITEFLSLFLVPEEQLSQWLHFANSVFNRLEDLPVPTIAAVNGYALGGGCE
FADB_SHISS      NKAAFIVGADITEFLSLFLVPEEQLSQWLHFANSVFNRLEDLPVPTIAAVNGYALGGGCE
FADB_ECOSE      NKAAFIVGADITEFLSLFLVPEEQLSQWLHFANSVFNRLEDLPVPTIAAANGYALGGGCE
FADB_ECO24      NKAAFIVGADITEFLSLFLVPEEQLSQWLQFANSVFNRLEDLPVPTIAAVNGYALGGGCE
FADB_ESCF3      NKAAFIVGADITEFLSLFLVPEEQLSQWLHFANSVFNRLEDLPVPTIAAVNGYALGGGCE
FADB_ECO57      NKAAFIVGADITEFLSLFLVPEEQLSQWLHFANSVFNRLEDLPVPTIAAVNGYALGGGCE
FADB_ECO5E      NKAAFIVGADITEFLSLFLVPEEQLSQWLHFANSVFNRLEDLPVPTIAAVNGYALGGGCE
FADB_SHIDS      NKAAFIVGADITEFLSLFLVPEEQLSQWLHFANSVFNRLEDLPVPTIAAVNGYALGGGCE
FADB_ECOSM      NKAAFIVGADITEFLSLFLVPEEQLSQWLHFANSVFNRLEDLPVPTIAAVNGYALGGGCE
FADB_SHIFL      NKAAFIVGADITEFLSLFLVPEEQLSQWLHFANSVFNRLEDLPVPTIAAVNGYALGGGCE
FADB_SHIF8      NKAAFIVGADITEFLSLFLVPEEQLSQWLHFANSVFNRLEDLPVPTIAAVNGYALGGGCE
FADB_ECOHS      NKAAFIVGADITEFLSLFLVPEEQLSQWLHFANSVFNRLEDLPVPTIAAVNGYALGGGCE
FADB_ECOUT      NKAAFIVGADITEFLSLFLVPEEQLSQWLHFANSVFNRLEDLPVPTIAAVNGYALGGGCE
FADB_ECO45      NKAAFIVGADITEFLSLFLVPEEQLSQWLHFANSVFNRLEDLPVPTIAAVNGYALGGGCE
FADB_ECO81      NKAAFIVGADITEFLSLFLVPEEQLSQWLHFANSVFNRLEDLPVPTIAAVNGYALGGGCE
FADB_ECOL6      NKAAFIVGADITEFLSLFLVPEEQLSQWLHFANSVFNRLEDLPVPTIAAVNGYALGGGCE
FADB_ECOL5      NKAAFIVGADITEFLSLFLVPEEQLSQWLHFANSVFNRLEDLPVPTIAAVNGYALGGGCE
FADB_ECO27      NKAAFIVGADITEFLSLFLVPEEQLSQWLHFANSVFNRLEDLPVPTIAAVNGYALGGGCE
FADB_ECOLU      NKAAFIVGADITEFLSLFLVPEEQLSQWLHFANSVFNRLEDLPVPTIAAVNGYALGGGCE
FADB_ECO7I      NKAAFIVGADITEFLSLFLVPEEQLSQWLHFANSVFNRLEDLPVPTIAAVNGYALGGGCE
FADB_SALG2      NKAAFIVGADITEFLSLFLVPEEQLSQWLHFANSVFNRLEDLPVPTLAAVNGYALGGGCE
FADB_SALTI      NKAAFIVGADITEFLSLFLVPEEQLSQWLHFANSVFNRLEDLPVPTLAAVNGYALGGGCE
FADB_SALEP      NKAAFIVGADITEFLSLFLVPEEQLSQWLHFANSVFNRLEDLPVPTLAAVNGYALGGGCE
FADB_SALA4      NKAAFIVGADITEFLSLFLVPEEQLSQWLHFANSVFNRLEDLPVPTLAAVNGYALGGGCE
FADB_SALCH      NKAAFIVGADITEFLSLFLVPEEQLSQWLHFANSVFNRLEDLPVPTLAAVNGYALGGGCE
FADB_SALPB      NKAAFIVGADITEFLSLFLVPEEQLSQWLHFANSVFNRLEDLPVPTLAAVNGYALGGGCE
FADB_SALNS      NKAAFIVGADITEFLSLFLVPEEQLSQWLHFANSVFNRLEDLPVPTLAAVNGYALGGGCE
FADB_SALTY      NKAAFIVGADITEFLSLFLVPEEQLSQWLHFANSVFNRLEDLPVPTLAAVNGYALGGGCE
FADB_SALPA      NKAAFIVGADITEFLSLFLVPEEQLSQWLHFANSVFNRLEDLPVPTLAAVNGYALGGGCE
FADB_SALPK      NKAAFIVGADITEFLSLFLVPEEQLSQWLHFANSVFNRLEDLPVPTLAAVNGYALGGGCE
FADB_SALSV      NKAAFIVGADITEFLSLFLVPEEQLSQWLHFANSVFNRLEDLPVPTLAAVNGYALGGGCE
FADB_CITK8      NKAAFIVGADITEFLSLFLVPEEQLSQWLHFANSVFNRLEDLPVPTLSAINGYALGGGCE
FADB_ENTCL      NKAAFIVGADITEFLSLFLVPEEQLSQWLHFANSVFNRLEDLPVPTISAVNGYALGGGCE
FADB_ENT38      EKAAFIVGADITEFLSLFQVPEEQLSQWLHFANSVFNRLEDLPVPTISAVNGYALGGGCE
FADB_KLEP3      EKAAFIVGADITEFLSLFLVPEEQLSQWLHFANSVFNRLEDLPVPTISAVNGYALGGGCE
FADB_KLEP7      EKAAFIVGADITEFLSLFLVPEEQLSQWLHFANSVFNRLEDLPVPTISAVNGYALGGGCE
FADB_CROS8      EKAAFIVGADITEFLSLFQVPAEQLSQWLHFANSVFNRLEDLPVPTLCAINGYALGGGCE
FADB_PECAS      DKPAFIVGADITEFLSLFAAPAEKLHEWLVFANSIFNRLEDLPVPTLSAINSYALGGGCE
FADB_YERPE      AKTALIVGADITEFLSLFNAPPEKLHQWLVFANTIFNRLEDLPVPTISAINGYALGGGCE
FADB_YERPY      AKTALIVGADITEFLSLFNAPPEKLHQWLVFANTIFNRLEDLPVPTISAINGYALGGGCE
FADB_YERPP      AKTALIVGADITEFLSLFNAPPEKLHQWLVFANTIFNRLEDLPVPTISAINGYALGGGCE
FADB_YERPG      AKTALIVGADITEFLSLFNAPPEKLHQWLVFANTIFNRLEDLPVPTISAINGYALGGGCE
FADB_YERPA      AKTALIVGADITEFLSLFNAPPEKLHQWLVFANTIFNRLEDLPVPTISAINGYALGGGCE
FADB_YERPN      AKTALIVGADITEFLSLFNAPPEKLHQWLVFANTIFNRLEDLPVPTISAINGYALGGGCE
FADB_YERPS      AKTALIVGADITEFLSLFNAPPEKLHQWLVFANTIFNRLEDLPVPTISAINGYALGGGCE
FADB_YERPB      AKTALIVGADITEFLSLFNAPPEKLHQWLVFANTIFNRLEDLPVPTISAINGYALGGGCE
FADB_YERP3      AKTALIVGADITEFLSLFNAPPEKLHQWLVFANTIFNRLEDLPVPTISAINGYALGGGCE
FADB_YERE8      AKAAFIVGADITEFLSLFNEPPEKLHQWLVFANDIFNRLEDLPVPTIAAINGYALGGGCE
FADB_SERP5      TKAAFIVGADITEFLSLFAAPAEKLQEWLNFANAIFNRLEDLPVPTISAINGYALGGGCE
FADB_PHOLL      EKTAFIVGADITEFLSLFDSPVEKLQEWLNFSNSIFNRIEDLPVPTISAINGYALGGGCE
FADB_ALIF1      DKSAFIVGADITEFLGLFDIPTEELSDWLHQANAIFNRLEDIPVPTLSAITGFALGGGCE
FADB_ALIFM      DKSAFIVGADITEFLGLFDIPTEELSDWLHQANAIFNRLEDIPVPTLSAITGFALGGGCE
FADB_ALISL      GKSAFIVGADITEFLGLFDTPEEELSDWLHQANVIFSRLEDLPVPTLSAITGFALGGGCE
FADB_PHOPR      DKDAFIVGADITEFLGLFAKPAEELSQWLTRANDIFNKLEDLPVPTLSAINGHALGGGCE
FADB_VIBCH      DKEAFIVGADITEFLGLFAKPEAELDEWLQFANRIFNKLEDLPFPTLSALKGHTLGGGCE
FADB_VIBCM      DKEAFIVGADITEFLGLFAKPEAELDEWLQFANRIFNKLEDLPFPTLSALKGHTLGGGCE
FADB_VIBC3      DKEAFIVGADITEFLGLFAKPEAELDEWLQFANRIFNKLEDLPFPTLSALKGHTLGGGCE
FADB_VIBCB      DKDAFIVGADITEFLGLFAKTDAELDQWLQFANSIFNKLEDLPVPTISVLKGHTLGGGCE
FADB_VIBPA      DKDAFIVGADITEFLGLFAKTDAELDQWLQFANSIFNKLEDLPVPTISVLKGHTLGGGCE
FADB_VIBVU      DKEAFIVGADITEFLGLFAKPEEELDQWLQFANSIFNKLEDLPVPTVAVVKGHTLGGGCE
FADB_VIBVY      DKEAFIVGADITEFLGLFAKPEEELDQWLQFANSIFNKLEDLPVPTVAVVKGHTLGGGCE
FADB_VIBTL      NKDAFIVGADITEFLGLFAKPEAELDEWLRFANSIFSKLEDLPVPTLSMMRGHALGGGCE
FADB_AERHH      GKDAFIVGADITEFLELFDLPQADLLGWLKKANDIFSAIEDLPVPTLSAIKGHALGGGCE
FADB_AERS4      GKDAFIVGADITEFLELFDLPQEDLLGWLKKANDIFSAIEDLPVPTLSAIKGHALGGGCE
FADB_SHEB8      SKDTFIVGADITEFLGLFAQDDAVLLSWVEQANAVFNKLEDLPFPTASAIKGFALGGGCE
FADB_SHEB2      SKDTFIVGADITEFLGLFAQDDAVLLSWVEQANAVFNKLEDLPFPTASAIKGFALGGGCE
FADB_SHEB9      SKDTFIVGADITEFLGLFAQDDAVLLSWVEQANAVFNKLEDLPFPTASAIKGFALGGGCE
FADB_SHEB5      SKDTFIVGADITEFLGLFAQDDAVLLSWVEQANAVFNKLEDLPFPTASAIKGFALGGGCE
FADB_SHEPC      SKDTFIVGADITEFLGLFAQDDAVLLSWVEQANAVFNKLEDLPFPTASAIKGFALGGGCE
FADB_SHESW      SKDTFIVGADITEFLGLFAQDDAVLLSWVEQANAVFNKLEDLPFPTASAIKGFALGGGCE
FADB_SHESA      GKDTFIVGADITEFLGLFAQDDAVLLSWIEQANAVFNKLEDLPFPTASAIKGFALGGGCE
FADB_SHESR      GKDTFIVGADITEFLGLFAQDDAVLLSWVEQANAVFNKLEDLPFPTASAIKGFALGGGCE
FADB_SHESM      GKDTFIVGADITEFLGLFAQDDAVLLSWVEQANAVFNKLEDLPFPTASAIKGFALGGGCE
FADB_SHEON      GKDTFIVGADITEFLGLFAQDDAVLLSWVEQANAVFNKLEDLPFPTASAIKGFALGGGCE
FADB_SHEFN      AKSTFIVGADITEFLTLFQQDDATLLAWVEQANAVFNKLEDLPFPTASAINGFALGGGCE
FADB_SHEHH      AKDAFIVGADITEFLGLFAEEDAVLQSWLEQANVVFNKLEDLPFPTLSAINGFALGAGCE
FADB_SHEPA      AKDAFVVGADITEFLGLFAEEDTVLQSWLEQANVVFNKLEDLPFPTISAINGFALGAGCE
FADB_SHEPW      AKPAFIVGADITEFLGLFAEEDAVLLSWLEEANVVFNKLEDLPFPTISAINGFALGAGCE
FADB_SHESH      AKGAFIVGADITEFLGLFAQEDSVLLPWIAEANVVFNKLEDLPFPTISAINGFALGGGFE
FADB_SHEWM      GKGAFIVGADITEFLGLFAQEESVLLPWIAEANVVFNKIEDLPFPTISAINGFALGGGFE
FADB_SHEAM      GKDTFIVGADITEFLALFAEEDAKLMEWIAQANVVFNKLEDLPFPTVSAIKGFALGGGCE
FADB_SHELP      GKDAFIVGADITEFLGLFAQDDNVLQGWLEDANKVFNKLEDLPFPTISAIKGFALGGGCE
FADB_COLP3      GKSTFIVGADITEFLVSFSQPEDALASWAKKASDVFDSFEDIQLPTIAAINGIALGGGCE
FADB_IDILO      SKSTFIVGADITEFLTLFSDQE-KTRSWVAKASRVFDQLEDLPVPTVGAVTGFALGGGCE
FADB_PSEF5      GKDVFIVGADITEFVDNFKLPDAELVAGNLEANKIFSDFEDLNVPTVAAINGIALGGGLE
FADB_PSEPF      GKDVFIVGADITEFVDNFKLPDAELVAGNLEANKIFSDFEDLNVPTVAAINGIALGGGLE
FADB_PSEFR      GKDVFIVGADITEFVENFKLPDAELIAGNLEANKIFSDFEDLNVPTVAAINGIALGGGLE
FADB_PSEP1      GKDVFIVGADITEFVDNFKLPEAELVAGNLEANRIFNAFEDLEVPTVAAINGIALGGGLE
FADB_PSEPK      GKDVFIVGADITEFVDNFKLPEAELVAGNLEANRIFNAFEDLEVPTVAAINGIALGGGLE
FADB_PSEPG      GKDVFIVGADITEFVDNFKLPEAELVAGNLEANRIFNAFEDLEVPTVAAINGIALGGGLE
FADB_PSEPW      GKDVFIVGADITEFVDNFKLPEAELVAGNLEANRIFNAFEDLEVPTVAAINGIALGGGLE
FADB_PSEPU      GKDVFIVGADITEFVDNFKLPEAELVAGNLEANRIFSAFEDLEVPTVAAINGIALGGGLE
FADB_PSEOL      GKDVFIVGADITEFVDNFKLPEAELVAGNLEANRIFNAFEDLEVPTVAAISGIALGGGLE
FADB_PSEE4      GKDVFIVGADITEFVDNFKLPEAELVAGNLEANRIFSDFEDLEVPTVAAINGIALGGGLE
FADB_PSE14      GKDVFIVGADITEFVDNFKLPEAELVAGNLQANRIFSDFEDLGVPTVVAINGIALGGGLE
FADB_PSESM      GKDVFIVGADITEFVDNFKLPEAELVAGNLEANRIFSDFEDLGVPTVVAINGIALGGGLE
FADB_PSEU2      GKDSFIVGADITEFVDNFKLPEAELVAGNLEANRIFSDFEDLNVPTVVAINGIALGGGLE
FADB_PSEAE      GKDVFIVGADITEFVDNFQLPDEELMAGNLEANKIFSDFEDLDVPTVAAINGIALGGGLE
FADB_PSEAB      GKDVFIVGADITEFVDNFQLPDEELMAGNLEANKIFSDFEDLDVPTVAAINGIALGGGLE
FADB_PSEA8      GKDVFIVGADITEFVDNFQLPDEELMAGNLEANKIFSDFEDLDVPTVAAINGIALGGGLE
FADB_PSEA7      GKDVFIVGADITEFVDNFQLPDEELMAGNLEANKIFSDFEDLDVPTVAAINGIALGGGLE
FADB_PSEMY      GKDVFIVGADITEFVDNFKLPDEELVAGNLEANKIFSDFEDLAVPTVVAINGIALGGGFE
FADB_PSEU5      GKDVFIVGADITEFVDNFKLPDEELVAGNLEANKIFSDFEDLGVPTVVAINGIALGGGFE
FADB_ACIB5      GKSTFIVGADITEFGQNFAQGEKAIVDWLMPVHEIFNSFEDLDLPKVAAINGMALGGGFE
FADB_ACIB3      GKSTFIVGADITEFGQNFAQGEKAIVDWLMPVHEIFNSFEDLDLPKVAAINGMALGGGFE
FADB_ACIBY      GKSTFIVGADITEFGQNFAQGEKAIVDWLMPVHEIFNSFEDLDLPKVAAINGMALGGGFE
FADB_ACIBC      GKSTFIVGADITEFGQNFAQGEKAIVDWLMPVHEIFNSFEDLDLPKVAAINGMALGGGFE
FADB_ACIBS      GKSTFIVGADITEFGQNFAQGEKAIVDWLMPVHEIFNSFEDLDLPKVAAINGIALGGGFE
FADB_ACIAD      AKSTFIVGADITEFGQNFAQGEKAIVEWALPVHDIFNSFEDLDIPKVAAINGMALGGGFE
FADB_PSYA2      SKGVFIAGADITEFVASFKQSEEEIKDWVININDAFNRFEDLPFPKVAAINGAALGGGCE
FADB_PSYCK      SKGVFIAGADITEFVASFKQSEEEIKDWVININDAFNRFEDLPFPKVAAINGAALGGGCE
FADB_PSYWF      SKGVFIAGADITEFVSHFNKEAAEIEKWIVDINGVFNRFEDLPFPKVAAINGAALGGGCE
                 *  ::.*******   *                 *. :**: .*.     . :**.* *

FADB_ECO55      CVLATDYRLATPDLRIGLPETKLGIMPGFGGSVRMPRMLGADSALEIIAAGKDVGADQAL
FADB_ECOLC      CVLATDYRLATPDLRIGLPETKLGIMPGFGGSVRMPRMLGADSALEIIAAGKDVGADQAL
FADB_ECO8A      CVLATDYRLATPDLRIGLPETKLGIMPGFGGSVRMPRMLGADSALEIIAAGKDVGADQAL
FADB_SHIB3      CVLATDYRLATPDLRIGLPETKLGIMPGFGGSVRMPRMLGADSALEIIAAGKDVGADQAL
FADB_ECODH      CVLATDYRLATPDLRIGLPETKLGIMPGFGGSVRMPRMLGADSALEIIAAGKDVGADQAL
FADB_ECOLI      CVLATDYRLATPDLRIGLPETKLGIMPGFGGSVRMPRMLGADSALEIIAAGKDVGADQAL
FADB_SHISS      CVLATDYRLATPDLRIGLPETKLGIMPGFGGSVRMPRMLGADSALEIIAAGKDVGADQAL
FADB_ECOSE      CVLATDYRLATPDLRIGLPETKLGIMPGFGGSVRMPRMLGADSALEIIAAGKDVGADQAL
FADB_ECO24      CVLATDYRLATPDLRIGLPETKLGIMPGFGGSVRMPRMLGADSALEIIAAGKDVGADQAL
FADB_ESCF3      CVLATDYRLATPDLRIGLPETKLGIMPGFGGSVRMPRMLGADSALEIIAAGKDVGADQAL
FADB_ECO57      CVLATDYRLATPDLRIGLPETKLGIMPGFGGSVRMPRMLGADSALEIIAAGKDVGADQAL
FADB_ECO5E      CVLATDYRLATPDLRIGLPETKLGIMPGFGGSVRMPRMLGADSALEIIAAGKDVGADQAL
FADB_SHIDS      CVLATDYRLATPDLRIGLPETKLGIMPGFGGSVRMPRMLGADSALEIIAAGKDVGADQAL
FADB_ECOSM      CVLATDYRLATPDLRIGLPETKLGIMPGFGGSVRMPRMLGADSALEIIAAGKDVGADQAL
FADB_SHIFL      CVLATDYRLATPDLRIGLPETKLGIMPGFGGSVRMPRMLGADSALEIIAAGKDVGADQAL
FADB_SHIF8      CVLATDYRLATPDLRIGLPETKLGIMPGFGGSVRMPRMLGADSALEIIAAGKDVGADQAL
FADB_ECOHS      CVLATDYRLATPDLRIGLPETKLGIMPGFGGSVRMPRMLGADSALEIIAAGKDVGADQAL
FADB_ECOUT      CVLATDYRLATPDLRIGLPETKLGIMPGFGGSVRMPRMLGADSALEIIAAGKDVGADQAL
FADB_ECO45      CVLATDYRLATPDLRIGLPETKLGIMPGFGGSVRMPRMLGADSALEIIAAGKDVGADQAL
FADB_ECO81      CVLATDYRLATPDLRIGLPETKLGIMPGFGGSVRMPRMLGADSALEIIAAGKDVGADQAL
FADB_ECOL6      CVLATDYRLATPDLRIGLPETKLGIMPGFGGSVRMPRMLGADSALEIIAAGKDVGADQAL
FADB_ECOL5      CVLATDYRLATPDLRIGLPETKLGIMPGFGGSVRMPRMLGADSALEIIAAGKDVGADQAL
FADB_ECO27      CVLATDYRLATPDLRIGLPETKLGIMPGFGGSVRMPRMLGADSALEIIAAGKDVGADQAL
FADB_ECOLU      CVLATDYRLATPDLRIGLPETKLGIMPGFGGSVRMPRMLGADSALEIIAAGKDVGADQAL
FADB_ECO7I      CVLATDYRLATPDLRIGLPETKLGIMPGFGGSVRMPRMLGADSALEIIAAGKDVGADQAL
FADB_SALG2      CVLATDYRLATPDLRIGLPETKLGIMPGFGGSVRLPRMLGADSALEIIAAGKDVGAEHAL
FADB_SALTI      CVLATDYRLATPDLRIGLPETKLGIMPGFGGSVRLPRMLGADSALEIIAAGKDVGAEHAL
FADB_SALEP      CVLATDYRLATPDLRIGLPETKLGIMPGFGGSVRLPRMLGADSALEIIAAGKDVGAEHAL
FADB_SALA4      CVLATDYRLATPDLRIGLPETKLGIMPGFGGSVRLPRMLGADSALEIIAAGKDVGAEHAL
FADB_SALCH      CVLATDYRLATPDLRIGLPETKLGIMPGFGGSVRLPRMLGADSALEIIAAGKDVGAEHAL
FADB_SALPB      CVLATDYRLATPDLRIGLPETKLGIMPGFGGSVRLPRMLGADSALEIIAAGKDVGAEHAL
FADB_SALNS      CVLATDYRLATPDLRIGLPETKLGIMPGFGGSVRLPRMLGADSALEIIAAGKDVGAEHAL
FADB_SALTY      CVLATDYRLATPDLRIGLPETKLGIMPGFGGSVRLPRMLGADSALEIIAAGKDVGAEHAL
FADB_SALPA      CVLATDYRLATPDLRIGLPETKLGIMPGFGGSVRLPRMLGADSALEIIAAGKDVGAEHAL
FADB_SALPK      CVLATDYRLATPDLRIGLPETKLGIMPGFGGSVRLPRMLGADSALEIIAAGKDVGAEHAL
FADB_SALSV      CVLATDYRLATPDLRIGLPETKLGIMPGFGGSVRMPRMLGADSALEIIAAGKDIGAEQAL
FADB_CITK8      CVLATDYRLVTPDLRIGLPETKLGIMPGFGGSVRMPRMLGADSALEIIAAGKDIGAEQAL
FADB_ENTCL      CVLATDYRLATPDLRIGLPETRLGIMPGFGGSVRMPRMLGADSAMEIIAAGKDVGAEQAQ
FADB_ENT38      CVLATDYRLATPDLRIGLPETKLGIMPGFGGSVRMPRMLGADSALEIIAAGKDVGADQAL
FADB_KLEP3      CVLATDYRLATPDLRIGLPETKLGIMPGFGGSVRLPRLLGADSALEIIAAGKDVGADQAL
FADB_KLEP7      CVLATDYRLATPDLRIGLPETKLGIMPGFGGSVRLPRLLGADSALEIIAAGKDVGADQAL
FADB_CROS8      CVLATDFRLATPDARIGLPETKLGIMPGFGGSVRLPRLLGADSALEIIAAGKDITADAAL
FADB_PECAS      CVLATDFRLATPDARIGLPETKLGIMPGFGGTVRLPRLLGADSALEIIAAGKDVSAADAL
FADB_YERPE      CILATDFRIASPEARIGLPETKLGIMPGFGGSVRLPRLLGADSALEIIATGKDVTANDAL
FADB_YERPY      CILATDFRIASPEARIGLPETKLGIMPGFGGSVRLPRLLGADSALEIIATGKDVTANDAL
FADB_YERPP      CILATDFRIASPEARIGLPETKLGIMPGFGGSVRLPRLLGADSALEIIATGKDVTANDAL
FADB_YERPG      CILATDFRIASPEARIGLPETKLGIMPGFGGSVRLPRLLGADSALEIIATGKDVTANDAL
FADB_YERPA      CILATDFRIASPEARIGLPETKLGIMPGFGGSVRLPRLLGADSALEIIATGKDVTANDAL
FADB_YERPN      CILATDFRIASPEARIGLPETKLGIMPGFGGSVRLPRLLGADSALEIIATGKDVTANDAL
FADB_YERPS      CILATDFRIASPEARIGLPETKLGIMPGFGGSVRLPRLLGADSALEIIATGKDVTANDAL
FADB_YERPB      CILATDFRIASPEARIGLPETKLGIMPGFGGSVRLPRLLGADSALEIIATGKDVTANDAL
FADB_YERP3      CILATDFRIASPEARIGLPETKLGIMPGFGGSVRLPRLLGADSALEIIATGKDVTANDAL
FADB_YERE8      CILATDFRVASPEARIGLPETKLGIMPGFGGSVRLPRLLGADSALEIIAAGKDIIAKDAL
FADB_SERP5      CILATDFRVASPDARIGLPETKLGIMPGFGGSVRLPRLLGNDSALEIIAAGKDVSAKDAL
FADB_PHOLL      CVLSTDFRVASPDIRIGLPETKLGIMPGFGGSVRLPRLIGTDNALDIIAAGKDIGAEEAL
FADB_ALIF1      CVLATDFRLADETASIGLPETQLGIMPGWGGSVRLPRLIGADPAMEVITTGKPKRAKDAL
FADB_ALIFM      CVLATDFRLADETASIGLPETQLGIMPGWGGSVRLPRLIGADPAMEVITTGKPKRAKDAL
FADB_ALISL      CVLATDFRLADDTASIGLPETQLGIMPGWGGSVRLPRLIGADPAMEVITTGKPKRAKDAL
FADB_PHOPR      CVLATDFRLADITARIGLPETRLGIMPGFGGTVRLPRLLGADSAMEIITAGKDKKAQDAL
FADB_VIBCH      CVLATDFRIGDATTSIGLPETKLGIMPGFGGTVRLPRLIGADSAMEIITQGKACRAEEAL
FADB_VIBCM      CVLATDFRIGDATTSIGLPETKLGIMPGFGGTVRLPRLIGADSAMEIITQGKACRAEEAL
FADB_VIBC3      CVLATDFRIGDATTSIGLPETKLGIMPGFGGTVRLPRLIGADSAMEIITQGKACRAEEAL
