CLUSTAL format seed alignment for MF_01622

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

SELU_ECOK1      -----------MQERHTEQDYRALLIADTPIIDVRAPIEFEQGAMPAAINLPLMNNDERA
SELU_ECOUT      -----------MQERHTEQDYRALLIADTPIIDVRAPIEFEQGAMPAAINLPLMNNDERA
SELU_ECOL5      -----------MQERHTEQDYRALLIADTPIIDVRAPIEFEQGAMPAAINLPLMNNDERA
SELU_ECOL6      -----------MQERHTEQDYRALLIADTPIIDVRAPIEFEQGAMPAAINLPLMNNDERA
SELU_SHIBS      -----------MQERHTEQDYRALLIADTPIIDVRAPIEFEQGAMPAAINLPLMNNDERA
SELU_SHISS      -----------MQERHTEQDYRALLIADTPIIDVRAPIEFEQGAMPAAINLPLMNNDERA
SELU_SHIDS      -----------MQERHTEQDYRALLIADTPIIDVRAPIEFEQGAMPAAINLPLMNNDERA
SELU_ECOLI      -----------MQERHTEQDYRALLIADTPIIDVRAPIEFEHGAMPAAINLPLMNNDERA
SELU_ECO57      -----------MQERHTEQDYRALLIADTPIIDVRAPIEFEQGAMPAAINLPLMNNDERA
SELU_SHIF8      -----------MQERHTEQDYRALLIADTPIIDVRAPIEFEQGAMPAAINLPLMDNDERA
SELU_SHIFL      -----------MQERHTEQDYRALLIADTPIIDVRAPIEFEQGAMPAAINLPLMDNDERA
SELU_SALTY      -----------MQDRQKAQDYRALLLADTPLIDVRAPIEFEQGAMPGAINLPLMMDDERA
SELU_SALCH      -----------MQDRQKAQDYRALLLADTPLIDVRAPIEFEQGAMPGAINLPLMMDDERA
SELU_SALTI      -----------MQDRQKAQDYRALLLADTPLIDVRAPIEFEQGAMPGAINLPLMMDDERA
SELU_SALEN      -----------MQDRQKAQDYRALLLADTPLIDVRAPIEFEQGAMPGAINLPLMMDDERA
SELU_SALPA      -----------MQDRQKAQDYRALLLADTPLIDVRAPIEFEQGAMPGAINLPLMMDDERA
SELU_PSYIN      ---------MQQSDLQEQQLYRSLFLLKTPLIDLRAPVEFAQGAFPESCNLPLMTDNERE
SELU_PHOPR      ---------MLMP-RQNCEVFRQLFVNDTPLMDMRAPIEFAQGAFPTSINHPLMEDEERK
SELU_COLP3      MSINTSGKITSATERADSADFRTIIRNKIPLMDVRAPVEFGKGAFDLSINYPLMNNDERA
SELU_CHRSD      --------------MSLPHLAPEMALLERPLIDVRAPVEFARGALPGAVNLPLMDDAERH
SELU_AERHH      -----------MSALPLATDYARIFLDDVPLIDLRAPIEFKEGAFPCSTNLPLMTDDERA
SELU_AERS4      -----------MSQLPLTSDLARIFLDDVPLIDLRAPIEFKEGAFPCSTSLPLMTDDERA
SELU_SHEDO      ----------MTRQIIPSSEFASLFLQARPLIDVRAPIEFTKGAFPSAINLPLMKDSERE
SELU_SHEFN      -----------MSEVIPSSEYGRLLLENRPLIDVRAPIEFTKGAFGHSINLPLMQDGERE
SELU_SHESM      ----------MTTKLIPAQQYHDIFVAGKPLIDLRAPIEFDRGAFPSSVNLPLMVDKERE
SELU_SHESR      ----------MTTKLIPAQQYHDIFIAGQPLIDLRAPIEFDRGAFPSSVNLPLMVDKERE
SELU_SHESA      ----------MTTKLIPAQQYHDIFIAGQPLIDLRAPIEFDRGAFPSSVNLPLMVDKERE