FADB_VIBCB      CVLATDMRIGDKTTSIGLPETKLGIMPGFGGCVRLPRVIGADSAMEVITQGKACRADEAL
FADB_VIBPA      CVLATDMRIGDKTTSIGLPETKLGIMPGFGGCVRLPRVIGADSAMEIITQGKACRADEAL
FADB_VIBVU      CVLATDLRIGDKTTSIGLPETKLGIMPGFGGCVRLPRVIGADSAMEIITQGKACRAEEAL
FADB_VIBVY      CVLATDLRIGDKTTSIGLPETKLGIMPGFGGCVRLPRVIGADSAMEIITQGKACRAEEAL
FADB_VIBTL      CVLATDFRIGDKTTSIGLPETKLGIMPGFGGCVRLPRVIGADSAMEIITQGKACRADEAL
FADB_AERHH      TILSTDFRLADTSAKIGLPETKLGIMPGFGGTVRLPRVIGADNALEWITTGKDYRADDAL
FADB_AERS4      TILSTDFRLADTSAKIGLPETKLGIMPGFGGTVRLPRVIGADNALEWITTGKDYRADDAL
FADB_SHEB8      TILATDFRIADTTAKIGLPETKLGIIPGFGGTVRLPRVIGADNALEWITTGKDQRAEDAL
FADB_SHEB2      TILTTDFRIADTTAKIGLPETKLGIIPGFGGTVRLPRVIGADNALEWITTGKDQRAEDAL
FADB_SHEB9      TILATDFRVADTTAKIGLPETKLGIIPGFGGTVRLPRVIGADNALEWITTGKDQRAEDAL
FADB_SHEB5      TILATDFRIADTTAKIGLPETKLGIIPGFGGTVRLPRVIGADNALEWITTGKDQRAEDAL
FADB_SHEPC      TILATDFRIADTTAKIGLPETKLGIIPGFGGTVRLPRVIGADNALEWISTGNDQRAEDAL
FADB_SHESW      TILATDFRIADTTAKIGLPETKLGIIPGFGGTVRLPRVIGADNALEWISTGNDQRAEDAL
FADB_SHESA      TILATDFRIADTTAKIGLPETKLGIIPGFGGTVRLPRVIGADNALEWITTGKDQRPEDAL
FADB_SHESR      TILATDFRIADTTAKIGLPETKLGIIPGFGGTVRLPRVIGADNALEWITTGKDQRPEDAL
FADB_SHESM      AILATDFRIADTTAKIGLPETKLGIIPGFGGTVRLPRVIGADNALEWITTGKDQRPEDAL
FADB_SHEON      TILATDFRIADTTAKIGLPETKLGIIPGFGGTVRLPRVIGADNALEWITTGNEQRAEDAL
FADB_SHEFN      TILATDLRVADTNARIGLPETKLGLIPGFGGTVRLPRVIGADNALEWITTAKDQRPEDAL
FADB_SHEHH      TILATDFRIADTTARIGLPETKLGIIPGFGGTVRLPRVIGADNALEWITSGKDQRPDAAL
FADB_SHEPA      TILATDFRIADTTARIGLPETKLGIIPGFGGTVRLPRVIGADNALEWITSGKDQRPEAAL
FADB_SHEPW      TILATDFRVADTTARIGLPETKLGIIPGFGGTVRLPRVVGTDNALEWITSGKDQRPEAAL
FADB_SHESH      TVLATDFRIADTTAKIGLPETKLGLIPGFGGTVRLPRLIGTDNALEWITSGKDQRPEAAL
FADB_SHEWM      TVLATDFRIADTTAKLGLPETKLGLIPGFGGTVRLPRLIGADNALEWITTGKDHKPEAAL
FADB_SHEAM      AILATDFRVADTSAKIGLPETKLGLIPGFGGTVRLPRLIGADNALEWITTGKDQRPEDAL
FADB_SHELP      TILATDLRIADTSARIGLPETKLGIIPGFGGTVRLPRVIGADNALEWITTGKDQRPEAAL
FADB_COLP3      MTLACDYRVAATTASIGLPEVKLGLMPGFGGTVRLPRLIGFDNAATWMSTGKAFKPAAAL
FADB_IDILO      ALLACDYRVADTTATIGLPEVKLGLIPGFGGTMRLPRVIGPDNALEWITTGKNNKALDAL
FADB_PSEF5      MCLAADYRVMAASAKIGLPEVKLGIYPGFGGTVRLPRLIGADNAIEWIAAGKENRAEDAL
FADB_PSEPF      MCLAADYRVMSTKAKIGLPEVKLGIYPGFGGTVRLPRLIGADNAIEWIAAGKENRPEDAL
FADB_PSEFR      MCLAADFRVMADSAKIGLPEVKLGIYPGFGGTVRLPRLIGVDNAVEWIASGKENRAEDAL
FADB_PSEP1      MCLAADYRVMSTSARIGLPEVKLGIYPGFGGTVRLPRLIGSDNAIEWIAAGKENRAEDAL
FADB_PSEPK      MCLAADYRVMSTSARIGLPEVKLGIYPGFGGTVRLPRLIGSDNAIEWIAAGKENRAEDAL
FADB_PSEPG      MCLAADYRVMSNSAKIGLPEVKLGIYPGFGGTVRLPRLIGSDNAIEWIAAGKENRAEDAL
FADB_PSEPW      MCLAADYRVMSTSAKIGLPEVKLGIYPGFGGTVRLPRLIGSDNAIEWIAAGKENRAEDAL
FADB_PSEPU      MCLAADYRVMSTSAKIGLPEVKLGIYPGFGGTVRLPRLIGSDNAVEWIASGKENRAEDAL
FADB_PSEOL      MCLAADYRVMSTSAKIGLPEVKLGIYPGFGGTVRLPRLIGSDNAIEWIAAGKENRAEDAL
FADB_PSEE4      MCLAADYRIMSSSAKIGLPEVKLGIYPGFGGTVRLPRLIGSDNAIEWIAAGKENRAEDAL
FADB_PSE14      MCLAADYRVISSSARIGLPEVKLGLYPGFGGTVRLPRIIGADNAIEWIASGKESSAEDAL
FADB_PSESM      MCLAADYRVISSSARVGLPEVKLGLYPGFGGTVRLPRIIGADNAIEWIASGKENSAEDAL
FADB_PSEU2      MCLAADYRVMASSARIGLPEVKLGLYPGFGGTVRLPRIIGADNAIEWIASGKENAAEDAL
FADB_PSEAE      MCLAADFRVMSATAKVGLPEVKLGIYPGFGGTVRLPRLIGCDNAVEWIASGKENKAEDAL
FADB_PSEAB      MCLAADFRVMSATAKVGLPEVKLGIYPGFGGTVRLPRLIGCDNAVEWIASGKENKAEDAL
FADB_PSEA8      MCLAADFRVMSATAKVGLPEVKLGIYPGFGGTVRLPRLIGCDNAVEWIASGKENKAEDAL
FADB_PSEA7      MCLAADFRVMSATAKVGLPEVKLGIYPGFGGTVRLPRLIGCDNAVEWIASGKENKAEDAL
FADB_PSEMY      MCLAGDYRVMSETAKIGLPEVKLGIYPGFGGTVRLPRVIGTDNAVEWIASGKENKAADAL
FADB_PSEU5      MCMAADYRVMSTTAKVGLPEVKLGIYPGFGGTVRLPRLIGVDNAVEWIASGKENRAEDAL
FADB_ACIB5      MCLVCDYRVMSEAAQVGLPEIKLGIYPGFGGSVRLSRLIGIDNAVEWMAMATPKKPAAAL
FADB_ACIB3      MCLVCDYRVMSEAAQVGLPEIKLGIYPGFGGSVRLSRLIGIDNAVEWMAMATPKKPAAAL
FADB_ACIBY      MCLVCDYRVMSEAAQVGLPEIKLGIYPGFGGSVRLSRLIGIDNAVEWMAMATPKKPAAAL
FADB_ACIBC      MCLVCDYRVMSEAAQVGLPEIKLGIYPGFGGSVRLSRLIGIDNAVEWMAMATPKKPAAAL
FADB_ACIBS      MCLVCDYRVMSEAAQVGLPEIKLGIYPGFGGSVRLSRLIGIDNAVEWMAMATPKKPAAAL
FADB_ACIAD      MCLVCDYRVMSDQAQVGLPEIKLGIFPGFGGTVRLSRLIGIDNAVEWIAMAAPKKPAAAL
FADB_PSYA2      MTLVCEYRVMSDKAIIGLPETQLGIFPGFGGTVRSTRVIGIDNALELIATGAPKKALDAL
FADB_PSYCK      MTLVCEYRVMSDKAIIGLPETQLGIFPGFGGTVRSTRVIGIDNALELIATGTPKKALDAL
FADB_PSYWF      MTLVCEYRVMGDKAQIGLPETQLGIFPGFGGSVRTPRVIGIDNAVELIATGKAQKPAEAL
                  :  : *:      :**** :**: **:** :* .*::* * *   :: .    .  * 

FADB_ECO55      KIGLVDGVVKAEKLVEGAKAVLRQAINGDLDWKAKRQPKLEPLKLSKIEATMSFTIAKGM
FADB_ECOLC      KIGLVDGVVKAEKLVEGAKAVLRQAINGDLDWKAKRQPKLEPLKLSKIEATMSFTIAKGM
FADB_ECO8A      KIGLVDGVVKAEKLVEGAKAVLRQAINGDLDWKAKRQPKLEPLKLSKIEATMSFTIAKGM
FADB_SHIB3      KIGLVDGVVKAEKLVEGAKAVLRQAINGDLDWKAKRQPKLEPLKLSKIEATMSFTIAKGM
FADB_ECODH      KIGLVDGVVKAEKLVEGAKAVLRQAINGDLDWKAKRQPKLEPLKLSKIEATMSFTIAKGM
FADB_ECOLI      KIGLVDGVVKAEKLVEGAKAVLRQAINGDLDWKAKRQPKLEPLKLSKIEATMSFTIAKGM
FADB_SHISS      KIGLVDGVVKAEKLVEGAKAVLRQAINGDLDWKAKRQPKLEPLKLSKIEATMSFTIAKGM
FADB_ECOSE      KIGLVDGVVKAEKLVEGAKAVLRQAINGDLDWKAKRQPKLEPLKLSKIEATMSFTIAKGM
FADB_ECO24      KIGLVDGVVKAEKLVEGAKAVLRQAINGDLDWKAKRQPKLEPLKLSKIEATMSFTIAKGM
FADB_ESCF3      KIGLVDGVVKAEKLVEGAKAILRQAINGDLDWKAKRQPKLEPLKLSKIEATMSFTIAKGM
FADB_ECO57      KIGLVDGVVKAEKLIEGAMAILRQAINGDLDWKAKRQPKLEPLKLSKIEATMSFTIAKGM
FADB_ECO5E      KIGLVDGVVKAEKLIEGAMAILRQAINGDLDWKAKRQPKLEPLKLSKIEATMSFTIAKGM
FADB_SHIDS      KIGLVDGVVKAEKLIEGAMAILRQAINGDLDWKAKRQPKLEPLKLSKIEATMSFTIAKGM
FADB_ECOSM      KIGLVDGVVKAEKLIEGAMAILRQAINGDLDWKAKRQPKLEPLKLSEIEATMSFTIAKGM
FADB_SHIFL      KIGLVDGVVKAEKLIEGAMAILRQAINGDLDWKAKRQPKQEPLKLSKIEATMSFTIAKGM
FADB_SHIF8      KIGLVDGVVKAEKLIEGAMAILRQAINGDLDWKAKRQPKQEPLKLSKIEATMSFTIAKGM
FADB_ECOHS      KIGLVDGVVKAEKLIEGAMAILRQAINGDLDWKAKRQPKLEPLKLSKIEATMSFTIAKGM
FADB_ECOUT      KIGLVDGVVKAEKLVEGAIAILRQAINGDLDWKAKRQPKLEPLKLSKIEAAMSFTIAKGM
FADB_ECO45      KIGLVDGVVKAEKLVEGAIAILRQAINGDLDWKAKRQPKLEPLKLSKIEAAMSFTIAKGM
FADB_ECO81      KIGLVDGVVKAEKLVEGAIAILRQAINGDLDWKAKRQPKLEPLKLSKIEAAMSFTIAKGM
FADB_ECOL6      KIGLVDGVVKAEKLVEGAMAILRQAINGDLDWKAKRQPKLEPLKLSKIEAAMSFTIAKGM
FADB_ECOL5      KIGLVDGVVKAEKLVEGAMAILRQAINGDLDWKAKRQPKLEPLKLSKIEAAMSFTIAKGM
FADB_ECO27      KIGLVDGVVKAEKLVEGAMAILRQAINGDLDWKAKRQPKLEPLKLSKIEAAMSFTIAKGM
FADB_ECOLU      KIGLVDGVVKAEKLVEGAMAILRQAINGDLDWKAKRQPKLEPLKLSKIEATMSFTIAKGM
FADB_ECO7I      KIGLVDGVVKAEKLVEGAMAILRQAINGDLDWKAKRQPKLEPLKLSKIEATMSFTIAKGM
FADB_SALG2      KIGLVDGVVKQEKLIEGAIAVLRQAITGDLDWRAKRQPKLEPLKLSKIEAAMSFTIAKGM
FADB_SALTI      KIGLVDGVVKQEKLIEGAIAVLRQAITGDLDWRAKRQPKLEPLKLSKIEAAMSFTIAKGM
FADB_SALEP      KIGLVDGVVKQEKLIEGAIAVLRQAITGDLDWRAKRQPKLEPLKLSKIEAAMSFTIAKGM
FADB_SALA4      KIGLVDGVVKQEKLIEGAIAVLRQAITGDLDWRAKRQPKLEPLKLSKIEAAMSFTIAKGM
FADB_SALCH      KIGLVDGVVKQEKLIEGAIAVLRQAITGDLDWRAKRQPKLEPLKLSKIEAAMSFTIAKGM
FADB_SALPB      KIGLVDGVVKQEKLIEGAIAVLRQAITGDLDWRAKRQPKLEPLKLSKIEAAMSFTIAKGM
FADB_SALNS      KIGLVDGVVKQETLIEGAIAVLRQAITGDLDWRAKRQPKLEPLKLSKIEAAMSFTIAKGM
FADB_SALTY      KIGLVDGVVKQEKLIEGAIAVLRQAITGDLDWRAKRQPKLEPLKLSKIEAAMSFTIAKGM
FADB_SALPA      KIGLVDGVVKQEKLIEGAIAVLRQAITGDLDWRAKRQPKLEPLKLSKIEAAMSFTIAKGM
FADB_SALPK      KIGLVDGVVKQEKLIEGAIAVLRQAITGDLDWRAKRQPKLEPLKLSKIEAAMSFTIAKGM
FADB_SALSV      KIGLVDGVVKQEKLIDGAIAVLRQAITGDLDWRAKRQPKLEPLKLSKIEAAMSFTIAKGM
FADB_CITK8      KIGLVDGVVKPEKLLDGAIAVLRQAIDGSLDWKAKRQPKLEPLKLSKIEAAMSFTIAKGM
FADB_ENTCL      KIGLVDGVVKPEKLVEGALAILRQAINGDLDWKAKRQPKLEPLKLSKIEATMSFTIAKGM
FADB_ENT38      KIGLIDGIVKAEKLRDGAISILRQAINGDLDWKAKRQRKLEPLKLSKIEATMSFTIAKGM
FADB_KLEP3      KIGLVDGVVAAEKLRDGALAILRQAINGDLDWKAKRQPKLEPLKLSKIEATMSFTIAKGM
FADB_KLEP7      KIGLVDGVVAAEKLRDGALAILRQAMNGDLDWKAKRQPKLEPLKLSKIEAAMSFTIAKGM
FADB_CROS8      KVGLVDAVVKPEKLIEGALRMLRQAIDGELDWQARRQPKLEPLRLSKIEATMSFTIAKGM
FADB_PECAS      KVGLVQAVVANEKLIPAAIKMLKQAINGELDWLGYRRPKLEALKLNKIEAMMSFTTAKAM
FADB_YERPE      KIGLVDAVVDPEKLVGSALTMLKQAIDGKLDWQAARRPKLEPLKLNPTEAAMCFTIAKGR
FADB_YERPY      KIGLVDAVVDPEKLVGSALTMLKQAIDGKLDWQAARRPKLEPLKLNPTEAAMCFTIAKGR
FADB_YERPP      KIGLVDAVVDPEKLVGSALTMLKQAIDGKLDWQAARRPKLEPLKLNPTEAAMCFTIAKGR
FADB_YERPG      KIGLVDAVVDPEKLVGSALTMLKQAIDGKLDWQAARRPKLEPLKLNPTEAAMCFTIAKGR
FADB_YERPA      KIGLVDAVVDPEKLVGSALTMLKQAIDGKLDWQAARRPKLEPLKLNPTEAAMCFTIAKGR
FADB_YERPN      KIGLVDAVVDPEKLVGSALTMLKQAIDGKLDWQAARRPKLEPLKLNPTEAAMCFTIAKGR
FADB_YERPS      KIGLVDAVVDPEKLVGSALTMLKQAIDGKLDWQAARRPKLEPLKLNPTEAAMCFTIAKGR
FADB_YERPB      KIGLVDAVVDPEKLVGSALTMLKQAIDGKLDWQAARRPKLEPLKLNPTEAAMCFTIAKGR
FADB_YERP3      KIGLVDAVVDPEKLVGSALTMLKQAIDGKLDWQAARRPKLEPLKLNPTEAAMCFTIAKGR
FADB_YERE8      KVGLVDAVVAPEKLVDAALSILNQAIDGKLDWQAARRPKLEPLKLNPTEAAMCFTIAKGM
FADB_SERP5      KVGLVDAVVAPEKLVEAALKMLQQAIEGKLDWRAYRQPKLEPLKLSPIEAAMSFTTAKGM
FADB_PHOLL      KNGLIDAVVPKEKLVDSAVSMLEQAIAGNLDWKAARQPKLEPLKLNETERGMSFSVAKGM
FADB_ALIF1      ALGMVDGVVSRETLITDSVTMLKKAIEGQLDWQSRRTQKKAPLKLSPLEAAMSFNVAKGM
FADB_ALIFM      ALGMIDGVVSRETLITDSVTMLKKAIGGQLDWQSRRTQKKAPLKLSPLEAAMSFNVAKGM
FADB_ALISL      KIGMVDGIVSRETLIDASVSMLKQAIDGQLNWQQRREQKKAPIQLSPLEAAMSFNVAKGM
FADB_PHOPR      KLGLVDAVVAPTALKDAALSMIKDAIAGKLDWQKRRAQKKAPLTLNKIEATMSFTMAKAM
FADB_VIBCH      KVGLLDAIVDSDKLIDSAITTLTQAIEEKLDWQKRRQQKTSALTLSKLEAMMSFTMAKGM
FADB_VIBCM      KVGLLDAIVDSDKLIDSAITTLTQAIEEKLDWQKRRQQKTSALTLSKLEAMMSFTMAKGM
FADB_VIBC3      KVGLLDAIVDSDKLIDSAITTLTQAIEEKLDWQKRRQQKTSALTLSKLEAMMSFTMAKGM
FADB_VIBCB      KIGLLDAVVDSDALYESALKTLTSAINEKLDWQARRKQKTSPLTLSKLESMMSFTMAKGL
FADB_VIBPA      KIGLLDAVVETDALYESALQTLTSAINEKIDWQARRKQKTSPLTLSKLESMMSFTMAKGL
FADB_VIBVU      KIGLLDAVVDSDRLYASALQTLTDAINEKIDWKARRQQKTSALTLSKLEAMMSFTMAKGL
FADB_VIBVY      KIGLLDAVVDSDRLYASALQTLTDAINEKIDWKARRQQKTSALTLSKLEAMMSFTMAKGL
FADB_VIBTL      KVGLLDAIVETDQLLESAINTVSLAANEKLDWQLRRKQKTSALSLSKLEAMMSFTMAKGL
FADB_AERHH      KVGAIDAVVAPDALQSAAVQMIKDAVKGKLDWQGRRAAKKAPLRLSKLEAMMSFTTAAGM
FADB_AERS4      KVGAIDAVVAPDALHSAAVQMMKDAIAGKLNWQSRRAAKKAPLRLSKLEAMMSFSTAAGM
FADB_SHEB8      KVGAVDSVVAPQALEAAAIQMLKDAVAEKLDWQARRNRKLSALTLPKLEAMMSFTTAKGM
FADB_SHEB2      KVGAVDAVVAPQALEAAAIQMLKDAVAEKLDWQARRNRKLSALTLPKLEAMMSFTTAKGM
FADB_SHEB9      KVGAVDAVVAPQALEAAAIQMLKDAVAEKLDWQARRNRKLSALTLPKLEAMMSFTTAKGM
FADB_SHEB5      KVGAVDAVVAPQALEAAAIQMLKDAVAEKLDWQARRNRKLSALTLPKLEAMMSFTTAKGM
FADB_SHEPC      KVGAVDAVVAPEALEAAAIQMLKDAVAEKLDWQARRNRKLSALTLPKLEAMMSFTTAKGM
FADB_SHESW      KVGAVDAVVAPEALEAAAIQMLKDAVAEKLDWQARRNRKLSALTLPKLEAMMSFTTAKGM
FADB_SHESA      KVGAVDAVVAPEALEAAAIQMLKDAVAEKLDWQARRQRKMSPLTLPKLEAMMSFTTAKGM
FADB_SHESR      KVGAVDAVVAPEALEAAAIQMLKDAVAEKLDWQARRHRKMSPLTLPKLEAMMSFTTAKGM
FADB_SHESM      KVGAVDAVVAPEALEAAAIQMLKDAVAEKLDWQARRQRKMSPLTLPKLEAMMSFTTAKGM
FADB_SHEON      KVGAVDAVVAPEALEVAAIQMLKDAVAEKLDWQARRQRKLSPLTLPKLEAMMSFTTAKGM
FADB_SHEFN      KVGAIDAVVAPENLEAAAIQMLHDALNGSLDWQARRTKKQSPLQLPKLEAMMSFATAKGM
FADB_SHEHH      KVGAIDAVVAPEQLRPAALRMLKDAMAEKLDWQTRRAKKLAPLTLPKLEAMMSFATAKGM
FADB_SHEPA      KVGAIDAVVAPEQLKPAALKMLKDALIEKLDWQTRRAKKQAPLTLPKLEAMMSFATAKGM
FADB_SHEPW      NVGAIDALVAPEQLQSAALKMLKDAIAEKLDWQTRRAKKLAPLTLPKLEAMMSFATAKGM
FADB_SHESH      KVGAIDAVVAPENLQASAIKMLKDALAEKLDWQSRRARKQAALTLPKLEAMMSFATAKGM
FADB_SHEWM      KVGAIDAVVAPENLEASAIAMLKEALSEKLDWQARRAKKQAPLNLPKLEAMMSFATAKGM
FADB_SHEAM      KVGAIDAVVAPENLEAAAIQMLNDALAGKLDWQARRARKQAPLTLPKLEAMMSFTTAKGM
FADB_SHELP      KVGAIDAVVAPELLETAACQMLQDAISEKIDWQARRQRKLSPLTLPKLEAMMSFATAKGM
FADB_COLP3      AQGAIDAVVEPENLQAAAISMLKLAIDGKLDWRAKRQPKLEALKLSPTELIMSSTTCKGM
FADB_IDILO      KVGAVDAVVEPENLTKAALNLAKAAAAGQQDWKAKRQPKLEPLKANDTELMMTLVTAKGM
FADB_PSEF5      KVGAVDAVVAPDKLKDAALALVKRAISGEFDYKAKRQPKLEKLKLNAIEQMMAFETAKGF
FADB_PSEPF      KVGAVDAVVAPEKLQDAALELIKRAVSGEFDYKAKRQPKLEKLRLNAIEQMMAFETAKGF
FADB_PSEFR      KVSAVDAVVTADKLGAAALDLIKRAISGELDYKAKRQPKLEKLKLNAIEQMMAFETAKGF
FADB_PSEP1      KVGAVDAVVAPELLLAGALDLIKRAISGELDYKAKRQPKLEKLKLNAIEQMMAFETAKGF
FADB_PSEPK      KVGAVDAVVAPELLLAGALDLIKRAISGELDYKAKRQPKLEKLKLNAIEQMMAFETAKGF
FADB_PSEPG      KVGAVDAVVAPELLLAGALDLIKRAISGELDYKAKRQPKLEKLKLNAIEQMMAFETAKGF
FADB_PSEPW      KVGAVDAVVAPELLQAGALDLVKRAISGELDYKAKRQPKLEKLKLNAIEQMMAFETAKGF
FADB_PSEPU      KVGAVDAVVAPELLQAGALDLIKRAISGELDYKAKRQPKLEKLKLNAIEQMMAFETAKGF
FADB_PSEOL      KVGAVDAVVAPELLMAGALDLVKRAISGELDYKAKRQPKLEKLKLNAIEQMMAFETAKGF
FADB_PSEE4      KVGAVDAVVAPELLQAGALDLIKRAISGELDHKAKRQPKLEKLKLNAIEQMMAFETAKGF
FADB_PSE14      KVGAVDAVVAPEKLQAAALDLIQRAISGEFDYKAKRQPKLDKLKLNAIEQMMAFETAKGF
FADB_PSESM      KVGVVDAIVAPEKLQAAALDLIQRAISGEFDYKAKRQPKLDKLKLNAIEQMMAFETAKGF
FADB_PSEU2      KVGAVDAVVAPEKLQAAALDLIQRAISGEFDYKAKRQPKLDKLKLNAIEQMMAFETAKGF
FADB_PSEAE      KVGAVDAVVAPEQLQAAALDLAKRAVAGELDHKARRQPKLEKLKLNAIEQMMAFETAKGF
FADB_PSEAB      KVGAVDAVVAPEQLQAAALDLAKRAVAGELDHKARRQPKLEKLKLNAIEQMMAFETAKGF
FADB_PSEA8      KVGAVDAVVAPEQLQAAALDLAKRAVAGELDHKARRQPKLEKLKLNAIEQMMAFETAKGF
FADB_PSEA7      KVGAVDAVVAPEQLQAAALDLAKRAVAGELDHKARRQPKLEKLKLNAIEQMMAFETAKGF
FADB_PSEMY      KVGAVDAVVAPAKLKEAALDLVKRAISGELDYKAKRQPKLEKLKLNAIEQMMCFETAKGF
FADB_PSEU5      KVHAVDAVVAPEKLQEAALDLVKRAISGELDYKAKRQPKLDKLKLNAIEQMMAFETSKAF
FADB_ACIB5      KDGAVDAVVAADKLLDAATDLVKQAISGRLNWKAKRQEKLEAVKLNPLEQMMAFNTAKGA
FADB_ACIB3      KDGAVDAVVAADKLLDAATDLVKQAISGRLNWKAKRQEKLEAVKLNPLEQMMAFNTAKGA
FADB_ACIBY      KDGAVDAVVAADKLLDAATDLVKQAISGRLNWKAKRQEKLEAVKLNPLEQMMAFNTAKGA
FADB_ACIBC      KDGAVDAVVAADKLLDAATDLVKQAISGRLNWKAKRQEKLEAVKLNPLEQMMAFNTAKGA
FADB_ACIBS      KDGAVDAVVAADKLLDAATDLVKQAISGRLNWKAKRQEKLEAVKLNPLEQMMAFNTAKGA
FADB_ACIAD      KDGAVDAVVSADKLQEAAIDLVKQALAGRVDWKAKRQEKLNPVKLNPLEQMMAFNTAKGA
FADB_PSYA2      KLGLVDATVAADDLQDAAIDLVKKCISGELDWKAKREEKLVAVKLNQLEQAMAFNSAKGM
FADB_PSYCK      KLGLVDATVAADDLQDAAIDLVKKCISDELDWQAKREEKLVPVKLNQLEQAMAFNSAKGM
FADB_PSYWF      KLGLVDAVVAQDDLQEAAVDLVKKCIAGDLDWQAKREEKLQPVKLNQLEQTMAFSTAKAA
                    ::. *    *   :      .     :    *  *   :     *  *    . . 

FADB_ECO55      VAQTAGK-HYPAPITAVKTIEAAARFGREEALNLENKSFVPLAHTNEARALVGIFLNDQY
FADB_ECOLC      VAQTAGK-HYPAPITAVKTIEAAARFGREEALNLENKSFVPLAHTNEARALVGIFLNDQY
FADB_ECO8A      VAQTAGK-HYPAPITAVKTIEAAARFGREEALNLENKSFVPLAHTNEARALVGIFLNDQY
FADB_SHIB3      VAQTAGK-HYPAPITAVKTIEAAARFGREEALNLENKSFVPLAHTNEARALVGIFLNDQY
FADB_ECODH      VAQTAGK-HYPAPITAVKTIEAAARFGREEALNLENKSFVPLAHTNEARALVGIFLNDQY
FADB_ECOLI      VAQTAGK-HYPAPITAVKTIEAAARFGREEALNLENKSFVPLAHTNEARALVGIFLNDQY
FADB_SHISS      VAQTAGK-HYPAPITAVKTIEAAARFGREEALNLENKSFVPLAHTNEARALVGIFLNDQY
FADB_ECOSE      VAQTAGK-HYPAPITAVKTIEAAARFGREEALNLENKSFVPLAHTNEARALVGIFLNDQY
FADB_ECO24      VAQTAGK-HYPAPITAVKTIEAAARFGREEALNLENKSFVPLAHTNEARALVGIFLNDQY
FADB_ESCF3      VAQTAGK-HYPAPITAVKTIEAAARFGREEALNLENKSFVPLAHTNEARALVGIFLNDQY
FADB_ECO57      VAQTAGK-HYPAPITAVKTIEAAARFGREEALNLENKSFVPLAHTNEARALVGIFLNDQY
FADB_ECO5E      VAQTAGK-HYPAPITAVKTIEAAARFGREEALNLENKSFVPLAHTNEARALVGIFLNDQY
FADB_SHIDS      VAQTAGK-HYPAPITAVKTIEAAARFGREEALNLENKSFVPLAHTNEARALIGIFLNDQY
FADB_ECOSM      VAQTAGK-HYPAPITAVKTIEAAARFGREEALNLENKSFVPLAHTNEARALVGIFLNDQY
FADB_SHIFL      VAQTAGK-HYPAPITAVKTIEAAARFGREEALNLENKSFVPLAHTNEARALVGIFLNDQY
FADB_SHIF8      VAQTAGK-HYPAPITAVKTIEAAARFGREEALNLENKSFVPLAHTNEARALVGIFLNDQY
FADB_ECOHS      VAQTAGK-HYPAPITAVKTIEAAARFGREEALNLENKSFVPLAHTNEARALVGIFLNDQY
FADB_ECOUT      VAQTAGK-HYPAPITAVKTIEAAARFGREEALNLENKSFVPLAHTNEARALVGIFLNDQY
FADB_ECO45      VAQTAGK-HYPAPITAVKTIEAAARFGREEALNLENKSFVPLAHTNEARALVGIFLNDQY
FADB_ECO81      VAQTAGK-HYPAPITAVKTIEAAARFGREEALNLENKSFVPLAHTNEARALVGIFLNDQY
FADB_ECOL6      VAQTAGK-HYPAPITAVKTIEAAARFGREEALNLENKSFVPLAHTNEARALVGIFLNDQY
FADB_ECOL5      VAQTAGK-HYPAPITAVKTIEAAARFGREEALNLENKSFVPLAHTNEARALVGIFLNDQY
FADB_ECO27      VAQTAGK-HYPAPITAVKTIEAAARFGREEALNLENKSFVPLAHTNEARALVGIFLNDQY
FADB_ECOLU      VAQTAGK-HYPAPITAVKTIEAAARFGREEALNLENKSFVPLAHTNEARALVGIFLNDQY
FADB_ECO7I      VAQTAGK-HYPAPITAVKTIEAAARFGREEALNLENKSFVPLAHTNEARALVGIFLNDQY
FADB_SALG2      VAQTAGK-HYPAPMTAVKTIEAAARFGREEALNLENKSFVPLAHTNEARALVGIFLNDQY
FADB_SALTI      VAQTAGK-HYPAPMTAVKTIEAAARFGREEALNLENKSFVPLAHTNEARALVGIFLNDQY
FADB_SALEP      VAQTAGK-HYPAPMTAVKTIEAAARFGREEALNLENKSFVPLAHTNEARALVGIFLNDQY
FADB_SALA4      VAQTAGK-HYPAPMTAVKTIEAAARFGREEALNLENKSFVPLAHTNEARALVGIFLNDQY
FADB_SALCH      VAQTAGK-HYPAPMTAVKTIEAAARFGREEALNLENKSFVPLAHTNEARALVGIFLNDQY
FADB_SALPB      VAQTAGK-HYPAPMTAVKTIEAAARFGREEALNLENKSFVPLAHTNEARALVGIFLNDQY
FADB_SALNS      VAQTAGK-HYPAPMTAVKTIEAAARFGREEALNLENKSFVPLAHTNEARALVGIFLNDQY
FADB_SALTY      VAQTAGK-HYPAPMTAVKTIEAAARFGREEALNLENKSFVPLAHTNEARALVGIFLNDQY
FADB_SALPA      VAQTAGK-HYPAPMTAVKTIEAAARFGREEALNLENKSFVPLAHTNEARALVGIFLNDQY
FADB_SALPK      VAQTAGK-HYPAPMTAVKTIEAAARFGREEALNLENKSFVPLAHTNEARALVGIFLNDQY
FADB_SALSV      VAQTAGK-HYPAPMTAVKTIEAAARFGREEALNLENKSFVPLAHTNEARALVGIFLNDQY
FADB_CITK8      VAQTAGK-HYPAPMIAVKTIEAAARFGREEALNLENKSFVPLAHTNEARALVGIFLNDQF
FADB_ENTCL      VMQTAGK-HYPAPITAVKTIEAAARLGRDEALKLENQSFVPLAHTNEARALVGIFLNDQF
FADB_ENT38      VMQTAGK-HYPAPITAVKTIEAAARLGREEALKLENQSFVPLAHTNEARALVGIFLNDQF
FADB_KLEP3      VAQTAGK-HYPAPITAVKTIEAAARLGREEALVLENKSFVPLAHTNEARALVGIFLNDQY
FADB_KLEP7      VAQTAGK-HYPAPITAVKTIEAAARLGREEALVLENKSFVPLAHTNEARALVGIFLNDQY
FADB_CROS8      VMQTAGK-HYPAPMTAVKTIEAAAGLGRDEALALENKSFVPLARSSEARALVGIFLNDQY
FADB_PECAS      VLQTAGK-HYPAPMLAVKTIEAAATMTRDEALQLETQHFVQLARSNEARALVGIFLNDQY
FADB_YERPE      VMQVAGK-HYPAPLTAVKTIEAAAKFGRTEALNLETNSFVPLAGSNEARALVGIFLNDQY
FADB_YERPY      VMQVAGK-HYPAPLTAVKTIEAAAKFGRTEALNLETNSFVPLAGSNEARALVGIFLNDQY
FADB_YERPP      VMQVAGK-HYPAPLTAVKTIEAAAKFGRTEALNLETNSFVPLAGSNEARALVGIFLNDQY
FADB_YERPG      VMQVAGK-HYPAPLTAVKTIEAAAKFGRTEALNLETNSFVPLAGSNEARALVGIFLNDQY
FADB_YERPA      VMQVAGK-HYPAPLTAVKTIEAAAKFGRTEALNLETNSFVPLAGSNEARALVGIFLNDQY
FADB_YERPN      VMQVAGK-HYPAPLTAVKTIEAAAKFGRTEALNLETNSFVPLAGSNEARALVGIFLNDQY
FADB_YERPS      VMQVAGK-HYPAPLTAVKTIEAAAKFGRTEALNLETNSFVPLAGSNEARALVGIFLNDQY
FADB_YERPB      VMQVAGK-HYPAPLTAVKTIEAAAKFGRTEALNLETNSFVPLAGSNEARALVGIFLNDQY
FADB_YERP3      VMQVAGK-HYPAPLTAVKTIEAAAKFGRTEALNLETNSFVPLAGSNEARALVGIFLNDQY
FADB_YERE8      VMQVAGK-HYPAPLTAVKTIEAAAKFGRAEALILETNSFVPLAGSNEARALVGIFLNDQY
FADB_SERP5      VMQTAGK-HYPAPMTAVKTIEAAARLGRDEALKLETASFVPLARSKEARALVGIFLNDQF
FADB_PHOLL      VMKVAGP-HYPAPITAVKSIEKAATFGRDEALKQETASFIPLAQTNVARALVGIFLNDQY
FADB_ALIF1      IMKMAGK-HYPAPMTAVKSIENSAFMDRDAALEVENKNFVALTQTDVAKSLVGIFLNDQL
FADB_ALIFM      IMKMAGK-HYPAPMTAVKSIENSAFMDRDAALEVENKNFVALTQTDVAKSLVGIFLNDQL
FADB_ALISL      IMKMAGK-HYPAPLTAVKSIEQSANMHRDDALAIENKHFVALTRTDVAKSLVGIFLNDQL
FADB_PHOPR      VAQVAGK-HYPAPMTAVIAIEAAARMSRDEALVVENKHFITLAKTDVAQSLVGIFLNDQY
FADB_VIBCH      VAQVAGK-HYPAPMTSVVTIEEAARLPRDAALDIERKHFIKLAKSTEAQALVGIFLNDQY
FADB_VIBCM      VAQVAGK-HYPAPMTSVVTIEEAARLPRDAALDIERKHFIKLAKSTEAQALVGIFLNDQY
FADB_VIBC3      VAQVAGK-HYPAPMTSVVTIEEAARLPRDAALDIERKHFIKLAKSTEAQALVGIFLNDQY
FADB_VIBCB      VAQKAGP-HYPAPMTAVITIEEGARFARNEALDIERKHFVKLAKSEEAKSLVGLFLNDQY
FADB_VIBPA      VAQVAGP-HYPAPMTAVITIEEGARFARNEALDIERKYFVKLAKSEEAKALVGLFLNDQY
FADB_VIBVU      VAQVAGP-HYPAPMTAVVTIEEGARFARNQALDIERKHFVKLAKSEEAKALVGLFLNDQY
FADB_VIBVY      VAQVAGP-HYPAPMTAVVTIEEGARFARNQALDIERKHFVKLAKSEEAKALVGLFLNDQY
FADB_VIBTL      VAQKAGP-HYPAPITSVIAIEEAARSDRDAALDIERKHFVKLAKSEEAKALVGLFLNDQY
FADB_AERHH      VAAVAGK-HYPAPMTAVKTVEAAAGMSRDEALAVEAQGFIKLAKTDVAKALVGIFLNDQH
FADB_AERS4      VAAVAGK-HYPAPMTAVKTVEAAAGMSRDEALVVEAQGFIKLAKTDVAKALVGIFLNDQH
FADB_SHEB8      VFAVAGK-HYPAPMAAVSVIEQASTKGRAEALQIEHQAFIKLAKTDVAKALIGIFLNDQF
FADB_SHEB2      VFAVAGK-HYPAPMAAVSVIEQASTKGRAEALQIEHQAFIKLAKTDVAKALIGIFLNDQF
FADB_SHEB9      VFAVAGK-HYPAPMAAVSVIEQASTKGRAEALQIEHQAFIKLAKTDVAKALIGIFLNDQF
FADB_SHEB5      VFAVAGK-HYPAPMAAVSVIEQASTKGRAEALQIEHQAFIKLAKTDVAKALIGIFLNDQF
FADB_SHEPC      VFAVAGK-HYPAPMAAVSVIEQASTKGRAEALQIEHQAFIKLAKTDVAKALIGIFLNDQL
FADB_SHESW      VFAVAGK-HYPAPMAAVSVIEQASTKGRAEALQIEHQAFIKLAKTDVAKALIGIFLNDQL
FADB_SHESA      VFAVAGK-HYPAPMAAVSVVEQAATKGRSDALQIEHQAFIKLAKTDVAKALIGIFLNDQL
FADB_SHESR      VFAVAGK-HYPAPMAAVSVVEQAATKGRSDALQIEHQAFIKLAKTDVAKALIGIFLNDQL
FADB_SHESM      VFAVAGK-HYPAPMAAVSVVEQAATKGRSDALQIEHQAFIKLAKTDVAKALIGIFLNDQL
FADB_SHEON      VFSVAGK-HYPAPMAAVNVVEQAATKGRSDALQIEHQAFIKLAKTDVAKALIGIFLNDQF
FADB_SHEFN      VFSVAGK-HYPAPMAAVNVVEQAAGLDRDGALKVEALAFIKLAKTDVAQALIGIFLNDQF
FADB_SHEHH      VFKIAGK-HYPAPMAVISVIEQAAQCGRAEALQIEHQAFIKLAKTEVAQALIGIFLNDQL
FADB_SHEPA      VFKVAGK-HYPAPMAVISVIEQAAQLDRAGALQVEHQAFIKLAKTEVAQALIGIFLNDQL
FADB_SHEPW      VFKVAGK-HYPAPMAVVSVIEKAAQLDRAGALKVEHQAFLKLAKTEVAQSLIGIFLNDQL
FADB_SHESH      VFKIAGK-HYPAPMAAISVIEQAARCGRADALKVEHQAFVKLAKTDVAQALIGIFLNDQL
FADB_SHEWM      VFKVAGK-HYPAPMTAISVIEQAARSERADALMVEHQAFIKLAKTDVAQALIGIFLNDQL
FADB_SHEAM      VYAVAGK-HYPAPMAAVSVVEQAAGMSRAEALVVEHNAFIKLAKTDVATALIGIFLNDQL
FADB_SHELP      VFKVAGK-HYPAPMAVVEVIEKAALSERAEALQVEHQAFIKLAKTDVAKALIGIFLNDQL
FADB_COLP3      IAAKAGK-HYPAPMVMINTLIASANLDRTGAMAAENTGFAKLAKTDAATAQIGLFMADQV
FADB_IDILO      IAAKAGK-HYPAPHKALEAIENGAREHREGALTAENNAFFDLTQTEACQAQVGIFLADQA
FADB_PSEF5      VAGQAGP-NYPAPVEAIKTIQKAANFGRDKALEVEAAGFVKLAKTSAAQSLIGLFLNDQE
FADB_PSEPF      VAGQAGP-NYPAPVEAIKTIQKAANFGRDKALEVEAAGFVKLAKTSAAQSLIGLFLNDQE
FADB_PSEFR      VAGQAGP-NYPAPVEAIKTIQKAANFGRDKALEVEAAGFAKLAKTSASNCLIGLFLNDQE
FADB_PSEP1      VAGQAGP-NYPAPVEAIKSIQKAANFGRDKALEVEAAGFAKLAKTSVAESLIGLFLNDQE
FADB_PSEPK      VAGQAGP-NYPAPVEAIKSIQKAANFGRDKALEVEAAGFAKLAKTSVAESLIGLFLNDQE
FADB_PSEPG      VAGQAGP-NYPAPVEAIKSIQKAANFGRDKALEVEAAGFAKLAKTSVAESLIGLFLNDQE
FADB_PSEPW      VAGQAGP-NYPAPVEAIKSIQKAANFGRDKALEVEAAGFAKLAKTSVAQSLIGLFLNDQE
FADB_PSEPU      VAGQAGP-NYPAPVEAIKTIQKAANFGRDKALEVEAAGFAKLAKTSVAESLIGLFLNDQE
FADB_PSEOL      VAGQAGP-NYPAPVEAIKTIQKAANFGRDKALEVEAAGFAKLAKTSVAESLIGLFLNDQE
FADB_PSEE4      VAGQAGP-NYPAPVEAIKTIQKAANFGRDKALEVEAAGFAKLARTSVAESLIGLFLNDQE
FADB_PSE14      VAGQAGP-NYPAPVEAIKTIQKAANFGRDKALEIEAAGFVKMAKTSAAQSLIGLFLNDQE
FADB_PSESM      VAGQAGP-NYPAPVEAIKTIQKAAIFGRDKALEIEAAGFVKMAKTSAAQSLIGLFLNDQE
FADB_PSEU2      VAGQAGP-NYPAPVEAIKTIQKAANFGRDKALEIEAAGFVKMAKTPAAQSLIGLFLNDQE
FADB_PSEAE      VAGQAGP-NYPAPVEAIKSIQKAANFGRDKALEVEAAGFVKLAKTSVAQSLIGLFLNDQE
FADB_PSEAB      VAGQAGP-NYPAPVEAIKSIQKAANFGRDKALEVEAAGFVKLAKTSVAQSLIGLFLNDQE
FADB_PSEA8      VAGQAGP-NYPAPVEAIKSIQKAANFGRDKALEVEAAGFVKLAKTSVAQSLIGLFLNDQE
FADB_PSEA7      VAGQAGP-NYPAPVEAIKSIQKAANFGRDKALEVEAAGFVKLAKTSVAQSLIGLFLNDQE
FADB_PSEMY      VAGQAGP-NYPAPVEAIKTIQKAANFGRDKALEVEAAGFVKLAKTSVAESLIGLFLNDQE
FADB_PSEU5      VAGQAGP-NYPAPVEAIKTIQKAANFGRDKAIEVEAAGFVKLAKTSVAQSLVGLFLSDQE
FADB_ACIB5      VLAKANPAQYPAPKLLLDSLQAGASLARDEALKAEAEGFAKAAVTPQAEALIGLFINDQV
FADB_ACIB3      VLAKANPAQYPAPKLLLDSLQAGASLARDEALKAEAEGFAKAAVTPQAEALIGLFINDQV
FADB_ACIBY      VLAKANPAQYPAPKLLLDSLQAGASLARDEALKAEAEGFAKAAVTPQAEALIGLFINDQV
FADB_ACIBC      VLAKANPAQYPAPKLLLDSLQAGASLARDEALKAEAEGFAKAAVTPQAEALIGLFINDQV
FADB_ACIBS      VLAKANPAQYPAPKLLLDSLQAGASLARDEALKAEAEGFAKAAVTPQAEALIGLFINDQV
FADB_ACIAD      VLAKANPAQYPAPKLMLDSLQAGASLGRDEALKVETEGFAKAAITPQAEALIGLFLNDQI
FADB_PSYA2      IFAKANPKQYPAPALAIAAIEKHVNLPRDKAIEVEAAGFAKAAKTPQAESLVGLFLSDQL
FADB_PSYCK      IFAKANPKQYPAPALAIAAIEKHVNLPRDKAIEVEAAGFAKAAKTPQAESLVGLFLSDQL
FADB_PSYWF      IFAKANPKQYPAPAIAIETIEKHVNLGRDEAIKVEAAGFAKAAKTPQAESLVGLFLNDQT
                :   *.  :****   :  :       *  *:  *   *   : :  . . :*:*: ** 

FADB_ECO55      VKGKAKKLTKDVET-PKQAAVLGAGIMGGGIAYQSAWKGVPVVMKDINDKSLTLGMTEAA
FADB_ECOLC      VKGKAKKLTKDVET-PKQAAVLGAGIMGGGIAYQSAWKGVPVVMKDINDKSLTLGMTEAA
FADB_ECO8A      VKGKAKKLTKDVET-PKQAAVLGAGIMGGGIAYQSAWKGVPVVMKDINDKSLTLGMTEAA
FADB_SHIB3      VKGKAKKLTKDVET-PKQAAVLGAGIMGGGIAYQSAWKGVPVVMKDINDKSLTLGMTEAA
FADB_ECODH      VKGKAKKLTKDVET-PKQAAVLGAGIMGGGIAYQSAWKGVPVVMKDINDKSLTLGMTEAA
FADB_ECOLI      VKGKAKKLTKDVET-PKQAAVLGAGIMGGGIAYQSAWKGVPVVMKDINDKSLTLGMTEAA
FADB_SHISS      VKGKAKKLTKDVET-PKQAAVLGAGIMGGGIAYQSAWKGVPVVMKDINDKSLTLGMTEAA
FADB_ECOSE      VKGKAKKLTKDVET-PKQAAVLGAGIMGGGIAYQSAWKGVPVVMKDINDKSLTLGMTEAA
FADB_ECO24      VKGKAKKLTKDVET-PKQAAVLGAGIMGGGIAYQSAWKGVPVVMKDINDKSLTLGMTEAA
FADB_ESCF3      VKGKAKKLTKDVET-PKQAAVLGAGIMGGGIAYQSAWKGVPVVMKDINDKSLTLGMTEAA
FADB_ECO57      VKGKAKKLTKDVET-PKQAAVLGAGIMGGGIAYQSAWKGVPVIMKDINDKSLALGMTEAA
FADB_ECO5E      VKGKAKKLTKDVET-PKQAAVLGAGIMGGGIAYQSAWKGVPVIMKDINDKSLALGMTEAA
FADB_SHIDS      VKGKAKKLTKDVET-PKQAAVLGAGIMGGGIAYQSAWKGVPVVMKDINDKSLTLGMTEAA
FADB_ECOSM      VKGKAKKLTKDVET-PKQAAVLGAGIMGGGIAYQSAWKGVPVVMKDINDKSLTLGMTEAA
FADB_SHIFL      VKGKAKKLTKDVET-PKQAAVLGAGIMGGGIAYQSAWKGVPVVMKDINDKSLTLGMTEAA
FADB_SHIF8      VKGKAKKLTKDVET-PKQAAVLGAGIMGGGIAYQSAWKGVPVVMKDINDKSLTLGMTEAA
FADB_ECOHS      VKGKAKKLTKDVET-PKQAAVLGAGIMGGGIAYQSAWKGVPVVMKDINDKSLTLGMTEAA
FADB_ECOUT      VKGKAKKLTKDVET-PKQAAVLGAGIMGGGIAYQSAWKGVPVVMKDINDKSLTLGMTEAA
FADB_ECO45      VKGKAKKLTKDVET-PKQAAVLGAGIMGGGIAYQSAWKGVPVVMKDINDKSLTLGMTEAA
FADB_ECO81      VKGKAKKLTKDVET-PKQAAVLGAGIMGGGIAYQSAWKGVPVVMKDINDKSLTLGMTEAA
FADB_ECOL6      VKGKAKKLTKDVET-PKQAAVLGAGIMGGGIAYQSAWKGVPVVMKDINDKSLTLGMTEAA
FADB_ECOL5      VKGKAKKLTKDVET-PKQAAVLGAGIMGGGIAYQSAWKGVPVVMKDINDKSLTLGMTEAA
FADB_ECO27      VKGKAKKLTKDVET-PKQAAVLGTGIMGGGIAYQSAWKDVPVVMKDINDKSLTLGMTEAA
FADB_ECOLU      VKGKAKKLTKDVET-PKQAAVLGAGIMGGGIAYQSAWKGVPVVMKDINDKSLTLGMTEAA
FADB_ECO7I      VKGKAKKLTKDVET-PKQAAVLGAGIMGGGIAYQSAWKGVPVVMKDINDKSLTLGMTEAA
FADB_SALG2      VKGKAKKLTKDIET-PKQAAVLGAGIMGGGIAYQSAWKGVPVIMKDINDKSLNLGMTEAA
FADB_SALTI      VKGKAKKLTKDIET-PKQAAVLGAGIMGGGIAYQSAWKGVPVIMKDINDKSLNLGMTEAA
FADB_SALEP      VKGKAKKLTKDIET-PKQAAVLGAGIMGGGIAYQSAWKGVPVIMKDINDKSLNLGMTEAA
FADB_SALA4      VKGKAKKLTKDIET-PKQAAVLGAGIMGGGIAYQSAWKGVPVIMKDINDKSLNLGMTEAA
FADB_SALCH      VKGKAKKLTKDIET-PKQAAVLGAGIMGGGIAYQSAWKGVPVIMKDINDKSLNLGMTEAA
FADB_SALPB      VKGKAKKLTKDIET-PKQAAVLGAGIMGGGIAYQSAWKGVPVIMKDINDKSLNLGMTEAA
FADB_SALNS      VKGKAKKLTKDIET-PKQAAVLGAGIMGGGIAYQSAWKGVPVIMKDINDKSLNLGMTEAA
FADB_SALTY      VKGKAKKLTKDIET-PKQAAVLGAGIMGGGIAYQSAWKGVPVIMKDINDKSLNLGMTEAA
FADB_SALPA      VKGKAKKLTKDIET-PKQAAVLGAGIMGGGIAYQSAWKGVPVIMKDINDKSLNLGMTEAA
FADB_SALPK      VKGKAKKLTKDIET-PKQAAVLGAGIMGGGIAYQSAWKGVPVIMKDINDKSLNLGMTEAA
FADB_SALSV      VKGKAKKLTKDIET-PKQAAVLGAGIMGGGIAYQSAWKGVPVIMKDINDKSLNLGMTEAA
FADB_CITK8      VKGKAKKLTKDVET-PKQAAVLGAGIMGGGIAYQSAWKGVPVIMKDINDKSLTLGMTEAA
FADB_ENTCL      VKGKARQLTKNVET-PKHAAVLGAGIMGGGIAYQSAWKGVPVVMKDISEKSLTLGMTEAA
FADB_ENT38      VKGKAKQLTKNVEM-PKQAAVLGAGIMGGGIAYQSAWKGVPVIMKDINDKSLTLGMTEAA