SELU_SHEON      ----------MTTTLIPAQQYRDIFVAGKPLIDLRAPIEFNRGAFPSSVNLPLMVDKERE
SELU_SHESW      ----------MPSAIVAAEQYREIFLNQHPMMDVRAPIEFTRGAFPNSTNLPLMLDSERE
SELU_SHELP      ------MDNHQLANVIPASEYGRILASGHPIMDVRAPIEFTKGAFPASSNHPLMRDDERQ
SELU_SHEAM      ----------MSTNTVPAKQYREIFLKGHPIMDVRAPIEFSKGAFPNAVNLPLMTDSERQ
SELU_PSEAB      -------------MRDNTQHYRELFLDDIPLMDVRAPVEYHKGAFPNTVNRPLMNDIERQ
SELU_PSEAE      -------------MRDNTQHYRELFLDDIPLMDVRAPVEYHKGAFPNTVNRPLMNDIERQ
SELU_PSEE4      -------------MRPDCTDFNTLFLDDVPMMDMRAPIEFTKGAFPGVVNLPLMNDQERQ
SELU_PSEPK      -------------MRPDCTDFRQLFLDDVPMMDMRAPVEFAKGAFPGVVNLPLMNDQERQ
SELU_PSE14      -------------MADNSSDYRALFLNDVPMMDARAPVEFSKGAFPGVINLPLMNDIERQ
SELU_PSEU2      -------------MADNSSDYRALFLNDVPMMDARAPVEFSKGAFPGVINLPLMNDIERQ
SELU_PSESM      -------------MADNSSDYRALFLNDVPMMDARAPVEFSKGAFPGVINLPLMNDIERQ
SELU_PSEPF      -------------MSIDVTDYRDIFLNDRPLMDARAPVEFHKGAFPGAVNLPLMNDIERQ
SELU_PSEF5      -------------MPLDCTDYREIFLNDRPMMDTRAPIEFTKGAFPGVLNLPLMTDQERQ
SELU_BORBR      -------------MRADTRDFRALFLGDAPLLDTRAPVEFAKGAFPGAVNLPLMSDAERH
SELU_VEREI      -------------MRQDDAQLRHIFLHDVPLLDVRAPVEFAQGAFPGAVNHPLMDDAERH
SELU_CUPNH      -------------MRPDTADFRTLFLSGVAMLDVRAPLEFARGAFPGAVNLPLMDDAERH
SELU_CUPPJ      -------------MREDTGDFRRLFLSGTPMMDVRAPLEFARGAFPGTVNLPLMDDEERH
SELU_HAHCH      --------MKAFGDGQDTEDYLNLFLSGAPLLDTRAPVEFHKGAFPGAVNLPLMTDDERA
SELU_ALCBS      -------------MRDDTCDYLSLFLNDTPLLDVRAPVEFAKGAFPGTTNLALINDEERH
SELU_MARHV      -----------MASRPDTDDYLNLFLNDVPLMDVRAPVEFAKGSFPSAENAPLMNDEERH
SELU_HYDCU      -------------MVPQSDDFERIVLKNIPLIDVRAPVEFAQGAFEMAHNLPLMNDEERQ
SELU_SULDN      -------------MTLLFDDFKSIVLNKTPLLDVRAPVEFKKGAFLNAVNLPIMNDEERH
SELU_NITEC      ----------MNNPNIDSDELTALFTADTPLIDVRAPLEFILGSLPGSVNLPILNNEERA
SELU_NITEU      ----------MRNPDIGIDDLTALFIADTPLIDVRAPVEFTQGSLPGAVNLPILNDEERA
SELU_BDEBA      ----------MSLKNIKPDQLKNLFQQNIPLMDVRAPVEFSQGSIPGAVNLPVMNDDERA
                                       :     .::* ***:*:  *::    . .:: : ** 

SELU_ECOK1      AVGICYKQQGSDAALALGHKLVAGEIRQQRMDAWRAACLQNPHGILCCARGGQRSHIVQR
SELU_ECOUT      AVGICYKQQGSDAALALGHKLVAGEIRQQRMDAWRAACLQNPHGILCCARGGQRSHIVQR
SELU_ECOL5      AVGICYKQQGSDAALALGHKLVAGEIRQQRIDAWRAACLQNPHGILCCARGGQRSHIVQR