FADB_KLEP3      VKAKAKKLTKDVET-PKHAAVLGAGIMGGGIAYQSAWKGVPVVMKDISDKSLTLGMTEAA
FADB_KLEP7      VKAKAKKLTKDVET-PKHAAVLGAGIMGGGIAYQSAWKGVPVVMKDISDKSLTLGMTEAA
FADB_CROS8      VKGLAKKLTKETET-PKQAAVLGAGIMGGGIAYQSAWKGVPVIMKDINEKSLTLGISEAS
FADB_PECAS      VKGKAKKLVGETPV-PQQAAVLGAGIMGGGIAYQSAFKGVPIRMKDINEKPLALGMNEAA
FADB_YERPE      VKAQAKKLSKGVAA-PKLAAVLGAGIMGGGIAYQSALKSVPVIMKDINENSLDLGMNEAA
FADB_YERPY      VKAQAKKLSKGVAA-PKLAAVLGAGIMGGGIAYQSALKSVPVIMKDINENSLDLGMNEAA
FADB_YERPP      VKAQAKKLSKGVAA-PKLAAVLGAGIMGGGIAYQSALKSVPVIMKDINENSLDLGMNEAA
FADB_YERPG      VKAQAKKLSKGVAA-PKLAAVLGAGIMGGGIAYQSALKSVPVIMKDINENSLDLGMNEAA
FADB_YERPA      VKAQAKKLSKGVAA-PKLAAVLGAGIMGGGIAYQSALKSVPVIMKDINENSLDLGMNEAA
FADB_YERPN      VKAQAKKLSKGVAA-PKLAAVLGAGIMGGGIAYQSALKSVPVIMKDINENSLDLGMNEAA
FADB_YERPS      VKAQAKKLSKGVAA-PKLAAVLGAGIMGGGIAYQSALKSVPVIMKDINENSLDLGMNEAA
FADB_YERPB      VKAQAKKLSKGVAA-PKLAAVLGAGIMGGGIAYQSALKSVPVIMKDINENSLDLGMNEAA
FADB_YERP3      VKAQAKKLSKGVAA-PKLAAVLGAGIMGGGIAYQSALKSVPVIMKDINENSLDLGMNEAA
FADB_YERE8      VKGQAKKLSKGVSA-PKQAAVLGAGIMGGGIAYQSALKGVPVIMKDINDKSLTLGMNEAA
FADB_SERP5      VKGQAKKLAKGIEA-PKQAAVLGAGIMGGGIAYQSALKGVPVVMKDISDKSLTLGMNEAA
FADB_PHOLL      VKGLAKKHLKEVTI-PEYAAVLGAGIMGGGIAYQSARKGIPVMMKDISQQSLELGMNEAA
FADB_ALIF1      VKSKAKQAIKNSEP-VTSAAVLGAGIMGGGIAYQSASKGVPVLMKDIAQQSLDLGMSEAS
FADB_ALIFM      VKSKAKQAIKNSEP-VTSAAVLGAGIMGGGIAYQSASKGVPVLMKDIAQQSLDLGMNEAS
FADB_ALISL      VKSKAKQAVKNSEP-VKNAAVLGAGIMGGGIAYQSASKGVPVLMKDIAQASLDLGMNEAS
FADB_PHOPR      IKGKAKKAAKEGQP-TKKGVVLGAGIMGGGIAYQSALKGVPVLMKDIAVPSLDLGMAEAA
FADB_VIBCH      IKGLAKQSAKAASQDTQHAAVLGAGIMGGGIAYQSALKGVPVLMKDIAPHSLELGMTEAA
FADB_VIBCM      IKGLAKQSAKAASQDTQHAAVLGAGIMGGGIAYQSALKGVPVLMKDIAPHSLELGMTEAA
FADB_VIBC3      IKGLAKQSAKAASQDTQHAAVLGAGIMGGGIAYQSALKGVPVLMKDIAPHSLELGMTEAA
FADB_VIBCB      IKGLAKKSAKSASKDTQRAAVLGAGIMGGGIAYQSALKGVPVLMKDIAQPSLDLGMTEAS
FADB_VIBPA      IKGIAKKAAKSASKDTERAAVLGAGIMGGGIAYQSALKGVPVLMKDIAQPSLDLGMTEAS
FADB_VIBVU      IKGIAKKAAKSANKETQRAAVLGAGIMGGGIAYQSALKGVPVIMKDIAQASLDLGMTEAS
FADB_VIBVY      IKGIAKKAAKSANKETQRAAVLGAGIMGGGIAYQSALKGVPVIMKDIAQASLDLGMTEAS
FADB_VIBTL      IKGLAKHAGKSANKATERAAVLGAGIMGGGIAYQSALKGVPVMMKDIAQASLELGMNEAS
FADB_AERHH      IKALAKKAAKQAAKATSHAAVLGAGIMGGGIAYQSASKGIPAVMKDINEKALALGMGEAT
FADB_AERS4      IKALAKKAAKQAAKATRHAAVLGAGIMGGGIAYQSASKGIPAVMKDINEKALALGMGEAT
FADB_SHEB8      VKGKAKKAGKLAKE-VNNAAVLGAGIMGGGIAYQSASKGTPIVMKDIAQPALDLGLNEAA
FADB_SHEB2      VKGKAKKAGKLAKE-VNNAAVLGAGIMGGGIAYQSASKGTPIVMKDIAQPALDLGLNEAA
FADB_SHEB9      VKGKAKKAGKLAKE-VNNAAVLGAGIMGGGIAYQSASKGTPIVMKDIAQPALDLGLNEAA
FADB_SHEB5      VKGKAKKAGKLAKE-VNNAAVLGAGIMGGGIAYQSASKGTPIVMKDIAQPALDLGLNEAA
FADB_SHEPC      VKGKAKKAGKLAKE-VKNAAVLGAGIMGGGIAYQSASKGTPIVMKDIAQPALDLGLNEAA
FADB_SHESW      VKGKAKKAGKLAKE-VKNAAVLGAGIMGGGIAYQSASKGTPIVMKDIAQPALDLGLNEAA
FADB_SHESA      VKGKAKKAGKLAKD-VKSAAVLGAGIMGGGIAYQSASKGTPIVMKDIAQPALDLGLGEAA
FADB_SHESR      VKGKAKKAGKLAKD-VKSAAVLGAGIMGGGIAYQSASKGTPIVMKDIAQPALDLGLGEAA
FADB_SHESM      VKGKAKKAGKLAKD-VKSAAVLGAGIMGGGIAYQSASKGTPIVMKDIAQPALDLGLGEAA
FADB_SHEON      VKGKAKKAGKLAKA-VNSAAVLGAGIMGGGIAYQSASKGTPIVMKDIAQPALDLGLNEAA
FADB_SHEFN      VKGKAKKAGKLAKD-VNQAAVLGAGIMGGGIAYQSASKGTPIVMKDIAQPALELGLNEAA
FADB_SHEHH      VKGKAKKAGKLAKK-VNSAAVLGAGIMGGGIAYQSASKGTPIVMKDIAQPALDLGLGEAA
FADB_SHEPA      VKGKAKKAGKLAKK-VNSAAVLGAGIMGGGIAYQSASKGTPIVMKDIAQPALDLGLGEAA
FADB_SHEPW      VKGKAKKAGKLAKK-VNSAAVLGAGIMGGGIAYQSASKGTPIVMKDIAQPALDLGLGEAS
FADB_SHESH      VKGKAKKAGKLAKN-IDTAAVLGAGIMGGGIAYQSASKGTPIIMKDIAQPALELGLGEAS
FADB_SHEWM      VKGKAKKAGKLAKN-VDSAAVLGAGIMGGGIAYQSASKGTPIVMKDIAQPALDLGLGEAS
FADB_SHEAM      VKGKAKKASKLAKD-IKHAAVLGAGIMGGGIAYQSASKGTPIVMKDINQAALDLGVNEAA
FADB_SHELP      VKGKAKKAAKQAQA-VNSAAVLGAGIMGGGIAYQSASKGTPIVMKDINQAALDLGLNEAA
FADB_COLP3      IKGKAKKASKLATKAVNKAAVLGAGIMGGGIAYQSAYKGTPIIMKDINDQALDLGLTTAT
FADB_IDILO      VKGKSKKYAKAATKEIKTAGVLGAGIMGGGIAYQSALKGVPAVMKDIKQDALDLGMKEAG
FADB_PSEF5      LKKKAKAYDEIAKD-VKQAAVLGAGIMGGGIAYQSASKGTPILMKDINEHGIEQGLAEAA
FADB_PSEPF      LKKKAKAYDEIAKD-VKQAAVLGAGIMGGGIAYQSASKGTPILMKDINEHGIEQGLAEAA
FADB_PSEFR      LKKKAKVYDKIAKD-VKQAAVLGAGIMGGGIAYQSASKGTPILMKDINEHGIEQGLAEAA
FADB_PSEP1      LKRKAKAHDEIAHD-VKQAAVLGAGIMGGGIAYQSAVKGTPILMKDIREEAIQLGLNEAS
FADB_PSEPK      LKRKAKAHDEIAHD-VKQAAVLGAGIMGGGIAYQSAVKGTPILMKDIREEAIQLGLNEAS
FADB_PSEPG      LKRKAKAHDEIAHD-VKQAAVLGAGIMGGGIAYQSAVKGTPILMKDIREEAIQLGLNEAS
FADB_PSEPW      LKRKAKAHDEIAHD-VKQAAVLGAGIMGGGIAYQSAVKGTPILMKDIREEAIQLGLNEAS
FADB_PSEPU      LKRKAKAHDEIAHD-VKQAAVLGAGIMGGGIAYQSAVKGTPILMKDIREEAIQLGLNEAS
FADB_PSEOL      LKRKAKAHDEIAHD-AKQAAVLGAGIMGGGIAYQSAVKGTPILMKDIREEAIQLGLNEAS
FADB_PSEE4      LKRKAKAHDEIAHD-VKQAAVLGAGIMGGGIAYQSAVKGTPILMKDIREEAIQLGLNEAS
FADB_PSE14      LKKKAKGYDAVAKD-VKQAAVLGAGIMGGGIAYQSAVKGTPILMKDIREEAIQLGLNEAS
FADB_PSESM      LKKKAKGYDEVARD-VKQAAVLGAGIMGGGIAYQSAVKGTPILMKDIREEAIQLGLNEAS
FADB_PSEU2      LKKKARGYDKIAKD-VKQAAVLGAGIMGGGIAYQSAVKGTPILMKDIREEAIQLGLNEAS
FADB_PSEAE      LKKKAKKYDEVAKD-VKLAAVLGAGIMGGGIAYQSALKGTPILMKDIREEGIQMGLNEAA
FADB_PSEAB      LKKKAKKYDEVAKD-VKLAAVLGAGIMGGGIAYQSALKGTPILMKDIREEGIQMGLNEAA
FADB_PSEA8      LKKKAKKYDEVAKD-VKLAAVLGAGIMGGGIAYQSALKGTPILMKDIREEGIQMGLNEAA
FADB_PSEA7      LKKKAKKYDEVAKD-VKLAAVLGAGIMGGGIAYQSALKGTPILMKDIREEGIQMGLNEAA
FADB_PSEMY      LKKKAKHHDEIARD-VKLAAVLGAGIMGGGIAYQSASKGTPILMKDIREEGIQMGLTEAS
FADB_PSEU5      LKKKAKAYDKQARD-VKLAAVLGAGIMGGGIAYQSAVKGTPILMKDIREEGIQMGLDEAS
FADB_ACIB5      VKKASKQHEKGAHP-VNQAAVLGAGIMGGGIAYQAASKGTPIIMKDIGNPQLALGMKEAN
FADB_ACIB3      VKKASKQHEKGAHP-VNQAAVLGAGIMGGGIAYQAASKGTPIIMKDIGNPQLALGMKEAN
FADB_ACIBY      VKKASKQHEKGAHP-VNQAAVLGAGIMGGGIAYQAASKGTPIIMKDIGNPQLALGMKEAN
FADB_ACIBC      VKKASKQHEKGAHP-VNQAAVLGAGIMGGGIAYQAASKGTPIIMKDIGNPQLALGMKEAN
FADB_ACIBS      VKKASKQHEKGAHP-VNQAAVLGAGIMGGGIAYQAASKGTPIIMKDIGNPQLALGMKEAN
FADB_ACIAD      IKKTSKKHEKGAHP-VNQAAVLGAGIMGGGIAYQAASKGTPIIMKDIGNPQLALGMQEAN
FADB_PSYA2      VKKLAKQHSKKAHE-INEAAVLGAGIMGGGIAYQAASKGLPIIMKDIKSEQLDLGMGEAS
FADB_PSYCK      VKKLAKQHSKKAHD-INEAAVLGAGIMGGGIAYQAASKGLPIIMKDIKSEQLDLGMGEAS
FADB_PSYWF      VKKLAKQHTKNAHD-INEAAVLGAGIMGGGIAYQAASKGLPIIMKDIKSEQLDLGMGEAS
                :*  ::            . ***:**********:* *. *  ****    :  *:  * 

FADB_ECO55      KLLNKQLERGKIDGLKLAGVISTIHPTLDYAGFDRVDVVVEAVVENPKVKKAVLAETEQK
FADB_ECOLC      KLLNKQLERGKIDGLKLAGVISTIHPTLDYAGFDRVDVVVEAVVENPKVKKAVLAETEQK
FADB_ECO8A      KLLNKQLERGKIDGLKLAGVISTIHPTLDYAGFDRVDVVVEAVVENPKVKKAVLAETEQK
FADB_SHIB3      KLLNKQLERGKIDGLKLAGVISTIHPTLDYAGFDRVDVVVEAVVENPKVKKAVLAETEQK
FADB_ECODH      KLLNKQLERGKIDGLKLAGVISTIHPTLDYAGFDRVDIVVEAVVENPKVKKAVLAETEQK
FADB_ECOLI      KLLNKQLERGKIDGLKLAGVISTIHPTLDYAGFDRVDIVVEAVVENPKVKKAVLAETEQK
FADB_SHISS      KLLNKQLERGKIDGLKLAGVISTIHPTLDYAGFDRVDIVVEAVVENPKVKKAVLAETEQK
FADB_ECOSE      KLLNKQLERGKIDGLKLAGVISTIHPTLDYAGFDRVDVVVEAVVENPKVKKAVLAETEQK
FADB_ECO24      KLLNKQLERGKIDGLKLAGVISTIHPTLDYAGFDRVDVVVEAVVENPKVKKAVLAETEQK
FADB_ESCF3      KLLNKQLERGKIDGLKLAGVISTIHPTLDYAGFDRVDVVVEAVVENPKVKKAVLAETEQK
FADB_ECO57      KLLNKQLERGKIDGLKLAGVISTIHPTLDYAGFERVDVVVEAIVENPKVKKAVLAETEQK
FADB_ECO5E      KLLNKQLERGKIDGLKLAGVISTIHPTLDYAGFERVDVVVEAIVENPKVKKAVLAETEQK
FADB_SHIDS      KLLNKQLERGKIDGLKLAGVISTIHPTLDYAGFDRVDVVVEAVVENPKVKKAVLAETEQK
FADB_ECOSM      KLLNKQLERGKIDGLKLAGVISTIHPTLDYAGFDRVDVVVEAVVENPKVKKAVLAETEQK
FADB_SHIFL      KLLNKQLERGKIDGLKLAGVISTIHPTLDYAGFDRVDIVVEAVVENPKVKKAVLAETEQK
FADB_SHIF8      KLLNKQLERGKIDGLKLAGVISTIHPTLDYAGFDRVDIVVEAVVENPKVKKAVLAETEQK
FADB_ECOHS      KLLNKQLERGKIDGLKLAGVISTIHPTLDYAGFDRVDVVVEAVVENPKVKKAVLAETEQK
FADB_ECOUT      KLLNKQLERGKIDGLKLAGVISTIHPTLDYAGFDRVDVVVEAVVENPKVKKAVLAETEQK
FADB_ECO45      KLLNKQLERGKIDGLKLAGVISTIHPTLDYAGFDRVDVVVEAVVENPKVKKAVLAETEQK
FADB_ECO81      KLLNKQLERGKIDGLKLAGVISTIHPTLDYAGFDRVDVVVEAVVENPKVKKAVLAETEQK
FADB_ECOL6      KLLNKQLERGKIDGLKLAGVISTIHPTLDYAGFDRVDVVVEAVVENPKVKKAVLAETEQK
FADB_ECOL5      KLLNKQLERGKIDGLKLAGVISTIHPTLDYAGFDRVDVVVEAVVENPKVKKAVLAETEQK
FADB_ECO27      KLLNKQLERGKIDGLKLAGVISTIHPTLDYAGFDRVDVVVEAVVENPKVKKAVLAETEQK
FADB_ECOLU      KLLNKQLERGKIDGLKLAGVISTIHPTLDYAGFDRVDIVVEAVVENPKVKKAVLAETEQK
FADB_ECO7I      KLLNKQLERGKIDGLKLAGVISTIHPTLDYAGFDRVDIVVEAVVENPKVKKAVLAETEQK
FADB_SALG2      KLLNKQLERGKIDGLKLAGVISTIHPTLDYAGFDRVDVVVEAVVENPKVKKAVLAETEQK
FADB_SALTI      KLLNKQLERGKIDGLKLAGVISTIHPTLDYAGFDRVDVVVEAVVENPKVKKAVLAETEQK
FADB_SALEP      KLLNKQLERGKIDGLKLAGVISTIHPTLDYAGFDRVDAVVEAVVENPKVKKAVLAETEQK
FADB_SALA4      KLLNKQLERGKIGGLKLAGVISTIHPTLDYAGFDRVDVVVEAVVENPKVKKAVLAETEQK
FADB_SALCH      KLLNKQLERGKIDGLKLAGVISTIHPTLDYAGFDRVDVVVEAVVENPKVKKAVLAETEQK
FADB_SALPB      KLLNKQLERGKIDGLKLAGVISTIHPTLDYAGFDRVDVVVEAVVENPKVKKAVLAETEQK
FADB_SALNS      KLLNKQLERGKIDGLKLAGVISTIHPTLDYAGFDRVDVVVEAVVENPKVKKAVLAETEQK
FADB_SALTY      KLLNKQLERGKIDGLKLAGVISTIHPTLDYAGFDRVDVVVEAVVENPKVKKAVLAETEQK
FADB_SALPA      KLLNKQLERGKIDGLKLAGVISTIHPTLDYAGFDRVDVVVEAVVENPKVKKAVLAETEQK
FADB_SALPK      KLLNKQLERGKIDGLKLAGVISTIHPTLDYAGFDRVDVVVEAVVENPKVKKAVLAETEQK
FADB_SALSV      KLLNKQLERGKIDGLKLAGVISTIHPTLDYAGFDRVDVVVEAVVENPKVKKAVLAETEQK
FADB_CITK8      KLLNKQLERGRIDGLKLAGVISTIHPTLNYAGFDRVDVVVEAVVENPKVKKAVLAETEDN
FADB_ENTCL      KLLNKQLERGKIDGLKLAGVISTIQPVLEYSGFDRVDVVVEAVVENPKVKKAVLAETEDK
FADB_ENT38      KLLNKQLERGKIDGLKLSGVISTIHPTLEYSGFDRVDVVVEAVVENPKIKKAVLAETEDK
FADB_KLEP3      KLLNKQLERGKIDGLKLAGVISTIQPTLEYSGFDRVDVVVEAVVENPKVKKAVLAETEAK
FADB_KLEP7      KLLNKQLERGKIDGLKLAGVISTIQPTLEYSGFDRVDVVVEAVVENPKVKKAVLAETESK
FADB_CROS8      KLLNKQLERGKIDGLKLAGVIATIHPTLDYAGFERADVVVEAVVENPKVKKAVLAETEEK
FADB_PECAS      KLLNKQMERGKLDGMKMATILANIHPTLDYAGFERTDIVVEAVVENPKIKASVLAETESH
FADB_YERPE      KLLNKQLERGKVDGLKMASILATIRPTLDYAGIERAQVIVEAVVENPKVKAAVLAEVEAL
FADB_YERPY      KLLNKQLERGKVDGLKMASILATIRPTLDYAGIERAQVIVEAVVENPKVKAAVLAEVEAL
FADB_YERPP      KLLNKQLERGKVDGLKMASILATIRPTLDYAGIERAQVIVEAVVENPKVKAAVLAEVEAL
FADB_YERPG      KLLNKQLERGKVDGLKMASILATIRPTLDYAGIERAQVIVEAVVENPKVKAAVLAEVEAL
FADB_YERPA      KLLNKQLERGKVDGLKMASILATIRPTLDYAGIERAQVIVEAVVENPKVKAAVLAEVEAL
FADB_YERPN      KLLNKQLERGKVDGLKMASILATIRPTLDYAGIERAQVIVEAVVENPKVKAAVLAEVEAL
FADB_YERPS      KLLNKQLERGKVDGLKMASILATIRPTLDYAGIERAQVIVEAVVENPKVKAAVLAEVEAL
FADB_YERPB      KLLNKQLERGKVDGLKMASILATIRPTLDYAGIERAQVIVEAVVENPKVKAAVLAEVEAL
FADB_YERP3      KLLNKQLERGKVDGLKMASILATIRPTLDYAGIERAQVIVEAVVENPKVKAAVLAEVEAL
FADB_YERE8      KLLNKQLERGKIDGLKMANILATIQPTLDYAGIERAQVIVEAVVENPKVKAAVLAEVETL
FADB_SERP5      KLLNKQLERGKLDGMKMAQVLSTIQPTLDYAGIERAQVIVEAVVENPKIKAAVLSEVEGL
FADB_PHOLL      KLLNKQFERGRLDAIKMARTLSSIQPTLNYAGIEQAQIVVEAVVENPKIKAAVLSETETL
FADB_ALIF1      KLLNKQLERGRLSGLKMAKVLSSITPSLNYASIENKDIVVEAVVENPKVKAAVLAEVENE
FADB_ALIFM      KLLNKQLERGRLSGLKMAQVLSSITPSLNYASIENKDIVVEAVVENPKIKAAVLAEVENE
FADB_ALISL      KLLNKQLERGRLSGLKMAQVLSSITPSLNYGGIETKDVIVEAVVENPTIKAAVLAEVENE
FADB_PHOPR      KLLNKQLERGRIDGVKMAKVLSGITPSLHYAGAEDADIVVEAVVENPKIKAAVLAEVESN
FADB_VIBCH      KLLNKQLERGKIDGFKMAGILASITPSLHYAGIDQADVIVEAVVENPKVKAAVLSEVEGL
FADB_VIBCM      KLLNKQLERGKIDGFKMAGILASITPSLHYAGIDQADVIVEAVVENPKVKAAVLSEVEGL
FADB_VIBC3      KLLNKQLERGKIDGFKMAGILASITPSLHYAGIDQADVIVEAVVENPKVKAAVLSEVEGL
FADB_VIBCB      KLLNKRLSRGRIDGFKMAGILASITPSLHYTGIEESDVIVEAVVENPKVKAAVLSEVESH
FADB_VIBPA      KLLNKRLAQGRIDGFKMAGILASITPSLHYAGIENSDVIVEAVVENPKVKATVLSEVESH
FADB_VIBVU      KLLNKQLERGKIDGFKMAGILASITPSLHYAGIDNADIIVEAVVENPKVKAAVLSEVEEQ
FADB_VIBVY      KLLNKQLERGKIDGFKMAGILASITPSLHYAGIDNADIIVEAVVENPKVKAAVLSEVEEQ
FADB_VIBTL      KLLNKRLSRGRLDGFKMAGILSSITPSLHYAGVEQSDVIVEAVVENPKVKAAVLSEVEGL
FADB_AERHH      KLLNGQLEKGRIDGIKMGQVLSAITPTLSYDNVKHVDVVVEAVVENPKVKAAVLGEVEGI
FADB_AERS4      KLLNGQLEKGRIDGIKMGQVLSAITPTLSYDNVKHVDLVVEAVVENPKVKAAVLGEVEGI
FADB_SHEB8      KLLSAQVARGRSTPEKMAKVLNNITPSLDYAAIKHSDVVVEAVVEHPKIKAQVLAEVEGY
FADB_SHEB2      KLLSAQVARGRSTPEKMAKVLNNITPSLDYAAIKHSDVVVEAVVEHPKIKAQVLAEVEGY
FADB_SHEB9      KLLSAQVARGRSTPEKMAKVLNNITPSLDYAAIKHSDVVVEAVVEHPKIKAQVLAEVEGY
FADB_SHEB5      KLLSAQVARGRSTPEKMAKVLNNITPSLDYAAIKHSDVVVEAVVEHPKIKAQVLAEVEGY
FADB_SHEPC      KLLSAQVARGRSTPEKMAKVLNNITPSLDYAALKHSDVVVEAVVEHPKIKAQVLAEVEGY
FADB_SHESW      KLLSAQVARGRSTPEKMAKVLNNITPSLDYAALKHSDVVVEAVVEHPKIKAQVLAEVEGY
FADB_SHESA      KLLSAQVARGRSTPEKMAKVLNNITPALDYAPVKHADVVVEAVVEHPKVKAQVLAEVEQY
FADB_SHESR      KLLSAQVARGRSTPEKMAKVLNNITPALDYAPVNHADVVVEAVVEHPKVKAQVLAEVEQY
FADB_SHESM      KLLSAQVARGRSTPEKMAKVLNNITPALDYAPVKHADVVVEAVVEHPKVKAQVLAEVEQY
FADB_SHEON      KLLSAQVARGRSTPEKMAKVLNNITPALEYAPVKHADVVVEAVVEHPKVKAQVLAEVEQY
FADB_SHEFN      KILTTQVARGRSTPEKMAKVLNNITPSLDYAAIKNSDIVVEAVVEHPKVKATVLAEVEGY
FADB_SHEHH      KLLTAQVKRGRSTPAKMATVLNNITPALDYAPVKDTDIIVEAVVEHPKVKSMVLAEVEEH
FADB_SHEPA      KLLTAQVKRGRSTPAKMAAVLNNITPALDYAPVKDADVVVEAVVEHPKVKSMVLAEVEQH
FADB_SHEPW      KLLAAQVKRGRSNPAKMAAVLNNITPALDYAPVKAADVVVEAVVEHPKVKSMVLAEVEEH
FADB_SHESH      KLLAAQIKRGRSTPQKMAKVLNNITATLDYTPVKDVDVVVEAVVEHPKVKSMVLAEVEQN
FADB_SHEWM      KLLAAQIKRGRSTPEKMAKVLNNITATLDYAPVKDVDVVVEAVVEHPKVKSMVLAEVEQN
FADB_SHEAM      KLLSAQVARGRSTPDKMAKVLNNITPALDYAPLKDVNVVVEAVVENPKVKAMVLADVENV
FADB_SHELP      KLLTAQINRGRSTPAKMAGVLNNITATLDYNALKQADVVVEAVVEHPKVKATVLAEVEQV
FADB_COLP3      GILTKQVERGRMNAKKMAGVLNNITPSLSYDSVKDVDIVVEAVVENPKVKGMVLAEVEGV
FADB_IDILO      KILKKGVERGKVNNEKMIKILSSITPTLLNDAVKDVDIVVEAVVENPKVKGSVLAEIEGV
FADB_PSEF5      KLLVGRVDKGRMTAAKMAEVLNGIRPTLSYGDFGNVDLVVEAVVENPKVKQIVLAEVEGQ
FADB_PSEPF      KLLVGRVDKGRMTAAKMAEVLNGIRPTLSYGDFGHVDLVVEAVVENPKVKQAVLAEVEDK
FADB_PSEFR      KLLVGRVDKGRMTPAKMAEVLNGIRPTLSYGDFGNVDLVVEAVVENPKVKQAVLAEVENH
FADB_PSEP1      KLLGNRVEKGRLTPAKMAEALNAIRPTLSYGDFANVDIVVEAVVENPKVKQAVLAEVEGQ
FADB_PSEPK      KLLGNRVEKGRLTPAKMAEALNAIRPTLSYGDFANVDIVVEAVVENPKVKQAVLAEVEGQ
FADB_PSEPG      KLLGNRVEKGRLTPAKMAEALNAIRPTLSYGDFANVDIVVEAVVENPKVKQAVLAEVEGQ
FADB_PSEPW      KLLGNRVEKGRLTPAKMAEALNAIRPTLSYGDFANVDIVVEAVVENPKVKQAVLAEVEGQ
FADB_PSEPU      KLLGNRVDKGRLTPAKMAEALNAIRPTLSYGDFANVDIVVEAVVENPKVKQAVLAEVEGQ
FADB_PSEOL      KLLGNRVEKGRLTPAKMAEALNAIRPTLSYGDFANVDIVVEAVVENPKVKQAVLAEVETQ
FADB_PSEE4      KLLGKRVEKGRLTPAKMAEALNAIRPTLSYGDFGNVDIVVEAVVENPKVKQAVLAEVEGQ
FADB_PSE14      KLLGGRLEKGRLTAAKMAEALNAIRPTLSYGDFGNVDLVVEAVVENPKVKQAVLAEVEAN
FADB_PSESM      KLLGGRLEKGRLTAAKMAEALNAIRPTLSYGDFGNVDLVVEAVVENPKVKQAVLAEVEAN
FADB_PSEU2      KLLGGRLEKGRLTAAKMAEALNAIRPTLSYGDFGNVDLVVEAVVENPKVKQAVLAEVEAN
FADB_PSEAE      KLLGKRVEKGRLTPAKMAEALNGIRPTMSYGDFGNVDIVVEAVVENPKVKQAVLAEVEGA
FADB_PSEAB      KLLGKRVEKGRLTPAKMAEALNGIRPTMSYGDFGNVDIVVEAVVENPKVKQAVLAEVEGA
FADB_PSEA8      KLLGKRVEKGRLTPAKMAEALNGIRPTMSYGDFGNVDIVVEAVVENPKVKQAVLAEVEGA
FADB_PSEA7      KLLGKRVEKGRLTPAKMAEALNGIRPTMSYGDFGNVDIVVEAVVENPKVKQAVLAEVEGA
FADB_PSEMY      KLLGKRVEKGRMTPAKMAEALNAIRPTMSYGDFGNVDIVVEAVVENPKVKQIVLAEVEDV
FADB_PSEU5      KLLGKRVEKGRLTPEKMAQALNAIRPTMSYGDFGNVDIVVEAVVENPKVKHAVLAEVEGH
FADB_ACIB5      NLLTKQVERKKMKPVQMGETLARIRPTLSYEEFKEVDIVIEAVTENPKVKEIVLAETEKN
FADB_ACIB3      NLLTKQVERKKMKPVQMGETLARIRPTLSYEEFKEVDIVIEAVTENPKVKEIVLAETEKN
FADB_ACIBY      NLLTKQVERKKMKPVQMGETLARIRPTLSYEEFKEVDIVIEAVTENPKVKEIVLAETEKN
FADB_ACIBC      NLLTKQVERKKMKPAQMGETLARIRPTLSYEEFKEVDIVIEAVTENPKVKEIVLAETEKN
FADB_ACIBS      NLLTKQVERKKMKPAQMGETLARIRPTLSYEEFKEVDIVIEAVTENPKVKEIVLAETEKN
FADB_ACIAD      GLLTKQVERKKLTPAKMGETLARIRPTLSYDEFKEVDIVIEAVTENPKIKEAVLADTEAK
FADB_PSYA2      KLLGKMVDRGKMTPAKMGETLSRIRPTLNYGDFAETDIVIEAVVENPNVKRAVLKEVEGL
FADB_PSYCK      KLLGKMVDRGKITPAKMGETLSRIRPTLNYGDFAETDIVIEAVVENPNVKRAVLKEVEGL
FADB_PSYWF      KLLGKMVERKKMTPAQMGETLSRIRPTLNYGDFGETDIVIEAVVENPKVKHAVLKEVEGL
                 :*   . : :    ::   :  * . :        : ::**:.*:*.:*  ** : *  

FADB_ECO55      VRPDTVLASNTSTIPISELANALERPENFCGMHFFNPVHRMPLVEIIRGEKSSDETIAKV
FADB_ECOLC      VRPDTVLASNTSTIPISELANALERPENFCGMHFFNPVHRMPLVEIIRGEKSSDETIAKV
FADB_ECO8A      VRPDTVLASNTSTIPISELANALERPENFCGMHFFNPVHRMPLVEIIRGEKSSDETIAKV
FADB_SHIB3      VRPDTVLASNTSTIPISELANALERPENFCGMHFFNPVHRMPLVEIIRGEKSSDETIAKV
FADB_ECODH      VRQDTVLASNTSTIPISELANALERPENFCGMHFFNPVHRMPLVEIIRGEKSSDETIAKV
FADB_ECOLI      VRQDTVLASNTSTIPISELANALERPENFCGMHFFNPVHRMPLVEIIRGEKSSDETIAKV
FADB_SHISS      VRQDTVLASNTSTIPISELANALERPENFCGMHFFNPVHRMPLVEIIRGEKSSDETIAKV
FADB_ECOSE      VRPDTVLASNTSTIPISELANALERPENFCGMHFFNPVHRMPLVEIIRGEKSSDETIAKV
FADB_ECO24      VRPDTVLASNTSTIPISELANALERPENFCGMHFFNPVHRMPLVEIIRGEKSSDETIAKV
FADB_ESCF3      VRPDTVLASNTSTIPISELANALERPENFCGMHFFNPVHRMPLVEIIRGEKSSDETIAKV
FADB_ECO57      VRPDTVLASNTSTIPISELANALERPENFCGMHFFNPVHRMPLVEIIRGEKSSDETIAKV
FADB_ECO5E      VRPDTVLASNTSTIPISELANALERPENFCGMHFFNPVHRMPLVEIIRGEKSSDETIAKV
FADB_SHIDS      VRPDTVLASNTSTIPISELANALERPENFCGMHFFNPVHRMPLVEIIRGEKSSDETIAKV
FADB_ECOSM      VRPDTVLASNTSTIPISELANALERPENFCGMHFFNPVHRMPLVEIIRGEKSSDETIAKV
FADB_SHIFL      VRQDTVLASNTSTIPISELANALERPENFCGMHFFNPVHRMPLVEIIRGEKSSDETIAKV
FADB_SHIF8      VRQDTVLASNTSTIPISELANALERPENFCGMHFFNPVHRMPLVEIIRGEKSSDETIAKV
FADB_ECOHS      VRQDTVLASNTSTIPISELANALERPENFCGMHFFNPVHRMPLVEIIRGEKSSDETIAKV
FADB_ECOUT      VRPDTVLASNTSTIPISELANALERPENFCGMHFFNPVHRMPLVEIIRGEKSSDETIAKV
FADB_ECO45      VRPDTVLASNTSTIPISELANALERPENFCGMHFFNPVHRMPLVEIIRGEKSSDETIAKV
FADB_ECO81      VRPDTVLASNTSTIPISELANALERPENFCGMHFFNPVHRMPLVEIIRGEKSSDETIAKV
FADB_ECOL6      VRPDTVLASNTSTIPISELANALERPENFCGMHFFNPVHRMPLVEIIRGEKSSDETIAKV
FADB_ECOL5      VRPDTVLASNTSTIPISELANALERPENFCGMHFFNPVHRMPLVEIIRGEKSSDETIAKV
FADB_ECO27      VRPDTVLASNTSTIPISELANALERPENFCGMHFFNPVHRMPLVEIIRGEKSSDETIAKV
FADB_ECOLU      VRPDTVLASNTSTIPISELANALERPENFCGMHFFNPVHRMPLVEIIRGEKSSDETIAKV
FADB_ECO7I      VRPDTVLASNTSTIPISELANALERPENFCGMHFFNPVHRMPLVEIIRGEKSSDETIAKV
FADB_SALG2      VRPETVLASNTSTIPIGELASALERPENFCGMHFFNPVHRMPLVEIIRGEKSSDETIAKV
FADB_SALTI      VRPETVLASNTSTIPIGELASALERPENFCGMHFFNPVHRMPLVEIIRGEKSSDETIAKV
FADB_SALEP      VRPETVLASNTSTIPIGELASALERPENFCGMHFFNPVHRMPLVEIIRGEKSSDETIAKV
FADB_SALA4      VRPETVLASNTSTIPIGELASALERPENFCGMHFFNPVHRMPLVEIIRGEKSSDETIAKV
FADB_SALCH      VRPETVLASNTSTIPIGELASALERPENFCGMHFFNPVHRMPLVEIIRGEKSSDETIAKV
FADB_SALPB      VRPETVLASNTSTIPIGELASALERPENFCGMHFFNPVHRMPLVEIIRGEKSSDETIAKV
FADB_SALNS      VRPETVLASNTSTIPIGELASALEHPENFCGMHFFNPVHRMPLVEIIRGEKSSDETIAKV
FADB_SALTY      VRPETVLASNTSTIPIGELASALERPENFCGMHFFNPVHRMPLVEIIRGEKSSDETIAKV
FADB_SALPA      VRPETVLASNTSTIPIGELASALERPENFCGMHFFNPVHRMPLVEIIRGEKSSDETIAKV
FADB_SALPK      VRPETVLASNTSTIPIGELASALERPENFCGMHFFNPVHRMPLVEIIRGEKSSDETIAKV
FADB_SALSV      VRPETVLASNTSTIPIRELASALERPENFCGMHFFNPVHRMPLVEIIRGEKSSDETIAKV
FADB_CITK8      VRPDTVLASNTSTIPISELASALKRPENFCGMHFFNPVHRMPLVEIIRGEKSSDETIAKV
FADB_ENTCL      VRPETVLASNTSTIPISELASVLKRPENFCGMHFFNPVHRMPLVEVIRGEKTSDETIAKV
FADB_ENT38      VRPDTVLASNTSTIPIGELASVLKRPENFCGMHFFNPVHRMPLVEVIRGEKTSDETIAKV
FADB_KLEP3      VRPDTVLASNTSTIPISELASVLQRPENFCGMHFFNPVHRMPLVEVIRGEKTSDKTIAKV
FADB_KLEP7      VRPDTVLASNTSTIPISELASVLQRPENFCGMHFFNPVHRMPLVEVIRGEKTSDNTIAKV
FADB_CROS8      VRPDTVIASNTSTIPISELASVLKRPENFCGMHFFNPVHRMPLVEVIRGEKTSDATIAKV
FADB_PECAS      ISESTILASNTSTIPIAVLAAALKRPQNFCGMHFFNPVHRMPLVEIIRGPKTSDSTIASV
FADB_YERPE      IGEDTVLASNTSTIPIDQLAKSLKRPENFCGMHFFNPVHRMPLVEIIRGAKTSDKTLAAV
FADB_YERPY      IGEDTVLASNTSTIPIDQLAKSLKRPENFCGMHFFNPVHRMPLVEIIRGAKTSDKTLAAV
FADB_YERPP      IGEDTVLASNTSTIPIDQLAKSLKRPENFCGMHFFNPVHRMPLVEIIRGAKTSDKTLAAV
FADB_YERPG      IGEDTVLASNTSTIPIDQLAKSLKRPENFCGMHFFNPVHRMPLVEIIRGAKTSDKTLAAV
FADB_YERPA      IGEDTVLASNTSTIPIDQLAKSLKRPENFCGMHFFNPVHRMPLVEIIRGAKTSDKTLAAV
FADB_YERPN      IGEDTVLASNTSTIPIDQLAKSLKRPENFCGMHFFNPVHRMPLVEIIRGAKTSDKTLAAV
FADB_YERPS      IGEDTVLASNTSTIPIDQLAKSLKRPENFCGMHFFNPVHQMPLVEIIRGAKTSDKTLAAV
FADB_YERPB      IGEDTVLASNTSTIPIDQLAKSLKRPENFCGMHFFNPVHQMPLVEIIRGAKTSDKTLAAV
FADB_YERP3      IGEDTVLASNTSTIPIDQLAKSLKRPENFCGMHFFNPVHRMPLVEIIRGAKTSDKTLAAV
FADB_YERE8      IGEETVLASNTSTIPIDQLAKSLKRPENFCGMHFFNPVHRMPLVEIIRGTKTSDKTIAAV
FADB_SERP5      IGENTVLASNTSTIPINHLAKSLKRPQNFCGMHFFNPVHRMPLVEIIRGEQTSDSTIAAV
FADB_PHOLL      VNEDCVLASNTSTIPISELAKSLKRPENFCGMHFFNPVHRMPLVEVIRGEKTSEKTISTV
FADB_ALIF1      VNEHAILASNTSTIPISLLAKSLKRPENFCGMHFFNPVHRMPLVEVIRGEKTSQQTIDRV
FADB_ALIFM      VNEHAILASNTSTIPISLLAKSLKRPENFCGMHFFNPVHRMPLVEVIRGEKTSQQTIDRV
FADB_ALISL      VNEHAILASNTSTIPISLLAKSLKRPENFCGMHFFNPVHRMPLVEVIRGEKTSQQTIDRV
FADB_PHOPR      VSDTTVIASNTSTIPINLLAQSLKRPENFCGMHFFNPVHRMPLVEIIRGEHTSEETISRV
FADB_VIBCH      VDTETILTSNTSTIPINLLAKSLKRPQNFCGMHFFNPVHRMPLVEIIRGEHTSEDTINRV
FADB_VIBCM      VDTETILTSNTSTIPINLLAKSLKRPQNFCGMHFFNPVHRMPLVEIIRGEHTSEDTINRV
FADB_VIBC3      VDAETILTSNTSTIPINLLAKSLKRPQNFCGMHFFNPVHRMPLVEIIRGEHTSEDTINRV
FADB_VIBCB      VGEDTVITSNTSTIPINLLAKSLKRPENFCGMHFFNPVHRMPLVEIIRGEHTSDETINRV
FADB_VIBPA      VGEDTVITSNTSTIPINLLAQSLKRPENFCGMHFFNPVHRMPLVEIIRGEKTSDETINRV
FADB_VIBVU      VSEETVLTSNTSTIPINLLAKSLKRPENFCGMHFFNPVHRMPLVEIIRGEHTSDETINRV
FADB_VIBVY      VSEETVLTSNTSTIPINLLAKSLKRPENFCGMHFFNPVHRMPLVEIIRGEHTSDETINRV
FADB_VIBTL      VGEDTVLTSNTSTIPINLLAKSLKRPENFCGMHFFNPVHRMPLVEIIRGEHTSEETINRV
FADB_AERHH      IGEDAVLASNTSTIPISLLAKELKRPQNFCGMHFFNPVHRMPLVEIIRGEQTSDETINRV
FADB_AERS4      IGDDAVLASNTSTIPISLLAKGLKRPQNFCGMHFFNPVHRMPLVEIIRGEQTSDETINRV
FADB_SHEB8      VSEDAIIASNTSTISINLLAKSMKKPERFCGMHFFNPVHKMPLVEVIRGEHSSEETIASV
FADB_SHEB2      VSEDAIIASNTSTISINLLAKSMKKPERFCGMHFFNPVHKMPLVEVIRGEHSSEETIASV
FADB_SHEB9      VSEDAIIASNTSTISINLLAKSMKKPERFCGMHFFNPVHKMPLVEVIRGEHSSEETIASV
FADB_SHEB5      VSEDAIIASNTSTISINLLAKSMKKPERFCGMHFFNPVHKMPLVEIIRGEHSSEETIASV
FADB_SHEPC      VSEDAIIASNTSTISINLLAKSMKKPERFCGMHFFNPVHKMPLVEVIRGEHSSEETIASV
FADB_SHESW      VSEDAIIASNTSTISINLLAKSMKKPERFCGMHFFNPVHKMPLVEVIRGEHSSEETIASV
FADB_SHESA      VSEDAIIASNTSTISINLLAKSMKKPERFCGMHFFNPVHKMPLVEVIRGEHSSEETIASV
FADB_SHESR      VSEDAIIASNTSTISINLLAKSMKKPERFCGMHFFNPVHKMPLVEVIRGEHSSEETIASV
FADB_SHESM      VSEDAIIASNTSTISINLLAKSMKKPERFCGMHFFNPVHKMPLVEVIRGEHSSEETIASV
FADB_SHEON      VSEDAIIASNTSTISISLLAKSMKKPERFCGMHFFNPVHKMPLVEVIRGEHSSEETIASV
FADB_SHEFN      VSEDAIIASNTSTISINLLAKSLKKPERFCGMHFFNPVHKMPLVEIIRGEHSSEETIATV
FADB_SHEHH      VSEDAIITSNTSTISINLLAKSLKKPERFCGMHFFNPVHKMPLVEVIRGENSSDETVASV
FADB_SHEPA      VSEDAIITSNTSTISINLLAKSLKKPERFCGMHFFNPVHKMPLVEVIRGENSSDETVASV
FADB_SHEPW      VSEDAIITSNTSTISINLLAKSLKKPERFCGMHFFNPVHKMPLVEVIRGEHSSDETVASV
FADB_SHESH      VSDDAIITSNTSTISINLLAKSLKKPERFCGMHFFNPVHKMPLVEVIRGENSSEETIASV
FADB_SHEWM      VSDDAIITSNTSTISINLLAKSLKKPERFCGMHFFNPVHKMPLVEVIRGENSSEETIASV
FADB_SHEAM      VADDAIIASNTSTISIDLLAKSLKNPARFCGMHFFNPVHKMPLVEVIRGKDTSEETVASV
FADB_SHELP      VGEDAIITSNTSTISINLLAKSLQKPERFCGMHFFNPVHKMPLVEVIRGEHSSEETVASV
FADB_COLP3      IGEDAILTSNTSTISIDLLAQSVKRPQNFCGMHFFNPVNKMPLVEVIRGKDTSDETVAAV
FADB_IDILO      IGDDAILTSNTSTISITELAKNLKRPEKFCGMHFFNPVHKMPLVEIIRGEKTSDDTVNAV
FADB_PSEF5      VKEDTILASNTSTISISLLAKALKRPENFVGMHFFNPVHMMPLVEVIRGEKSSELAVATT
FADB_PSEPF      VKEDTILASNTSTISISLLAKALKRPENFVGMHFFNPVHMMPLVEVIRGEKSSELAIATT
FADB_PSEFR      VREDAILASNTSTISISLLAKALKRPENFVGMHFFNPVHMMPLVEVIRGEKSSDLAVATT
FADB_PSEP1      VKDDAILASNTSTISINLLAKALKRPENFVGMHFFNPVHMMPLVEVIRGEKSSDVAVATT
FADB_PSEPK      VKDDAILASNTSTISINLLAKALKRPENFVGMHFFNPVHMMPLVEVIRGEKSSDVAVATT
FADB_PSEPG      VKDDAILASNTSTISINLLAKALKRPENFVGMHFFNPVHMMPLVEVIRGEKSSEVAVATT
FADB_PSEPW      VKEDAILASNTSTISINLLAKALKRPENFVGMHFFNPVHMMPLVEVIRGEKSSEVAVATT
FADB_PSEPU      VKEDAILASNTSTISINLLAKALKRPENFVGMHFFNPVHMMPLVEVIRGEKSSEVAVATT
FADB_PSEOL      VKDDAILASNTSTISINLLAKALKRPENFVGMHFFNPVHMMPLVEVIRGEKSSEVAVATT
FADB_PSEE4      VKEDAILASNTSTISINLLAKALKRPENFVGMHFFNPVHMMPLVEVIRGEKSSEVAVATT
FADB_PSE14      VGEHTILASNTSTISISLLAKALKRPENFVGMHFFNPVHMMPLVEVIRGEKSSEEAVATT
FADB_PSESM      VGENTILASNTSTISISLLAQALKRPENFVGMHFFNPVHMMPLVEVIRGEKSSEEAVATT
FADB_PSEU2      VGENTILASNTSTISISLLAQALKRPENFVGMHFFNPVHMMPLVEVIRGEKSSEEAVATT
FADB_PSEAE      VKEDAIIASNTSTISISLLAQALKRPENFCGMHFFNPVHMMPLVEVIRGEKTGETAIATT
FADB_PSEAB      VKEDAIIASNTSTISISLLAQALKRPENFCGMHFFNPVHMMPLVEVIRGEKTGETAIATT
FADB_PSEA8      VKEDAIIASNTSTISISLLAQALKRPENFCGMHFFNPVHMMPLVEVIRGEKTGETAIATT
FADB_PSEA7      VKEDAIIASNTSTISISLLAQALKRPENFCGMHFFNPVHMMPLVEVIRGEKTGETAIATT
FADB_PSEMY      VREDAILASNTSTISISLLAQALKRPENFVGMHFFNPVHMMPLVEVIRGEKSSEVAVATT
FADB_PSEU5      VREDAIIASNTSTISISYLAQALKRPENFCGMHFFNPVHMMPLVEVIRGEKTSETAIATT
FADB_ACIB5      VRENTIIASNTSTISITRLAKALQRPENFVGMHFFNPVHMMPLVEVIRGEKTSEEAIATT
FADB_ACIB3      VRENTIIASNTSTISITRLAKALQRPENFVGMHFFNPVHMMPLVEVIRGEKTSEEAIATT
FADB_ACIBY      VRENTIIASNTSTISITRLAKALQRPENFVGMHFFNPVHMMPLVEVIRGEKTSEEAIATT
FADB_ACIBC      VRENTIIASNTSTISITRLAKALQRPENFVGMHFFNPVHMMPLVEVIRGEKTSEEAIATT
FADB_ACIBS      VRENTIIASNTSTISITRLAKALQRPENFVGMHFFNPVHMMPLVEVIRGEKTSEEAIATT
FADB_ACIAD      VRDNTIIASNTSTISITRLAKALKRPENFVGMHFFNPVHMMPLVEVIRGEQTSEEAVATT
FADB_PSYA2      VKDDCILASNTSTISITFLAEALERPENFVGMHFFNPVHRMPLVEVIRGEKSSEEAIATT
FADB_PSYCK      VKDDCILASNTSTISITFLAEALERPENFVGMHFFNPVNRMPLVEVIRGEKSSEEAISTT
FADB_PSYWF      VKDNAILASNTSTISITYLATVLERPENFVGMHFFNPVHRMPLVEVIRGEKSSEEAIATT
                :    :::******.*  **  ::.* .* ********: *****:*** .:.: ::  .

FADB_ECO55      VAWASKMGKTPIVVNDCPGFFVNRVLFPYFAGFSQLLRDGADFRKIDKVMEKQFGWPMGP
FADB_ECOLC      VAWASKMGKTPIVVNDCPGFFVNRVLFPYFAGFSQLLRDGADFRKIDKVMEKQFGWPMGP
FADB_ECO8A      VAWASKMGKTPIVVNDCPGFFVNRVLFPYFAGFSQLLRDGADFRKIDKVMEKQFGWPMGP
FADB_SHIB3      VAWASKMGKTPIVVNDCPGFFVNRVLFPYFAGFSQLLRDGADFRKIDKVMEKQFGWPMGP
FADB_ECODH      VAWASKMGKTPIVVNDCPGFFVNRVLFPYFAGFSQLLRDGADFRKIDKVMEKQFGWPMGP
FADB_ECOLI      VAWASKMGKTPIVVNDCPGFFVNRVLFPYFAGFSQLLRDGADFRKIDKVMEKQFGWPMGP
FADB_SHISS      VAWASKMGKTPIVVNDCPGFFVNRVLFPYFAGFSQLLRDGADFRKIDKVMEKQFGWPMGP
FADB_ECOSE      VAWASKMGKTPIVVNDCPGFFVNRVLFPYFAGFSQLLRDGADFRKIDKVMEKQFGWPMGP
FADB_ECO24      VAWASKMGKTPIVVNDCPGFFVNRVLFPYFAGFSQLLRDGADFRKIDKVMEKQFGWPMGP
FADB_ESCF3      VAWASKMGKTPIVVNDCPGFFVNRVLFPYFAGFSQLLRDGADFRKIDKVMEKQFGWPMGP
FADB_ECO57      VAWASKMGKTPIVVNDCPGFFVNRVLFPYFAGFSQLLRDGADFRKIDKVMEKQFGWPMGP
FADB_ECO5E      VAWASKMGKTPIVVNDCPGFFVNRVLFPYFAGFSQLLRDGADFRKIDKVMEKQFGWPMGP
FADB_SHIDS      VAWASKMGKTPIVVNDCPGFFVNRVLFPYFAGFSQLLRDGADFRKIDKVMEKQFGWPMGP
FADB_ECOSM      VAWASKMGKTPIVVNDCPGFFVNRVLFPYFAGFSQLLRDGADFRKIDKVMEKQFGWPMGP
FADB_SHIFL      VAWASKMGKTPIVVNDCPGFFVNRVLFPYFAGFSQLLRDGADFRKIDKVMEKQFGWPMGP
FADB_SHIF8      VAWASKMGKTPIVVNDCPGFFVNRVLFPYFAGFSQLLRDGADFRKIDKVMEKQFGWPMGP
FADB_ECOHS      VAWASKMGKTPIVVNDCPGFFVNRVLFPYFAGFSQLLRDGADFRKIDKVMEKQFGWPMGP
FADB_ECOUT      VAWASKMGKTPIVVNDCPGFFVNRVLFPYFAGFSQLLRDGAGFRKIDKVMEKQFGWPMGP
FADB_ECO45      VAWASKMGKTPIVVNDCPGFFVNRVLFPYFAGFSQLLRDGAGFRKIDKVMEKQFGWPMGP
FADB_ECO81      VAWASKMGKTPIVVNDCPGFFVNRVLFPYFAGFSQLLRDGAGFRKIDKVMEKQFGWPMGP
FADB_ECOL6      VAWASKMGKTPIVVNDCPGFFVNRVLFPYFAGFSQLLRDGADFRKIDKVMEKQFGWPMGP
FADB_ECOL5      VAWASKMGKTPIVVNDCPGFFVNRVLFPYFAGFSQLLRDGADFRKIDKVMEKQFGWPMGP
FADB_ECO27      VAWASKMGKTPIVVNDCPGFFVNRVLFPYFAGFSQLLRDGADFRKIDKVMEKQFGWPMGP
FADB_ECOLU      VAWASKMGKTPIVVNDCPGFFVNRVLFPYFAGFSQLLRDGADFRKIDKVMEKQFGWPMGP
FADB_ECO7I      VAWASKMGKTPIVVNDCPGFFVNRVLFPYFAGFSQLLRDGADFRKIDKVMEKQFGWPMGP
FADB_SALG2      VAWASKMGKTPIVVNDCPGFFVNRVLFPYFAGFSQLLRDGADFRKVDKVMEKQFGWPMGP
FADB_SALTI      VAWASKMGKTPIVVNNCPGFFVNRVLFPYFAGFSQLLRDGADFRKVDKVMEKQFGWPMGP
FADB_SALEP      VAWASKMGKTPIVVNDCPGFFVNRVLFPYFAGFSQLLRDGADFRKVDKVMEKQFGWPMGP
FADB_SALA4      VAWASKMGKTPIVVNDCPGFFVNRVLFPYFAGFSQLLRDGADFRKVDKVMEKQFGWPMGP
FADB_SALCH      VAWASKMGKTPIVVNDCPGFFVNRVLFPYFAGFSQLLRDGADFRKVDKVMEKQFGWPMGP
FADB_SALPB      VAWASKMGKTPIVVNDCPGFFVNRVLFPYFAGFSQLLRDGADFRKVDKVMEKQFGWPMGP
FADB_SALNS      VAWASKMGKTPIVVNDCPGFFVNRVLFPYFAGFSQLLRDGADFRKVDKVMEKQFGWPMGP
FADB_SALTY      VAWASKMGKTPIVVNDCPGFFVNRVLFPYFAGFSQLLRDGADFRKVDKVMEKQFGWPMGP
FADB_SALPA      IAWASKMGKTPIVVNDCPGFFVNRVLFPYFAGFSQLLRDGADFRKVDKVMEKQFGWPMGP
FADB_SALPK      IAWASKMGKTPIVVNDCPGFFVNRVLFPYFAGFSQLLRDGADFRKVDKVMEKQFGWPMGP
FADB_SALSV      VAWASKMGKTPIVVNDCPGFFVNRVLFPYFAGFSQLLRDGADFRKVDKVMEKQFGWPMGP
FADB_CITK8      VAWASKMGKTPIVVNDCPGFFVNRVLFPYFAGFSQLLRDGADFRKVDKVMEKQFGWPMGP
FADB_ENTCL      VAWASKMGKTPIVVNDCPGFFVNRVLFPYFAGFSQLLRDGADFRKIDKVMEKQFGWPMGP
FADB_ENT38      VAWASKMGKTPIVVNDCPGFFVNRVLFPYFAGFSQLLRDGADFRKVDKVMEKQFGWPMGP
FADB_KLEP3      VAWASKMGKTPIVVNDCPGFFVNRVLFPYFAGFSQLLRDGADFRKVDKVMEKQFGWPMGP
FADB_KLEP7      VAWASKMGKTPIVVNDCPGFFVNRVLFPYFAGFSQLLRDGADFRKVDKVMEKQFGWPMGP
FADB_CROS8      VSWASKMGKTPIVVNDCPGFFVNRVLFPYFAGFSQLLRDGADFRQIDKVMEKQFGWPMGP
FADB_PECAS      VAYASKMGKTPIVVNDCPGFFVNRVLFPYFAAFSLLLRDGADFREIDNAMEKKFGWPMGP
FADB_YERPE      VAYATQMGKTPIVVNDCPGFFVNRVLFPYLAGFGMLVRDGGDFHQIDKVMEKQFGWPMGP
FADB_YERPY      VAYATQMGKTPIVVNDCPGFFVNRVLFPYLAGFGMLVRDGGDFHQIDKVMEKQFGWPMGP
FADB_YERPP      VAYATQMGKTPIVVNDCPGFFVNRVLFPYLAGFGMLVRDGGDFHQIDKVMEKQFGWPMGP
FADB_YERPG      VAYATQMGKTPIVVNDCPGFFVNRVLFPYLAGFGMLVRDGGDFHQIDKVMEKQFGWPMGP
FADB_YERPA      VAYATQMGKTPIVVNDCPGFFVNRVLFPYLAGFGMLVRDGGDFHQIDKVMEKQFGWPMGP
FADB_YERPN      VAYATQMGKTPIVVNDCPGFFVNRVLFPYLAGFGMLVRDGGDFHQIDKVMEKQFGWPMGP
FADB_YERPS      VAYATQMGKTPIVVNDCPGFFVNRVLFPYLAGFGMLVRDGGDFHQIDKVMEKQFGWPMGP
FADB_YERPB      VAYATQMGKTPIVVNDCPGFFVNRVLFPYLAGFGMLVRDGGDFHQIDKVMEKQFGWPMGP
FADB_YERP3      VAYATQMGKTPIVVNDCPGFFVNRVLFPYLAGFGMLVRDGGDFHQIDKVMEKQFGWPMGP
FADB_YERE8      VAYATQMGKTPIVVNDCPGFFVNRVLFPYLAGFGMLVRDGADFRQIDKVMEKQFGWPMGP
FADB_SERP5      VAYASRMGKTPIVVNDCPGFFVNRVLFPYFAGFSMLLRDGADFRQIDKVMEKQFGWPMGP
FADB_PHOLL      VAYASKMGKTPIVVNDCPGFFVNRVLLPYLLGFGLLLRDGGDFRQIDKIMEKEFGWPMGP
FADB_ALIF1      VAYASQMGKTPIVINDCPGFFVNRVLFPYFAGFSLLLRDGGDYQQIDNVMEKEFGWPMGP
FADB_ALIFM      VAYASQMGKTPIVVNDCPGFFVNRVLFPYFAGFSLLLRDGGDYQQIDKVMEKEFGWPMGP
FADB_ALISL      VAYASQMGKTPIVVNDCPGFFVNRVLFPYFAGFSLLLRDGGNYQQIDKVMEKEFGWPMGP
FADB_PHOPR      VAYAAKMGKSPIVVNDCPGFFVNRVLFPYFAGFSLLLRDGADFTQVDKVMEKQFGWPMGP
FADB_VIBCH      VAYAAKMGKSPIVVNDCPGFFVNRVLFPYFAGFSLLMRDGANFTEIDKVMERQFGWPMGP
FADB_VIBCM      VAYAAKMGKSPIVVNDCPGFFVNRVLFPYFAGFSLLMRDGANFTEIDKVMERQFGWPMGP
FADB_VIBC3      VAYAAKMGKSPIVVNDCPGFFVNRVLFPYFAGFSLLMRDGANFTEIDKVMERQFGWPMGP
FADB_VIBCB      VAYAAKMGKSPIVVNDCPGFFVNRVLFPYFGGFSMLLRDGADFTKIDKIMERKFGWPMGP
FADB_VIBPA      VAYAAKMGKSPIVVNDCPGFFVNRVLFPYFGGFSMLLRDGADFTKVDKVMERKFGWPMGP
FADB_VIBVU      VAYAAKMGKSPIVVNDCPGFFVNRVLFPYFGGFSMLLRDGADFTQIDKVMERKFGWPMGP
FADB_VIBVY      VAYAAKMGKSPIVVNDCPGFFVNRVLFPYFGGFSMLLRDGADFTQIDKVMERKFGWPMGP
FADB_VIBTL      VAYAAKMGKSPIVVNDCPGFFVNRVLFPYFGGFSMLLRDGADFTKIDKVMERKFGWPMGP
FADB_AERHH      VAYAAAMGKSPVVVNDCPGFFVNRVLFPYFFGFNKLVADGADFAAVDKVMEKEFGWPMGP
FADB_AERS4      VAYAAAMGKSPVVVNDCPGFFVNRVLFPYFFGFNKLVADGADFAAVDKVMEKEFGWPMGP
FADB_SHEB8      VAYASKMGKTPIVVNDCPGFFVNRVLFPYFAGFNGLLAEGGDFAAIDKVMEKQFGWPMGP
FADB_SHEB2      VAYASKMGKTPIVVNDCPGFFVNRVLFPYFAGFNGLLAEGGDFAAIDKVMEKQFGWPMGP
FADB_SHEB9      VAYASKMGKTPIVVNDCPGFFVNRVLFPYFAGFNGLLAEGGDFAAIDKVMEKQFGWPMGP
FADB_SHEB5      VAYASKMGKTPIVVNDCPGFFVNRVLFPYFAGFNGLLAEGGDFAAIDKVMEKQFGWPMGP
FADB_SHEPC      VAYASKMGKTPIVVNDCPGFFVNRVLFPYFAGFNGLLAEGGDFAAIDKVMEKQFGWPMGP
FADB_SHESW      VAYASKMGKTPIVVNDCPGFFVNRVLFPYFAGFNGLLAEGGDFAAIDKVMEKQFGWPMGP
FADB_SHESA      VAYASKMGKTPIVVNDCPGFFVNRVLFPYFAGFNGLLAEGGDFAAIDKVMEKQFGWPMGP
FADB_SHESR      VAYASKMGKTPIVVNDCPGFFVNRVLFPYFAGFNGLLAEGGDFAAIDKVMEKQFGWPMGP
FADB_SHESM      VAYASKMGKTPIVVNDCPGFFVNRVLFPYFAGFNGLLAEGGDFAAIDKVMEKQFGWPMGP
FADB_SHEON      VAYASKMGKTPIVVNDCPGFFVNRVLFPYFAGFNGLLAEGGDFAAIDKVMEKQFGWPMGP
FADB_SHEFN      VAYASKMGKTPIVVNDCPGFFVNRVLFPYFAGFSGLLAEGADFAAVDKVMEKQFGWPMGP
FADB_SHEHH      VAYASKMGKTPIVVNDCPGFFVNRVLFPYFAGFSGLLADGADFAAIDKVMEKQFGWPMGP
FADB_SHEPA      VAYASKMGKTPIVVNDCPGFFVNRVLFPYFAGFSGLLADGADFAAIDKVMEKQFGWPMGP
FADB_SHEPW      VAYASKMGKTPIVVNDCPGFFVNRVLFPYFAGFSGLLADGADFAAIDKVMEKQFGWPMGP
FADB_SHESH      VAYASKMGKTPIVVNDCPGFFVNRVLFPYFAGFSGLLADGADFAAIDKVMEKQFGWPMGP
FADB_SHEWM      VAYASKMGKTPIVVNDCPGFFVNRVLFPYFAGFSGLLADGADFAAIDKVMEKQFGWPMGP
FADB_SHEAM      VAYASKMGKTPIVVNDCPGFFVNRVLFPYFAGFNGLLADGGDFAAIDKVMEKQFGWPMGP
FADB_SHELP      VAYAAKMGKTPIVVNDCPGFFVNRVLFPYFAGFSGLLEDGADFAAIDKVMEKQFGWPMGP
FADB_COLP3      VAYAAKMGKSPIVVNDCPGFYVNRVLFPYFAGFSQLVLEGADFTAIDKVMEKQFGWPMGP
FADB_IDILO      VAYALKLGKTPIVVNDCPGFLVNRVLFPYLAGFAGMVDEGVDFVGIDKVMEKQFGWPMGP
FADB_PSEF5      VAYAKKMGKNPIVVNDCPGFLVNRVLFPYFGGFAKLVSAGVDFVRIDKIMEK-FGWPMGP
FADB_PSEPF      VAYAKKMGKNPIVVNDCPGFLVNRVLFPYFGGFAKLVSAGVDFVRIDKIMEK-FGWPMGP
FADB_PSEFR      VAYAKKMGKNPIVVNDCPGFLVNRVLFPYFGGFAKLVSAGVDFVRIDKVMEK-FGWPMGP
FADB_PSEP1      VAYAKKMGKNPIVVNDCPGFLVNRVLFPYFGGFAKLVSAGVDFVRIDKVMEK-FGWPMGP
FADB_PSEPK      VAYAKKMGKNPIVVNDCPGFLVNRVLFPYFGGFAKLVSAGVDFVRIDKVMEK-FGWPMGP
FADB_PSEPG      VAYAKKMGKNPIVVNDCPGFLVNRVLFPYFGGFAKLVSAGVDFVRIDKVMEK-FGWPMGP
FADB_PSEPW      VAYAKKMGKNPIVVNDCPGFLVNRVLFPYFGGFAKLVSAGVDFVRIDKVMEK-FGWPMGP
FADB_PSEPU      VAYAKKMGKNPIVVNDCPGFLVNRVLFPYFGGFAKLVSAGVDFVRIDKVMEK-FGWPMGP
FADB_PSEOL      VAYAKKMGKNPIVVNDCPGFLVNRVLFPYFGGFAKLVSAGVDFVRIDKVMEK-FGWPMGP
FADB_PSEE4      VAYAKKMGKNPIVVNDCPGFLVNRVLFPYFGGFAKLVSAGVDFVRIDKVMEK-FGWPMGP
FADB_PSE14      VAYARKMGKNPIVVNDCPGFLVNRVLFPYFGGFARLVSAGVDFVRIDKVMEK-FGWPMGP
FADB_PSESM      VAYAKKMGKNPIVVNDCPGFLVNRVLFPYFGGFARLVSAGVDFVRIDKVMEK-FGWPMGP
FADB_PSEU2      VAYAKKMGKNPIVVNDCPGFLVNRVLFPYFGGFARLVSAGVDFVRIDKVMEK-FGWPMGP
FADB_PSEAE      VAYAKKMGKSPIVVNDCPGFLVNRVLFPYFGGFAKLLSFGVDFVRIDKVMEK-FGWPMGP
FADB_PSEAB      VAYAKKMGKSPIVVNDCPGFLVNRVLFPYFGGFAKLLSFGVDFVRIDKVMEK-FGWPMGP
FADB_PSEA8      VAYAKKMGKSPIVVNDCPGFLVNRVLFPYFGGFAKLLSFGVDFVRIDKVMEK-FGWPMGP
FADB_PSEA7      VAYAKKMGKSPIVVNDCPGFLVNRVLFPYFGGFAKLLGFGVDFVRIDKVMEK-FGWPMGP
FADB_PSEMY      VAYAKKMGKNPIVVNDCPGFLVNRVLFPYFGGFSKLLGFGVDFVRIDKVMEK-FGWPMGP
FADB_PSEU5      VAYAKKMGKSPVVVNDCPGFLVNRVLFPYFGGFARAIAHGVDFVRADKVMEK-FGWPMGP
FADB_ACIB5      VVLAQKMGKTPIVVNDCPGFLVNRVLFPYFGAFDLLVKDGADFQQIDNVMSK-FGWPMGP
FADB_ACIB3      VVLAQKMGKTPIVVNDCPGFLVNRVLFPYFGAFDLLVKDGADFQQIDNVMSK-FGWPMGP
FADB_ACIBY      VVLAQKMGKTPIVVNDCPGFLVNRVLFPYFGAFDLLVKDGADFQQIDNVMSK-FGWPMGP
FADB_ACIBC      VVLAQKMGKTPIVVNDCPGFLVNRVLFPYFGAFDLLVKDGADFQQIDNVMSK-FGWPMGP
FADB_ACIBS      VVLAQKMGKTPIVVNDCPGFLVNRVLFPYFGAFDLLVKDGADFQQIDNVMSK-FGWPMGP
FADB_ACIAD      VVLAQKMGKTPIVVNDCPGFLVNRVLFPYFGAFDLLLKDGADFQQIDKVMEK-FGWPMGP
FADB_PSYA2      VALASKMGKVPVVVNDCPGFLVNRVLFPYFGAFDLLLKQGADFAHVDKVMEK-FGWPMGP
FADB_PSYCK      VALATKMGKVPVVVNDCPGFLVNRVLFPYFGAFDLLLKQGADFAHVDKVMEK-FGWPMGP
FADB_PSYWF      VALAQRMGKVPVVVNDCPGFLVNRVLFPYFGAFDLLLKQGADFVHVDKVMEK-FGWPMGP
                :  *  :** *:*:*:**** *****:**: .*   :  * .:   *: *.: *******

FADB_ECO55      AYLLDVVGIDTAHHAQAVMAAGFPQRMQKDYRDAIDALFDANRFGQKNGLGFWRYKEDSK
FADB_ECOLC      AYLLDVVGIDTAHHAQAVMAAGFPQRMQKDYRDAIDALFDANRFGQKNGLGFWRYKEDSK
FADB_ECO8A      AYLLDVVGIDTAHHAQAVMAAGFPQRMQKDYRDAIDALFDANRFGQKNGLGFWRYKEDSK
FADB_SHIB3      AYLLDVVGIDTAHHAQAVMAAGFPQRMQKDYRDAIDALFDANRFGQKNGLGFWRYKEDSK
FADB_ECODH      AYLLDVVGIDTAHHAQAVMAAGFPQRMQKDYRDAIDALFDANRFGQKNGLGFWRYKEDSK
FADB_ECOLI      AYLLDVVGIDTAHHAQAVMAAGFPQRMQKDYRDAIDALFDANRFGQKNGLGFWRYKEDSK
FADB_SHISS      AYLLDVVGIDTAHHAQAVMAAGFPQRMQKDYRDAIDALFDANRFGQKNGLGFWRYKEDSK
FADB_ECOSE      AYLLDVVGIDTAHHAQAVMAAGFPQRMQKDYRDAIDALFDANRFGQKNGLGFWRYKEDSK
FADB_ECO24      AYLLDVVGIDTAHHAQAVMAAGFPQRMQKDYRDAIDALFDANRFGQKNGLGFWRYKEDSK
FADB_ESCF3      AYLLDVVGIDTAHHAQAVMAAGFPQRMQKDYRDAIDALFDANRFGQKNGLGFWRYKEDSK
FADB_ECO57      AYLLDVVGIDTAHHAQAVMAAGFPQRMQKDYRDAIDALFDANRFGQKNGLGFWHYKEDSK
FADB_ECO5E      AYLLDVVGIDTAHHAQAVMAAGFPQRMQKDYRDAIDALFDANRFGQKNGLGFWHYKEDSK
FADB_SHIDS      AYLLDVVGIDTAHHAQAVMAAGFPQRMQKDYRDAIDALFDANRFGQKNGLGFWHYKEDSK
FADB_ECOSM      AYLLDVVGIDTAHHAQAVMAAGFPQRMQKDYRDAIDALFDANRFGQKNGLGFWRYKEDSK
FADB_SHIFL      AYLLDVVGIDTAHHAQAVMAAGFPQRMQKDYRDAIDALFDANRFGQKNGLGFWRYKEDSK
FADB_SHIF8      AYLLDVVGIDTAHHAQAVMAAGFPQRMQKDYRDAIDALFDANRFGQKNGLGFWRYKEDSK
FADB_ECOHS      AYLLDVVGIDTAHHAQAVMAAGFPQRMQKDYRDAIDALFDANRFGQKNGLGFWRYKEDSK
FADB_ECOUT      AYLLDVVGIDTAHHAQAVMAAGFPQRMQKDYRDAIDALFDANRFGQKNGLGFWRYKEDSK
FADB_ECO45      AYLLDVVGIDTAHHAQAVMAAGFPQRMQKDYRDAIDALFDANRFGQKNGLGFWRYKEDSK
FADB_ECO81      AYLLDVVGIDTAHHAQAVMAAGFPQRMQKDYRDAIDALFDANRFGQKNGLGFWRYKEDSK
FADB_ECOL6      AYLLDVVGIDTAHHAQAVMAAGFPQRMQKDYRDAIDALFNANRFGQKNGLGFWRYKEDSK
FADB_ECOL5      AYLLDVVGIDTAHHAQAVMAAGFPQRMQKDYRDAIDALFNANRFGQKNGLGFWRYKEDSK
FADB_ECO27      AYLLDVVGIDTAHHAQAVMAAGFPQRMQKDYRDAIDALFNANRFGQKNGLGFWRYKEDSK
FADB_ECOLU      AYLLDVVGIDTAHHAQAVMAAGFPQRMQKDYRDAIDALFDANRFGQKNGLGFWRYKEDSK
FADB_ECO7I      AYLLDVVGIDTAHHAQAVMAAGFPQRMQKDYRDAIDALFDANRFGQKNGLGFWRYKEDSK
FADB_SALG2      AYLLDVVGIDTAHHAQAVMAAGFPQRMQKEYRDAIDALFDASRFGQKNGLGFWRYKEDSK
FADB_SALTI      AYLLDVVGIDTAHHAQAVMAAGFPQRMQKEYRDAIDALFDASRFGQKNGLGFWRYKEDSK
FADB_SALEP      AYLLDVVGIDTAHHAQAVMAAGFPQRMQKEYRDAIDALFDASRFGQKNGLGFWRYKEDSK
FADB_SALA4      AYLLDVVGIDTAHHAQAVMAAGFPQRMQKEYRDAIDALFDASRFGQKNGLGFWRYKEDSK
FADB_SALCH      AYLLDVVGIDTAHHAQAVMAAGFPQRMQKEYRDAIDALFDASRFGQKNGLGFWRYKEDSK
FADB_SALPB      AYLLDVVGIDTAHHAQAVMAAGFPQRMQKEYRDAIDALFDASRFGQKNGLGFWRYKEDSK
FADB_SALNS      AYLLDVVGIDTAHHAQAVMAAGFPQRMQKEYRDAIDALFDASRFGQKNGLGFWRYKEDSK
FADB_SALTY      AYLLDVVGIDTAHHAQAVMAAGFPQRMQKDYRDAIDALFDASRFGQKNGLGFWRYKEDSK
FADB_SALPA      AYLLDVVGIDTAHHAQAVMAAGFPQRMQKEYRDAIDALFDANRFGQKNGLGFWRYKEDSK
FADB_SALPK      AYLLDVVGIDTAHHAQAVMAAGFPQRMQKEYRDAIDALFDANRFGQKNGLGFWRYKEDSK
FADB_SALSV      AYLLDVVGIDTAHHAQAVMAAGFPQRMQKEYRDAIDALFDASRFGQKNGLGFWRYKEDSK
FADB_CITK8      AYLLDVVGIDTAHHAQAVMAAGFPQRMQKDYRDAIDALFDASRYGQKNGLGFWRYKEDSK
FADB_ENTCL      AYLLDVVGIDTAHHAQAVMAAGFPQRMQKDYRDAIDALFDANRFGQKNGLGFWRYKENSK
FADB_ENT38      AYLLDVVGIDTAHHAQAVMAAGFPQRMQKDYRDAIDALFDANRFGQKNGLGFWRYKEDSK
FADB_KLEP3      AYLLDVVGIDTAHHAQAVMAAGFPQRMQKDYRDAIDALFDANRFGQKNGLGFWRYKEDSK
FADB_KLEP7      AYLLDVVGIDTAHHAQAVMAAGFPQRMQKDYRDAIDALFDANRFGQKNGLGFWRYKDDSK
FADB_CROS8      AYLLDVVGIDTAHHAQAVMAAGFPQRMQKDYRDAIDALFDAGRFGQKNGKGFYAYQEDSK
FADB_PECAS      AYLLDVVGIDTAHHAQAVMAEGFPQRMAKDYRDAIDVLFEHQRFGQKNGQGFYRYQTDSK
FADB_YERPE      AYLLDVVGIDTAHHAQAVMAAGFPERMNKDYRDAVDVMFDNQRFGQKNGQGFYRYTQDAK
FADB_YERPY      AYLLDVVGIDTAHHAQAVMAAGFPERMNKDYRDAVDVMFDNQRFGQKNGQGFYRYTQDAK
FADB_YERPP      AYLLDVVGIDTAHHAQAVMAAGFPERMNKDYRDAVDVMFDNQRFGQKNGQGFYRYTQDAK
FADB_YERPG      AYLLDVVGIDTAHHAQAVMAAGFPERMNKDYRDAVDVMFDNQRFGQKNGQGFYRYTQDAK
FADB_YERPA      AYLLDVVGIDTAHHAQAVMAAGFPERMNKDYRDAVDVMFDNQRFGQKNGQGFYRYTQDAK
FADB_YERPN      AYLLDVVGIDTAHHAQAVMAAGFPERMNKDYRDAVDVMFDNQRFGQKNGQGFYRYTQDAK
FADB_YERPS      AYLLDVVGIDTAHHAQAVMAAGFPERMNKDYRDAVDVMFDNQRFGQKNGQGFYRYTQDAK
FADB_YERPB      AYLLDVVGIDTAHHAQAVMAAGFPERMNKDYRDAVDVMFDNQRFGQKNGQGFYRYTQDAK
FADB_YERP3      AYLLDVVGIDTAHHAQAVMAAGFPERMNKDYRDAVDVMFDNQRFGQKNGQGFYRYTQDAK
FADB_YERE8      AYLLDVVGIDTAHHAQAVMAVGFPERMNKDYRDAVDVMFDNQRFGQKNGQGFYRYTQDTK
FADB_SERP5      AYLLDVVGIDTAHHAQAVMAAGFPERMGKDYRDAIDVMFDNQRFGQKNQLGFYRYSQDNK
FADB_PHOLL      AYLIDVIGLDTAHHSQSVMAQGFPDRMHRDYKDAIHVLYDNQRYGQKNGLGFYKYTQDKK
FADB_ALIF1      AYLLDVVGIDTAHHAQAVMAQGFPERMAKNGRDVIDAMFESDRYGQKNGSGFYAYSIDRK
FADB_ALIFM      AYLLDVVGIDTAHHAQAVMAQGFPERMAKNGRDVIDAMFESDRYGQKNGSGFYAYSIDRK
FADB_ALISL      AYLLDVVGIDTAHHAQAVMAQGFPERMAKNGRDVIDAMFEDDRYGQKNGIGFYAYALDKK
FADB_PHOPR      AYLLDVVGIDTAHHAQAVMAEGFPDRMGKNYKDAVDVMFEQQRFGQKNGNGFFAYSVDRR
FADB_VIBCH      AYLLDVVGIDTAHHAQAVMAEGFPTRMAKSGREAIDALYEAKKFGQKNGSGFYQYTVDKK
FADB_VIBCM      AYLLDVVGIDTAHHAQAVMAEGFPTRMAKSGREAIDALYEAKKFGQKNGSGFYQYTVDKK
FADB_VIBC3      AYLLDVVGIDTAHHAQAVMAEGFPTRMAKSGREAIDALYEAKKFGQKNGSGFYQYTVDKK
FADB_VIBCB      AYLLDVVGIDTAHHAQAVMAQGFPERMGKQGRDAIDALFEASKYGQKNGSGFYSYTIDRK
FADB_VIBPA      AYLLDVVGIDTAHHAQAVMAEGFPERMGKQGRDAIDALFEANKYGQKNGNGFYSYTIDKK
FADB_VIBVU      AYLLDVVGIDTAHHAQAVMAQGFPERMGKQGRDAIDALFEANKYGQKNGSGFYTYTMDKK
FADB_VIBVY      AYLLDVVGIDTAHHAQAVMAQGFPERMGKQGRDAIDALFEANKYGQKNGSGFYTYTMDKK
FADB_VIBTL      AYLLDVVGLDTAHHAQAVMAQGFPERMGKEGRDAIDALYVAEKYGQKNGSGFYTYSVDKR
FADB_AERHH      AYLLDVVGIDTGHHAGDVMAQGFPARMSKEGRTAIDVMYEVNRFGQKNGKGFYAYEQDKK
FADB_AERS4      AYLLDVVGIDTGHHAGDVMAQGFPARMSKEGRTAIDVMYDASRFGQKNGKGFYAYEQDKK
FADB_SHEB8      AYLLDVVGLDTGHHAQAVMAEGFPDRMGKSGTDAIDVMFENKRLGQKNGKGFYVYSVDSR
FADB_SHEB2      AYLLDVVGLDTGHHAQAVMAEGFPDRMGKSGTDAIDVMFENKRLGQKNGKGFYVYSVDSR
FADB_SHEB9      AYLLDVVGLDTGHHAQAVMAEGFPDRMGKSGTDAIDVMFENKRLGQKNGKGFYVYSVDSR
FADB_SHEB5      AYLLDVVGLDTGHHAQAVMAEGFPDRMGKSGTDAIDVMFENKRLGQKNGKGFYVYSVDSR
FADB_SHEPC      AYLLDVVGLDTGHHAQAVMAEGFPDRMGKSGTDAIDVMFENKRLGQKNGKGFYVYSVDSR
FADB_SHESW      AYLLDVVGLDTGHHAQAVMAEGFPDRMGKSGTDAIDVMFENKRLGQKNGKGFYVYSVDSR
FADB_SHESA      AYLLDVVGLDTGHHAQAVMAEGFPDRMGKSGNDAIDVMFENKRLGQKNGKGFYAYSVDSR
FADB_SHESR      AYLLDVVGLDTGHHAQAVMAEGFPDRMGKSGNDAIDVMFENKRLGQKNGKGFYAYSVDSR
FADB_SHESM      AYLLDVVGLDTGHHAQAVMAEGFPDRMGKSGNDAIDVMFENKRLGQKNGKGFYAYSVDSR
FADB_SHEON      AYLLDVVGLDTGHHAQAVMAEGFPDRMGKSGNDAIDVMFENKRLGQKNGKGFYAYSVDSR
FADB_SHEFN      AYLLDVVGLDTGHHAQAVMAEGFPDRMGKNGKDAIDIMFENKRLGQKNTKGFYAYSVDRR
FADB_SHEHH      AYLLDVVGLDTGHHAQAVMAEGFPDRMGKSGKDAIDVMFEAERFGQKNNKGFYQYSVDHR
FADB_SHEPA      AYLLDVVGLDTGHHAQAVMAEGFPDRMGKTGKDAIDVMFEAERFGQKNSKGFYQYSVDRR
FADB_SHEPW      AYLLDVVGLDTGHHAQAVMAEGFPERMGKTGKDAIDVMFEAERFGQKNNKGFYQYSVDRR
FADB_SHESH      AYLLDVVGIDTGHHAQAVMAEGFPDRMGKNGKDAIDIMFEAERFGQKNSKGFYAYSVDRR
FADB_SHEWM      AYLLDVVGIDTGHHAQAVMAEGFPDRMGKDGKDAIDIMFDSERFGQKNNKGFYAYSVDRR
FADB_SHEAM      AYLLDVVGLDTGHHAQAVMADGFPDRMGKSDKDAIDVMYEAGRLGQKNGKGFYQYSIDKR
FADB_SHELP      AYLLDVVGLDTGHHAQAVMAEGFPDRMAKEGKDAIDVMFEADRFGQKNGKGFYQYSVDRR
FADB_COLP3      AYLLDVVGVDTADHCTGVMSSGFPTRMKKIDNDPVSTLYANERLGQKNGKGFYDHIKDKR
FADB_IDILO      AYLSDVVGIDTADHCTVVMEAGFPTRMKRDESSAIAKLAAAERYGQKNGKGFYVYGTDKK
FADB_PSEF5      AYLMDVVGIDTGHHGRDVMAEGFPDRMKDDRRSAVDVLYEAKRLGQKNGKGFYAYETDKK
FADB_PSEPF      AYLMDVVGIDTGHHGRDVMAEGFPDRMKDDRRSAIDVLYEAKRLGQKNGKGFYAYEADKK
FADB_PSEFR      AYLMDVVGIDTGHHGRDVMAEGFPDRMKDDRRSAIDALYEAKRLGQKNGKGFYAYEADKK
FADB_PSEP1      AYLMDVVGIDTGHHGRDVMAEGFPDRMKDERRSAVDALYESNRLGQKNGKGFYAYETDKR
FADB_PSEPK      AYLMDVVGIDTGHHGRDVMAEGFPDRMKDERRSAVDALYEANRLGQKNGKGFYAYETDKR
FADB_PSEPG      AYLMDVVGIDTGHHGRDVMAEGFPDRMKDERRSAVDALYEANRLGQKNGKGFYAYETDKR
FADB_PSEPW      AYLMDVVGIDTGHHGRDVMAEGFPDRMKDERRSAVDALYEANRLGQKNGKGFYAYETDKR
FADB_PSEPU      AYLMDVVGIDTGHHGRDVMAEGFPDRMKDERRSAVDALYEANRLGQKNGKGFYAYETDKR
FADB_PSEOL      AYLMDVVGIDTGHHGRDVMAEGFPDRMKDERRSAVDALYEANRLGQKNGKGFYAYETDKR
FADB_PSEE4      AYLMDVVGIDTGHHGRDVMAEGFPDRMKDDRRSAVDALYEANRLGQKNGKGFYAYETDKR
FADB_PSE14      AYLMDVVGIDTGHHGRDVMAEGFPDRMKDDRRSVVDALYEAKRLGQKNGKGFYAYETDKK
FADB_PSESM      AYLMDVVGIDTGHHGRDVMAEGFPDRMKDDRRSAVDALYEANRLGQKNGKGFYVYETDKK
FADB_PSEU2      AYLMDVVGIDTGHHGRDVMAEGFPDRMKDDRRSAIDALYDAKRLGQKNGKGFYAYETDKK
FADB_PSEAE      AYLSDVVGIDTGHHGRDVMAEGFPDRMAVEGKTAVDVMYEANRLGQKNGKGFYAYETDKR
FADB_PSEAB      AYLSDVVGIDTGHHGRDVMAEGFPDRMAVEGKTAVDVMYEANRLGQKNGKGFYAYETDKR
FADB_PSEA8      AYLSDVVGIDTGHHGRDVMAEGFPDRMAVEGKTAVDVMYEANRLGQKNGKGFYAYETDKR
FADB_PSEA7      AYLSDVVGIDTGHHGRDVMAEGFPDRMAVEGKTAVDVMYEANRLGQKNGKGFYAYETDKR
FADB_PSEMY      AYLSDVVGIDTGHHGRDVMAEGFPDRMAVEGKTAVDVMYEANRLGQKNGKGFYAYETDKR
FADB_PSEU5      AYLMDVVGMDTGHHGRDVMAEGFPDRMKDDTRTAVDVMYDANRLGQKNGKGFYAYEMDKK
FADB_ACIB5      AYLIDVVGIDTGVHGAEVMAEGFPDRMKPDYKGAIEAMYEAKRLGQKNDVGFYKYELDKK
FADB_ACIB3      AYLIDVVGIDTGVHGAEVMAEGFPDRMKPDYKGAIEAMYEAKRLGQKNDVGFYKYELDKK
FADB_ACIBY      AYLIDVVGIDTGVHGAEVMAEGFPDRMKPDYKGAIEAMYEAKRLGQKNDVGFYKYELDKK
FADB_ACIBC      AYLIDVVGIDTGVHGAEVMAEGFPDRMKPDYKGAIEAMYEAKRLGQKNDVGFYKYELDKK
FADB_ACIBS      AYLIDVVGIDTGVHGAEVMAEGFPDRMKPDYKGAIEAMYEAKRLGQKNDVGFYKYELDKK
FADB_ACIAD      AYLMDVVGIDTGVHGAEVMAEGFPDRMKPDYKGSIQTMYEAKRLGQKNDVGFYKYELDKK
FADB_PSYA2      AYLIDVVGLDTGVHGAEVMAEGFPDRMKPDYKGAIELLYENKRLGQKNGVGFYKYEMDKR
FADB_PSYCK      AYLIDVVGLDTGVHGAEVMAEGFPDRMKPDYKGAIEHLYENKRLGQKNGVGFYKYEMDKR
FADB_PSYWF      AYLIDVVGLDTGVHGAEVMAEGFPDRMKPDYKGAIKHLFENNRLGQKNGVGFYKYEKDSR
                *** **:*:**. *   **  *** **       :  :    : ****  **: :  : :

FADB_ECO55      GKPKKEEDAAVEDLLAEVSQPK-RDFSEEEIIARMMIPMVNEVVRCLEEGIIATPAEADM
FADB_ECOLC      GKPKKEEDAAVEDLLAEVSQPK-RDFSEEEIIARMMIPMVNEVVRCLEEGIIATPAEADM
FADB_ECO8A      GKPKKEEDAAVEDLLAEVSQPK-RDFSEEEIIARMMIPMVNEVVRCLEEGIIATPAEADM
FADB_SHIB3      GKPKKEEDAAVEDLLAEVSQPK-RDFSEEEIIARMMIPMVNEVVRCLEEGIIATPAEADM
FADB_ECODH      GKPKKEEDAAVEDLLAEVSQPK-RDFSEEEIIARMMIPMVNEVVRCLEEGIIATPAEADM
FADB_ECOLI      GKPKKEEDAAVEDLLAEVSQPK-RDFSEEEIIARMMIPMVNEVVRCLEEGIIATPAEADM
FADB_SHISS      GKPKKEEDAAVEDLLAEVSQPK-RDFSEEEIIARMMIPMVNEVVRCLEEGIIATPAEADM
FADB_ECOSE      GKPKKEEDAAVEDLLAEVSQPK-RDFSEEEIIARMMIPMVNEVVRCLEEGIIATPAEADM
FADB_ECO24      GKPKKEEDAVVDDLLAEVSQPK-RDFSEEEIIARMMIPMVNEVVRCLEESIIATPAEADM
FADB_ESCF3      GKPKKEEDAAVDDLLAEVSQPK-RDFSEEEIIARMMIPMVNEVVRCLEEGIIATPAEADM
FADB_ECO57      GKPKKEEDAAVDDLLAEVSQPK-RDFSEEEIIARMMIPMVNEVVRCLEEGIIATPAEADM
FADB_ECO5E      GKPKKEEDAAVDDLLAEVSQPK-RDFSEEEIIARMMIPMVNEVVRCLEEGIIATPAEADM
FADB_SHIDS      GKPKKEEDAAVDDLLAEVSQPK-RDFSEEEIIARMMIPMVNEVVRCLEEGIIATPAEADM
FADB_ECOSM      GKPKKEEDAVVDDLLAEVSQPK-RDFSEEEIIARMMIPMVNEVVRCLEEGIIATPAEADM
FADB_SHIFL      GKPKKEEDAAVEDLLAEVSQPK-RDFSEEEIIARMMIPMVNEVVRCLEEGIIATPAEADM
FADB_SHIF8      GKPKKEEDAAVEDLLAEVSQPK-RDFSEEEIIARMMIPMVNEVVRCLEEGIIATPAEADM
FADB_ECOHS      GKPKKEEDAAVEDLLAEVSQPK-RDFSEEEIIARMMIPMVNEVVRCLEEGIIATPAEADM
FADB_ECOUT      GKPKKEEDVVVDDLLAKVSQPK-RDFSEEEIIARMMIPMVNEVVRCLEEGIIATPAEADM
FADB_ECO45      GKPKKEEDVVVDDLLAKVSQPK-RDFSEEEIIARMMIPMVNEVVRCLEEGIIATPAEADM
FADB_ECO81      GKPKKEEDVVVDDLLAKVSQPK-RDFSEEEIIARMMIPMVNEVVRCLEEGIIATPAEADM
FADB_ECOL6      GKPKKEEDVVVDDLLAKVSQPK-RDFSEEEIIARMMIPMVNEVVRCLEEGIIATPAEADM
FADB_ECOL5      GKPKKEEDVVVDDLLAKVSQPK-RDFSEEEIIARMMIPMVNEVVRCLEEGIIATPAEADM
FADB_ECO27      GKPKKEEDAAVDDLLAEVSQPK-RDFSEEEIIARMMIPMVNEVVRCLEEGIIATPAEADM
FADB_ECOLU      GKPKKEEDAAVDDLLAEVSQPK-RDFSEEEIIARMMIPMVNEVVRCLEEGIIATPAEADM
FADB_ECO7I      GKPKKEEDAVVDDLLAEVSQPK-RDFSEEEIIARMMIPMVNEVVRCLEEGIIATPAEADM
FADB_SALG2      GKPKKEEDAAVDDLLASVSQTK-RDFSDDEIIARMMIPMINEVVRCLEEGIIASPAEADM
FADB_SALTI      GKPKKEEDAAVDDLLASVSQTK-RDFSDDEIIARMMIPMINEVVRCLEEGIIASPAEADM
FADB_SALEP      GKPKKEEDAAVDDLLASVSQTK-RDFSDDEIIARMMIPMINEVVRCLEEGIIASPAEADM
FADB_SALA4      GKPKKEEDAAVDDLLASVSQPK-RDFSDDEIIARMMIPMINEVVRCLEEGIIASPAEADM
FADB_SALCH      GKPKKEEDAAVDDLLASVSQPK-RDFSDDEIIARMMIPMINEVVRCLEEGIIASPAEADM
FADB_SALPB      GKPKKEEDAAVDDLLASVSQPK-RDFSDDEIIARMMIPMINEVVRCLEEGIIASPAEADM
FADB_SALNS      GKPKKEEDAAVDDLLASVSQPK-HDFSDDEIIARMMIPMINEVVRCLEEGIIASPAEADM
FADB_SALTY      GKPKKEEDAAVDDLLASVSQPK-RDFSDDEIIARMMIPMINEVVRCLEEGIIASPAEADM
FADB_SALPA      GKPKKEEDAAVDDLLASVSQPK-RDFSDDEIIARMMIPMINEVVRCLEEGIIASPAEADM
FADB_SALPK      GKPKKEEDAAVDDLLASVSQPK-RDFSDDEIIARMMIPMINEVVRCLEEGIIASPAEADM
FADB_SALSV      GKPKKEEDAAVDDLLASVSQPK-RDFSDDEIIARMMIPMINEVVRCLEEGIIASPAEADM
FADB_CITK8      GKPKKEEDAAVDSLLAEVSQPK-RDFSDEEIIARMMIPMVNEVVRCLEEGIIASPAEADM
FADB_ENTCL      GKPKKEEDAVVDGLLADVSQPK-RDFTDDEIIARMMIPMINEVVRCLEEGIIASPAEADM
FADB_ENT38      GKPKKEDDTAVESLLADVSQPT-RDFSDEEIIARMMIPMVNEVVRCLEEGIIASPAEADM
FADB_KLEP3      GKPKKEEDAAVDSLLADVSQPK-RDFSDEEIIARMMIPMVNEVVRCLEEGIIASPAEADM
FADB_KLEP7      GKPKKEEDAAVDSLLADVSQPK-RDFSDEEIIARMMIPMVNEVVRCLEEGIIASPAEADM
FADB_CROS8      GKPRKVPDDAVDSLLAEVSQPK-RAFSDEEIVARMMIPMVNEVVRCLEEGIIASPAEADM
FADB_PECAS      GKQRKEQDDAVDALLKNISQPK-KAFSAEEIIARMMIPMINEVARCLEEGIVASPAEADM
FADB_YERPE      GKPRKENDEQVDKLLAEISQPL-QEFSDEDIIARTMIPMINEVVRCLEEGIIASAAEGDM
FADB_YERPY      GKPRKENDEQVDKLLAEISQPL-QEFSDEDIIARTMIPMINEVVRCLEEGIIASAAEGDM
FADB_YERPP      GKPRKENDEQVDKLLAEISQPL-QEFSDEDIIARTMIPMINEVVRCLEEGIIASAAEGDM
FADB_YERPG      GKPRKENDEQVDKLLAEISQPL-QEFSDEDIIARTMIPMINEVVRCLEEGIIASAAEGDM
FADB_YERPA      GKPRKENDEQVDKLLAEISQPL-QEFSDEDIIARTMIPMINEVVRCLEEGIIASAAEGDM
FADB_YERPN      GKPRKENDEQVDKLLAEISQPL-QEFSDEDIIARTMIPMINEVVRCLEEGIIASAAEGDM
FADB_YERPS      GKPRKENDEQVDKLLAEISQPL-QEFSDEDIIARTMIPMINEVVRCLEEGIIASAAEGDM
FADB_YERPB      GKPRKENDEQVDKLLAEISQPL-QEFSDEDIIARTMIPMINEVVRCLEEGIIASAAEGDM
FADB_YERP3      GKPRKENDEQVDKLLAEISQPL-QEFSDEDIIARTMIPMINEVVRCLEEGIIASAAEGDM
FADB_YERE8      GKPRKENDEQVDALLAQVSQPL-QKFSDDDIIARTMIPMINEVVRCLEEGIIASPAEGDM
FADB_SERP5      GKPRKDNDEQTDVLLAEVSQPR-QTISDEEIIARMMIPMINEVVRCLEENIIASPAEADM
FADB_PHOLL      GKPKKEQDEQTDQLLATICQQK-SNFSGEEIIARTMIPMINEVVRCLEEGVIASPAEADM
FADB_ALIF1      GKPKKNIDESTAGIIATVTNTT-QPYTSEQISARMMIPMINEVIRCLDEGIIASPAEADM
FADB_ALIFM      GKPKKNIDESTAGIIATVTNTT-QPYTSEQISARMMIPMINEVIRCLDEGIIASPAEADM
FADB_ALISL      GKPKKNIDEKTNAIIATITDST-QPYTSEQISARMMIPMINEVIRCLDEGIIASPAEADM
FADB_PHOPR      GKPKKNVDPAVAELLAPVLGAA-TDFTSDEIIARMMIPMINEVVRCLEECIIATPAEADM
FADB_VIBCH      GKPKKAFSDDVLAILAPVCGAP-QSFDPQTLIERTMIPMINEVVLCLEEGIIASAQEADM
FADB_VIBCM      GKPKKAFSDDVLAILAPVCGAP-QSFDPQTLIERTMIPMINEVVLCLEEGIIASAQEADM
FADB_VIBC3      GKPKKAFSDDVLAILAPVCGAP-QNFDPQTLIERTMIPMINEVVLCLEEGIIASAQEADM
FADB_VIBCB      GKPKKTFSEEILPVLADVCTDK-QDFDDQTIIQRMMIPMINEVVLCLQEGIIATPQEADM
FADB_VIBPA      GKPKKTFTEDILPVLADVCADK-QEFDEQTIIQRMMIPMINEVVLCLQEGIIATPQEADM
FADB_VIBVU      GKPKKAFSDEIVPILAPVCAAQ-QAFDDQTIIQRMMIPMINEVVLCLQEGIIASAQEADM
FADB_VIBVY      GKPKKAFSDEIVPILAPVCAAQ-QAFDDQTIIQRMMIPMINEVVLCLQEGIIASAQEADM
FADB_VIBTL      GRPKKTFSEDILPILADVCQQP-QDFDDQTIIQRVMIPMINEVVLCLEEGIIATPQEADM
FADB_AERHH      GKPKKVADAASYELLAPIAKPK-QDFDKDAIIARMMIPMINEVVLCLEEGIVATPAEADI
FADB_AERS4      GKPKKVADVAAYELLAPIAKPK-QDFDKEAIIAGMMIPMINEVVLCLEEGIVATPAEADI
FADB_SHEB8      GKPKKDVDPTSYGLLKDAFGEL-KAFEADDIIARTMIPMIIETVRCLEEGIVASPAEADM
FADB_SHEB2      GKPKKDVDPTSYGLLKDAFGEL-KAFEADDIIARTMIPMIIETVRCLEEGIVASPAEADM
FADB_SHEB9      GKPKKDVDPTSYGLLKDAFGEL-KAFEADDIIARTMIPMIIETVRCLEEGIVASPAEADM
FADB_SHEB5      GKPKKDVDPTSYGLLKDAFGEL-KAFEADDIIARTMIPMIIETVRCLEEGIVASPAEADM
FADB_SHEPC      GKPKKDVDPTSYGLLKDAFGEL-KTFEADDIIARTMIPMIIETVRCLEEGIVASPAEADM
FADB_SHESW      GKPKKDVDPTSYGLLKDAFGEL-KTFEADDIIARTMIPMIIETVRCLEEGIVASPAEADM
FADB_SHESA      GKPKKDVDPTSYELLKAAFGEQ-KAFDADEIIARTMIPMIIETVRCLEEGIVASPAEADM
FADB_SHESR      GKPKKDVDPTSYELLKAAFGEQ-KAFDADEIIARTMIPMIIETVRCLEEGIVASPAEADM
FADB_SHESM      GKPKKDVDPTSYELLKAAFGEQ-KAFDADEIIARTMIPMIIETVRCLEEGIVASPAEADM
FADB_SHEON      GKPKKDVDPTSYELLKAAFGEQ-KAFDADEIIARTMIPMIIETVRCLEEGIVASPAEADM
FADB_SHEFN      GKPKKDIDPTSYELLSAEFGEL-KAFESDDIIARCMIPMIIETVRCLEEGIIASPAEGDM
FADB_SHEHH      GKPKKDLDPTSYELLQAEFGEQ-KAFESDEIIARTMIPMIIETVRCLEEGIIASPAEADM
FADB_SHEPA      GKPKKDLDPTSYELLQAEFGEQ-KAFESDEIIARTMIPMIIETVRCLEEGIIASPAEADM
FADB_SHEPW      GKPKKDLDPTSYELLQGEFGER-KAFESDEIIARTMIPMIIETVRCLEEGIIASPAEADM
FADB_SHESH      GKPKKDVDPTSYELLGAEFGEL-KAFESEDIIARTMIPMIIETVRCLEEGIIATPAEADM
FADB_SHEWM      GKPKKDLDPTSYELLGAEFGDL-KAFESDEIIARTMIPMIIETVRCLEEGIIATPAEADM
FADB_SHEAM      GKPKKDVDPASYTMLAEAFGAQ-KAFEADEIIARTMIPMIIETVRCLEEGIVASPAEADM
FADB_SHELP      GKPKKEVDPLSYELLGNAFGEQ-KEFSSDEIIARTMIPMIIETVRCLEEGIIATPAEADM
FADB_COLP3      GRPMKVPAPVAYELLGQHCADK-KDFSSEEIIARMMIPMVNEVVRCLEEGVVDTAAEADM
FADB_IDILO      GKPTKEADPATYELLG--CEQG-KKLDADEVIARCMIPMVNEVVRCLEEDIVGSAAEADM
FADB_PSEF5      GKQKKVADPSVLEVLKPIVYEQ-REVTDEDIINWMMIPLCLETVRCLEDGIVETAAEADM
FADB_PSEPF      GKQKKVADPSVLEVLKPIVYEQ-REVTDEDIINWMMIPLCLETVRCLEDGIVETAAEADM
FADB_PSEFR      GKQKKLVDSSVLEVLKPIVYEQ-RDVTDEDIINWMMIPLCLETVRCLEDGIVETAAEADM
FADB_PSEP1      GKPKKVFDATVLDVLKPIVFEQ-REVTDEDIINWMMVPLCLETVRCLEDGIVETAAEADM
FADB_PSEPK      GKPKKVFDATVLDVLKPIVFEQ-REVTDEDIINWMMVPLCLETVRCLEDGIVETAAEADM
FADB_PSEPG      GKPKKVFDATVLDVLKPIVFEQ-REVTDEDIINWMMVPLCLETVRCLEDGIVETAAEADM
FADB_PSEPW      GKPKKVFDATVLDVLKPIVFEQ-REVTDEDIINWMMVPLCLETVRCLEDGIVETAAEADM
FADB_PSEPU      GKPKKVFDAAVLDVLKPIVFEQ-REVTDEDIINWMMVPLCLETVRCLEDGIVETAAEADM
FADB_PSEOL      GKPKKVADASVLDVLKPIVFEQ-REVTDEDIINWMMIPLCLETVRCLEDGIVETAAEADM
FADB_PSEE4      GKPKKVADASVLDVLKPVIFEQ-REVSDEDIINWMMVPLCLETVRCLEDGIVETAAEADM
FADB_PSE14      GKPKKVNDPAVLDVLKPIVYEQ-REVSDEDIINWMMIPLCLETVRCLEDGIVETAAEADM
FADB_PSESM      GKPKKVNDPAVLDVLKPIVYEQ-REVSDEDIINWMMIPLCLETVRCLEDGIVETAAEADM
FADB_PSEU2      GKPKKVNDPAVLDVLKPIVYEQ-REVSDEDIVNWMMIPLCLETVRCLEDGIVETAAEADM
FADB_PSEAE      GKPKKVTDPQAYEVLKPIVVEQ-REVTDEDIVNFMMIPLCLETVRCLEDGIVETAAEADM
FADB_PSEAB      GKPKKVTDPQAYEVLKPIVVEQ-REVTDEDIVNFMMIPLCLETVRCLEDGIVETAAEADM
FADB_PSEA8      GKPKKVTDPQAYEVLKPIVVEQ-REVTDEDIVNFMMIPLCLETVRCLEDGIVETAAEADM
FADB_PSEA7      GKPKKVTDPQAYEVLKPIVVEQ-REVTDEDIVNFMMIPLCLETVRCLEDGIVETAAEADM
FADB_PSEMY      GKPKKVSDPEAYELLKSIVVEE-REVTDEDIINFMMIPLCLETVRCLEDGIVDTAAEADM
FADB_PSEU5      GKPKKVVDPQAYELLKPIVAET-RELSDEDIINYMMIPLCLETVRCLEDGIVETAAEADM
FADB_ACIB5      GKKAKTVDPTAYEVIAPFVTGEKREFDNQEIIDRMMLALCNETVRCLEDNIVATASEADM
FADB_ACIB3      GKKAKTVDPTAYEVIAPFVTGEKREFDNQEIIDRMMLALCNETVRCLEDNIVATASEADM
FADB_ACIBY      GKKAKTVDPTAYEVIAPFVTGEKREFDNQEIIDRMMLALCNETVRCLEDNIVATASEADM
FADB_ACIBC      GKKAKTVDPTAYEVIAPFVTGEKREFDNQEIIDRMMLALCNETVRCLEDNIVATASEADM
FADB_ACIBS      GKKAKTVDPTAYEVIAPFVTGEKREFDNQEIIDRMMLALCNETARCLEDNIVATASEADM
FADB_ACIAD      GKKAKTVDSTAYEVIAPVVTSEKREFDAQEIIDRMMLALCNETVRCLEDNIVATPAEADM
FADB_PSYA2      GKPKKVADEATYELLKTTTDSEKQTFDDQAIIDRTMLAFCNETVRCLEDNIVSTPSEADM
FADB_PSYCK      GKPKKVADEATYELLKTTTDSDKQTFEDQAIIDRTMLAFCNETVRCLEDNIVSTPSEADM
FADB_PSYWF      GKPKKTADDATYALLKDTTDTDNQQFDDQTIIDRMMLAFCNETVRCLEDNIVATPSEADM
                *:  *        ::             : :    *:.:  *.  **:: :: :. *.*:

FADB_ECO55      ALVYGLGFPPFHGGAFRWLDTLGSAKYLDMAQQYQHLGPLYEVPEGLRNKARHNEPYYPP
FADB_ECOLC      ALVYGLGFPPFHGGAFRWLDTLGSAKYLDMAQQYQHLGPLYEVPEGLRNKARHNEPYYPP
FADB_ECO8A      ALVYGLGFPPFHGGAFRWLDTLGSAKYLDMAQQYQHLGPLYEVPEGLRNKARHNEPYYPP
FADB_SHIB3      ALVYGLGFPPFHGGAFRWLDTLGSAKYLDMAQQYQHLGPLYEVPEGLRNKARHNEPYYPP
FADB_ECODH      ALVYGLGFPPFHGGAFRWLDTLGSAKYLDMAQQYQHLGPLYEVPEGLRNKARHNEPYYPP
FADB_ECOLI      ALVYGLGFPPFHGGAFRWLDTLGSAKYLDMAQQYQHLGPLYEVPEGLRNKARHNEPYYPP
FADB_SHISS      ALVYGLGFPPFHGGAFRWLDTLGSAKYLDMAQQYQHLGPLYEVPEGLRNKARHNEPYYPP
FADB_ECOSE      ALVYGLGFPPFHGGAFRWLDTLGSAKYLDMAQQYQHLGPLYEVPEGLRNKARHNEPYYPP
FADB_ECO24      ALIYGLGFPPFHGGAFRWLDTLGSAKYLDMAQQYQHLGPLYEVPEGLRNKARHNEPYYPP
FADB_ESCF3      ALVYGLGFPPFHGGAFRWLDTLGSAKYLDMAQQYQHLGPLYEVPEGLRNKARHNEPYYPQ
FADB_ECO57      ALVYGLGFPPFHGGAFRWLDTLGSAKYLDMAQQYQHLGPLYEVPEGLRNKARHNEPYYPP
FADB_ECO5E      ALVYGLGFPPFHGGAFRWLDTLGSAKYLDMAQQYQHLGPLYEVPEGLRNKARHNEPYYPP
FADB_SHIDS      ALVYGLGFPPFHGGAFRWLDTLGSAKYLDMAQQYQHLGPLYEVPEGLRNKARHNEPYYPP
FADB_ECOSM      ALVYGLGFPPFHGGAFRWLDTLGSAKYLDMAQQYQHLGPLYEVPEGLRNKARHNEPYYPP
FADB_SHIFL      ALVYGLGFPPFHGGAFRWLDTLGSAKYLDMAQQYQHLGPLYEVPEGLRNKARHNEPYYPP
FADB_SHIF8      ALVYGLGFPPFHGGAFRWLDTLGSAKYLDMAQQYQHLGPLYEVPEGLRNKARHNEPYYPP
FADB_ECOHS      ALVYGLGFPPFHGGAFRWLDTLGSAKYLDMAQQYQHLGPLYEVPEGLRNKARHNEPYYPP
FADB_ECOUT      ALVYGLGFPPFHGGAFRWLDTLGSAKYLDMAQQYQHLGPLYEVPEGLRNKARHNEPYYPP
FADB_ECO45      ALVYGLGFPPFHGGAFRWLDTLGSAKYLDMAQQYQHLGPLYEVPEGLRNKARHNEPYYPP
FADB_ECO81      ALVYGLGFPPFHGGAFRWLDTLGSAKYLDMAQQYQHLGPLYEVPEGLRNKARHNEPYYPP
FADB_ECOL6      ALVYGLGFPPFHGGAFRWLDTLGSAKYLDMAQQYQHLGPLYEVPEGLRNKARHNEPYYPP
FADB_ECOL5      ALVYGLGFPPFHGGAFRWLDTLGSAKYLDMAQQYQHLGPLYEVPEGMRNKARHNEPYYPP
FADB_ECO27      ALVYGLGFPPFHGGAFRWLDTLGSAKYLDMAQQYQHLGPLYEVPEGLRNKARHNEPYYPP
FADB_ECOLU      ALVYGLGFPPFHGGAFRWLDTLGSAKYLDMAQQYQHLGPLYEVPEGLRNKARHNEPYYPP
FADB_ECO7I      ALVYGLGFPPFHGGAFRWLDTLGSAKYLDMAQQYQHLGPLYEVPEGLRNKARHNEPYYPP
FADB_SALG2      ALVYGLGFPPFHGGAFRWLDTQGSAKYLDMAQQYQHLGPLYEVPEGLRNKARHNEPYYPP
FADB_SALTI      ALVYGLGFPPFHGGAFRWLDTQGSAKYLDMAQQYQHLGPLYEVPEGLRDKTRHNEPYYPP
FADB_SALEP      ALVYGLGFPPFHGGAFRWLDTQGSAKYLDMAQQYQHLGPLYEVPEGLRNKARHNEPYYPP
FADB_SALA4      ALVYGLGFPPFHGGAFRWLDTQGSAKYLDMAQQYQHLGPLYEVPEGLRDKARHNEPYYPP
FADB_SALCH      ALVYGLGFPPFHGGAFRWLDTQGSAKYLDMAQQYQHLGPLYEVPEGLRNKARHNEPYYPP
FADB_SALPB      ALVYGLGFPPFHGGAFRWLDTQGSAKYLDMAQQYQHLGPLYEVPEGLRNKARHNEPYYPP
FADB_SALNS      ALVYGLGFPPFHGGAFRWLDTQGSAKYLDMAQQYQHLGPLYEVPEGLRNKARHNEPYYPP
FADB_SALTY      ALVYGLGFPPFHGGAFRWLDTQGSAKYLDMAQQYQHLGPLYEVPEGLRNKARHNEPYYPP
FADB_SALPA      ALVYGLGFPPFHGGAFRWLDTQGSAKYLDMAQQYQHLGPLYEVPEGLRNKARHNEPIIPR
FADB_SALPK      ALVYGLGFPPFHGGAFRWLDTQGSAKYLDMAQQYQHLGPLYEVPEGLRNKARHNEPIIPR
FADB_SALSV      ALVYGLGFPPFHGGAFRWLDTQGSAKYLDMAQQYQHLGPLYEVPEGLRNKARHNEPYYPP
FADB_CITK8      ALVYGLGFPPFHGGAFRWLDTLGSAKYLDMAQQYQHLGPLYEVPEGLRNKARHNEPYYPP
FADB_ENTCL      ALVYGLGFPPFHGGAFRWLDTLGSARYLDMAQQYQHLGPLYEVPEGLRNKARHNEPYYPA
FADB_ENT38      ALVYGLGFPPFHGGAFRWLDTLGSAKYLDMAQQYQQLGPLYEVPDGLRNKARHNEPYYPP
FADB_KLEP3      ALVYGLGFPPFHGGAFRWLDTIGSAKYLDMAQQYQHLGPLYEVPAGLRDKARHNEAYYPQ
FADB_KLEP7      ALVYGLGFPPFHGGAFRWLDTIGSAKYLDMAQQYQHLGPLYEVPAGLRDKARHNEAYYPQ
FADB_CROS8      ALVYGLGFPPFHGGAFRWLDTQGSAKYLDMAQHYQHLGPLYEAPAGLRDKASHNAPYYPQ
FADB_PECAS      ALVYGLGFPPFHGGACRYLDTLGSERYVEMAQQLAHLGAIYQVPDGLQQKARSNEGYYPS
FADB_YERPE      ALVYGLGFPPFHGGVFRYLDTLGSANYVEMAQRYAHLGALYHVPAGLRAKAEHNESYYPV
FADB_YERPY      ALVYGLGFPPFHGGVFRYLDTLGSANYVEMAQRYAHLGALYHVPAGLRAKAEHNESYYPV
FADB_YERPP      ALVYGLGFPPFHGGVFRYLDTLGSANYVEMAQRYAHLGALYHVPAGLRAKAEHNESYYPV
FADB_YERPG      ALVYGLGFPPFHGGVFRYLDTLGSANYVEMAQRYAHLGALYHVPAGLRAKAEHNESYYPV
FADB_YERPA      ALVYGLGFPPFHGGVFRYLDTLGSANYVEMAQRYAHLGALYHVPAGLRAKAEHNESYYPV
FADB_YERPN      ALVYGLGFPPFHGGVFRYLDTLGSANYVEMAQRYAHLGALYHVPAGLRAKAEHNESYYPV
FADB_YERPS      ALVYGLGFPPFHGGVFRYLDTLGSANYVEMAQRYAHLGALYHVPAGLRAKAEHNESYYPV
FADB_YERPB      ALVYGLGFPPFHGGVFRYLDTLGSANYVEMAQRYAHLGALYHVPAGLRAKAEHNESYYPV
FADB_YERP3      ALVYGLGFPPFHGGVFRYLDTLGSANYVEMAQRYAHLGALYHVPAGLRAKAEHNESYYPV
FADB_YERE8      ALVYGLGFPPFHGGVFRYLDTIGSANYVEMAQRYTHLGALYQVPPGLRAKAEHNESYYPV
FADB_SERP5      ALVYGIGFPPFHGGAFRYLDTLGTANYVELAQRYAHLGALYQVPAGLRAKAEHNESYYPV
FADB_PHOLL      ALVYGLGFPPFHGGVFRYLETMGTAAYVKMAENYAHLGALYQVPPGLKAKAERNESYYST
FADB_ALIF1      ALVYGLGFPPFKGGVFRYLDAIGLTTYLDMAKEFEHLGAVYQVPESIKQKAADDECYYPA
FADB_ALIFM      ALVYGLGFPPFKGGVFRYLDAIGLTTYLDMAKEFEHLGAVYQVPESIKQKAADGECYYPA
FADB_ALISL      ALVYGLGFPPFKGGVFRYLDSIGLDTYLDMAKEFEQLSPVYQVPDSIKQKAAAGECYYPA
FADB_PHOPR      ALVYGLGFPPFRGGVFRYIDTLGLAEYVAMADKFAHLGAVYEVPTGLREKAAKGESYYTQ
FADB_VIBCH      ALVYGLGFPPFRGGVFRYLDTIGIANYVAMAEKYADLGALYQVPQLLKNMAQQGTSFYSA
FADB_VIBCM      ALVYGLGFPPFRGGVFRYLDTIGIANYVAMAEKYADLGALYQVPQLLKNMAQQGTSFYSA
FADB_VIBC3      ALVYGLGFPPFRGGVFRYLDTIGIANYVAMAEKYADLGALYQVPQLLKNMAQQGTSFYSA
FADB_VIBCB      TLVYGLGFPPFRGGVFRYLDSVGIAEFVAMAKQYSELGAMYQVPQMLIDMAAKGESFYGA
FADB_VIBPA      ALVYGLGFPPFRGGVFRYLDSVGIAEFVEMAKQHADLGAMYHVPQMLIDMAAKGESFYGA
FADB_VIBVU      ALVYGLGFPPFRGGVFRYLDSVGIANFVAMAQQHVELGAMYQVPQMLIDMAEKGQTFYGA
FADB_VIBVY      ALVYGLGFPPFRGGVFRYLDSVGIANFVAMAQQHVELGAMYQVPQMLIDMAERGQTFYGA
FADB_VIBTL      ALVYGLGFPPFRGGVFRYLDSVGIGNFVEMAKSYQDLGAMYQVPQLLLDMAAKGESFYDG
FADB_AERHH      ALVYGLGFPPFRGGVFRYLDTIGLDRYVAMADQYADLGPLYRVSDKLREMAAQGKTFY--
FADB_AERS4      ALVYGLGFPPFRGGVFRYLDTIGLDRYVAMADQYADLGPLYRVSDRLREMAAQGKTFY--
FADB_SHEB8      GLVYGLGFPPFRGGVFRYLDTMGVANFVALADKYAHLGGLYQVTDAMRTLAANNGSYYQA
FADB_SHEB2      GLVYGLGFPPFRGGVFRYLDTMGVANFVALADKYAHLGGLYQVTDAMRTLAANNGSYYQA
FADB_SHEB9      GLVYGLGFPPFRGGVFRYLDTMGVANFVALADKYAHLGGLYQVTDAMRTLAANNGSYYQA
FADB_SHEB5      GLVYGLGFPPFRGGVFRYLDTMGVANFVALADKYAHLGGLYQVTDAMRTLAANNGSYYQA
FADB_SHEPC      GLVYGLGFPPFRGGVFRYLDTMGVANFVALADKYAHLGGLYQVTDAMRTKATNNGSYYQA
FADB_SHESW      GLVYGLGFPPFRGGVFRYLDTMGVANFVALADKYAHLGGLYQVTDAMRTKATNNGSYYQA
FADB_SHESA      GLVYGLGFPPFRGGVFRYLDTMGVANFVALADKYAHLGGLYQVTDAMRALAANNGSYYQA
FADB_SHESR      GLVYGLGFPPFRGGVFRYLDTMGVANFVALADKYAHLGGLYQVTDAMRALAANNGSYYQA
FADB_SHESM      GLVYGLGFPPFRGGVFRYLDTMGVANFVALADKYAHLGGLYQVTDAMRTLAANNGSYYQA
FADB_SHEON      GLVYGLGFPPFRGGVFRYLDTMGVANFVALADKYAHLGGLYQVTDAMRALAANNGSYYQA
FADB_SHEFN      GLVYGIGFPPFRGGVFRYLDTMGVANFVALADKYAHLGGLYQVTDAMRALAANNGSYYQA
FADB_SHEHH      GLVYGLGFPPFRGGVFRYLDTIGVANFVALADKYAHLGGLYQVTDTMRELAANNGSYYQQ
FADB_SHEPA      GLVYGLGFPPFRGGVFRYLDTMGVANFVALADKYAHLGGLYQVTDTMRELAANNGSYYQQ
FADB_SHEPW      GLVYGLGFPPFRGGVFRYLDTMGVANFVALADKYAHLGGLYQVTDAMRELAANNGSYYQQ
FADB_SHESH      GLVFGLGFPPFRGGVFRYIDTMGVANFVALADKYAHLGGLYQVTDAMRELAANNGSYYQS
FADB_SHEWM      GLVFGLGFPPFRGGVFRYIDTMGVANFVALADKYAHLGGLYQVTDAMRELAANNGSYYQA
FADB_SHEAM      GLVYGLGFPPFRGGVFRYLDTMGVANFVALADKYAHLGGLYQVTDAMRELASNNGSYYPK
FADB_SHELP      GLVYGLGFPPFRGGVFRYLDTLGVANFVALADQYAHLGGLYQVTDKMRELAATNGSYYPA
FADB_COLP3      GLIYGVGFPPFRGGAIRYLETLGLDNFIAMADKYTDLGEIYHVTDGLREMAKSGKSYFTT
FADB_IDILO      ALLYGLGFPPFRGGPFRYLETLGMDNFIQLADKYAHLGEIYQVTDGMREMAKAGKSYFDT
FADB_PSEF5      GLVYGIGFPPFRGGALRYIDSIGVAEFVALADQYADLGALYHPTAKLREMAKNGQSFFG-
FADB_PSEPF      GLVYGIGFPPFRGGALRYIDSIGVAEFVALADQYADLGALYHPTAKLREMAKNGQSFFG-
FADB_PSEFR      GLVYGIGFPLFRGGALRYIDSIGVAEFVALADQYAELGALYHPTAKLREMAKNGQSFFG-
FADB_PSEP1      GLVYGIGFPPFRGGALRYIDSIGVAEFVALADQYADLGPLYHPTAKLREMAKNGQRFFN-
FADB_PSEPK      GLVYGIGFPPFRGGALRYIDSIGVAEFVALADQYADLGPLYHPTAKLREMAKNGQRFFN-
FADB_PSEPG      GLVYGIGFPPFRGGALRYIDSIGVAEFVALADQYADLGPLYHPTAKLREMAKNGQRFFN-
FADB_PSEPW      GLVYGIGFPPFRGGALRYIDSIGVAEFVALADQYADLGPLYHPTAKLREMAKNGQRFFS-
FADB_PSEPU      GLVYGIGFPPFRGGALRYIDSIGVAEFVALADQYADLGPLYHPTAKLREMAKNGQRFFN-
FADB_PSEOL      GLVYGIGFPPFRGGALRYIDSIGVAEFVALADQYADLGPLYHPTAKLREMAKNGQRFFN-
FADB_PSEE4      GLVYGIGFPPFRGGALRYIDSIGVAEFVALADKYADLGPLYHATAKLREMAKNGQRFFN-
FADB_PSE14      GLIYGIGFPPFRGGALRYIDSIGVAEFVALADQYAELGALYQPTAKLREMASKGQSFFGQ
FADB_PSESM      GLIYGIGFPPFRGGALRYIDSIGVAEFVALADRYAELGALYQPTAKLREMAANGQSFFGQ
FADB_PSEU2      GLIYGIGFPPFRGGALRYIDSIGVAEFVALADQYAELGALYQPTAKLREMAANGQSFFGQ
FADB_PSEAE      GLIYGIGFPPFRGGALRYIDSIGVAEFVALADKYAELGALYHPTAKLREMAKNGQKFFG-
FADB_PSEAB      GLIYGIGFPPFRGGALRYIDSIGVAEFVALADKYAELGALYHPTAKLREMAKNGQKFFG-
FADB_PSEA8      GLIYGIGFPPFRGGALRYIDSIGVAEFVALADKYAELGALYHPTAKLREMAKNGQKFFG-
FADB_PSEA7      GLIYGIGFPPFRGGALRYIDSIGVAEFVALADKYAELGALYHPTAKLREMAKNGQKFFG-
FADB_PSEMY      GLIYGIGFPPFRGGALRYIDSIGVAEFVALADKYADLGALYHPTAKLREMAAKGQKFFG-
FADB_PSEU5      GLIYGIGFPPFRGGALRYIDSIGVAEFVAMADKYADLGPLYHPTAKLREMAANGQRFYG-
FADB_ACIB5      AMIMGIGFPPFRGGPCRYIDQTGVAEYVALCDKYAHLGKAYEAPQMLRDMAANNKKFYG-
FADB_ACIB3      AMIMGIGFPPFRGGPCRYIDQTGVAEYVALCDKYAHLGKAYEAPQMLRDMAANNKKFYG-
FADB_ACIBY      AMIMGIGFPPFRGGPCRYIDQTGVAEYVALCDKYAHLGKAYEAPQMLRDMAANNKKFYG-
FADB_ACIBC      AMIMGIGFPPFRGGPCRYIDQTGVAEYVALCDKYAHLGKAYEAPQMLRDMAANNKKFYG-
FADB_ACIBS      AMIMGIGFPPFRGGPCRYIDQTGVAEYVALCDKYAHLGKAYEAPQMLRDMAANNKKFYG-
FADB_ACIAD      AMIMGIGFPPFRGGPCRYIDQTGVAEYVALCNKYAHLGKAYEAPQLLRDMAENNKKFYG-
FADB_PSYA2      AMIMGVGFPPFRGGPCRYIDQMGLDNYLALCEKYAHLGKAYEAPQKIRDMAAAGETFYAT
FADB_PSYCK      AMIMGVGFPPFRGGPCRYIDQMGLDNYLALCEKYAYLGKAYEAPQKIRDMAAAGETFYAT
FADB_PSYWF      AMIMGVGFPAFRGGPCRYIDQVGLDNYLALCEKYAHLGKAYEAPQKIRDMAAAGETFYPK
                 :: *:*** *:**  *:::  *   :: :..    *.  *. .  :   :  .      

FADB_ECO55      VEPARPVGDLKTA
FADB_ECOLC      VEPARPVGDLKTA
FADB_ECO8A      VEPARPVGDLKTA
FADB_SHIB3      VEPARPVGDLKTA
FADB_ECODH      VEPARPVGDLKTA
FADB_ECOLI      VEPARPVGDLKTA
FADB_SHISS      VEPARPVGDLKTA
FADB_ECOSE      VEPARLVGDLKTA
FADB_ECO24      VEPARPVGDLKTA
FADB_ESCF3      VEPARAVGDLKTA
FADB_ECO57      VEPARPVGDLKTA
FADB_ECO5E      VEPARPVGDLKTA
FADB_SHIDS      VEPARPVGDLKTA
FADB_ECOSM      VEPARPVGDLKTA
FADB_SHIFL      VEPARPVGDLKTA
FADB_SHIF8      VEPARPVGDLKTA
FADB_ECOHS      VEPARPVGDLKTA
FADB_ECOUT      VEPARPVGDLKTA
FADB_ECO45      VEPARPVGDLKTA
FADB_ECO81      VEPARPVGDLKTA
FADB_ECOL6      VEPARPVGDLKTA
FADB_ECOL5      VEPARPVGDLKTA
FADB_ECO27      VEPARPVGDLKTA
FADB_ECOLU      VEPARPVGDLKTA
FADB_ECO7I      VEPARPVGDLKTA
FADB_SALG2      VEPARPVGSLKTA
FADB_SALTI      VEPARPVGSLKTA
FADB_SALEP      VEPARPVGSLKTA
FADB_SALA4      VEPARPVGSLKTA
FADB_SALCH      VEPARPVGSLKTA
FADB_SALPB      VEPARPVGSLKTA
FADB_SALNS      VEPARPVGSLKTA
FADB_SALTY      VEPARPVGSLKTA
FADB_SALPA      LNQPVRLVL----
FADB_SALPK      LNQPVRLVL----
FADB_SALSV      VEPARPVGSLKTA
FADB_CITK8      VEPARPVGDLKTA
FADB_ENTCL      VEPARPVGELKTA
FADB_ENT38      VEPARPVGALKTA
FADB_KLEP3      VEPARPVGALKTA
FADB_KLEP7      VEPARPVGALKTA
FADB_CROS8      VEPAQPVGELQTA
FADB_PECAS      VAPHADVSHGQPA
FADB_YERPE      AAALLDVSTNQPA
FADB_YERPY      AAALLDVSTNQPA
FADB_YERPP      AAALLDVSTNQPA
FADB_YERPG      AAALLDVSTNQPA
FADB_YERPA      AAALLDVSTNQPA
FADB_YERPN      AAALLDVSTNQPA
FADB_YERPS      AAALLDVSTNQPA
FADB_YERPB      AAALLDVSTNQPA
FADB_YERP3      SAALLDVSTNQPA
FADB_YERE8      AAALLDVSISQPA
FADB_SERP5      AAPLSDVSTGQPA
FADB_PHOLL      AATIA-VSTGKTA
FADB_ALIF1      PQS-LSAPSA---
FADB_ALIFM      PQS-LSAPSA---
FADB_ALISL      PKSSVSSPSV---
FADB_PHOPR      QVNA---------
FADB_VIBCH      QQVSAL-------
FADB_VIBCM      QQVSAL-------
FADB_VIBC3      QQASAL-------
FADB_VIBCB      QQQGSI-------
FADB_VIBPA      QQQGSI-------
FADB_VIBVU      QQQGSI-------
FADB_VIBVY      QQQGSI-------
FADB_VIBTL      QQASSL-------
FADB_AERHH      -------------
FADB_AERS4      -------------
FADB_SHEB8      -------------
FADB_SHEB2      -------------
FADB_SHEB9      -------------
FADB_SHEB5      -------------
FADB_SHEPC      -------------
FADB_SHESW      -------------
FADB_SHESA      -------------
FADB_SHESR      -------------
FADB_SHESM      -------------
FADB_SHEON      -------------
FADB_SHEFN      -------------
FADB_SHEHH      A------------
FADB_SHEPA      A------------
FADB_SHEPW      A------------
FADB_SHESH      -------------
FADB_SHEWM      -------------
FADB_SHEAM      A------------
FADB_SHELP      -------------
FADB_COLP3      DVKLA--------
FADB_IDILO      TSAK---------
FADB_PSEF5      -------------
FADB_PSEPF      -------------
FADB_PSEFR      -------------
FADB_PSEP1      -------------
FADB_PSEPK      -------------
FADB_PSEPG      -------------
FADB_PSEPW      -------------
FADB_PSEPU      -------------
FADB_PSEOL      -------------
FADB_PSEE4      -------------
FADB_PSE14      ASSEE--------
FADB_PSESM      ASSEV--------
FADB_PSEU2      ASSEE--------
FADB_PSEAE      -------------
FADB_PSEAB      -------------
FADB_PSEA8      -------------
FADB_PSEA7      -------------
FADB_PSEMY      -------------
FADB_PSEU5      -------------
FADB_ACIB5      -------------
FADB_ACIB3      -------------
FADB_ACIBY      -------------
FADB_ACIBC      -------------
FADB_ACIBS      -------------
FADB_ACIAD      -------------
FADB_PSYA2      A------------
FADB_PSYCK      A------------
FADB_PSYWF      A------------