SELU_ECOL6      AVGICYKQQGSDAALALGHKLVAGEIRQQRMDAWRAACLQNPHGILCCARGGQRSHIVQR
SELU_SHIBS      AVGTCYKQQGSDAALALGHKLVAGEIRQQRIDAWRAACLQNPQGILCCARGGQRSHIVQS
SELU_SHISS      AVGTCYKQQGSDAALALGHKLVAGEIRQQRMDAWRAACLQNPQGILCCARGGQRSHIVQS
SELU_SHIDS      AVGTCYKQQGSDAALALGHKLVAGEIRQQRMDAWRAACLQNPQGILCCARGGQRSHIVQS
SELU_ECOLI      AVGTCYKQQGSDAALALGHKLVAGEIRQQRMDAWRAACLQNPQGILCCARGGQRSHIVQS
SELU_ECO57      AVGTCYKQQGSDAALALGHKLVAGEIRQQRMDAWRAACLQNPQGILCCARGGQRSHIVQS
SELU_SHIF8      AVGTCYKQQGSDAALALGHKLVAGEIRQQRMYAWRAACLQNPQGILCCARGGQRSHIVQR
SELU_SHIFL      SVGTCYKQQGSDAALALGHKLVAGEIRQQRMYAWRAACLQNPQGILCCARGGQRSHIVQR
SELU_SALTY      AVGTCYKRQGADAALALGHRLVCGDIRQQRLEAWKAAYQRFPNGYLCCARGGQRSHIVQR
SELU_SALCH      AVGTCYKRQGADAALALGHRLVCGDIRQQRLEAWKAAYQRFPNGYLCCARGGQRSHIVQR
SELU_SALTI      AVGTCYKRQGADAALALGHRLVCGDIRQQRLEAWKAAYQRFPNGYLCCARGGQRSHIVQR
SELU_SALEN      AVGTCYKRQGADAALALGHRLVCGDIDQQRLEAWKAAYQRFPNGYLCCARGGQRSHIVQR
SELU_SALPA      AVGTCYKRQGADAALALGHRLVCGDIRQQRLEAWKAAYQRFPNGYLCCARGGQRSHIVQR
SELU_PSYIN      QVGTCYKKEGQAAAITLGHQLVASDIQN-RIRKWAQFKEENPTAWLYCFRGGLRSRLSAQ
SELU_PHOPR      AVGTCYKAHGQDAAIALGHQLVNGDIKAARLAQWKAFAEENPNGYLYCFRGGLRSRITQQ
SELU_COLP3      DVGICYKQNGQEAAIKLGNALVSGQSKARRLTQWQTFARENPQGYLYCFRGGLRSQTVQR
SELU_CHRSD      AVGIRYKEAGQGAAIALGERLVDGDLKARRVAAWRAFAERHPDAVIYCFRGGLRSRIAQQ
SELU_AERHH      QVGTCFKQQGQAAAIALGHQLVGGAVRAERLEGWLAQLRRQPDAVLYCFRGGLRSQTVQQ
SELU_AERS4      QVGTCFKQRGQAAAIELGHQLVGGAVRAERLDGWLAQLRKQPDALLYCFRGGLRSQTVQL
SELU_SHEDO      KVGTCYKQQGQESAIKLGHALVSGTVKEQRIAAWRKAIEANPSSYLYCFRGGLRSQLSQQ
SELU_SHEFN      KVGTCYKKRGQEAAIALGHELVKGKVKQQRIDAWLAQLSQHPDSYLYCFRGGLRSKLSQQ
SELU_SHESM      KVGTCYKEQGQQAAIALGHSLVHGVVKQQRIDAWLNFLSAHPQAYLYCFRGGLRSQLTQQ
SELU_SHESR      KVGTCYKEQGQQAAIALGHSLVHGVVKQQRIDAWLNFLSAHPQAYLYCFRGGLRSQLTQQ
SELU_SHESA      KVGTCYKAQGQQAAIALGHSLVHGVVKQQRIDAWLNFLSANPEAYLYCFRGGLRSQLTQQ
SELU_SHEON      KVGTCYKQQGQQAAIALGHSLVHGAVKQQRIDAWLGFLAAQPEAYLYCFRGGLRSQLTQQ
SELU_SHESW      KVGTCYKQFGQQAAIALGHSLVNGPIKQQRIEAWASYVKANPNAYLYCFRGGLRSQLTQQ
SELU_SHELP      QVGTCYKEHGQDAAIALGHSLVCGAVKQQRVDAWLAYLDAHPDAYLYCFRGGLRSQLTQQ
SELU_SHEAM      KVGTCYKEHGQEAAIELGHQLVAGKVKANRVDAWKAFFSEHPDGFLYCFRGGLRSRITQS
SELU_PSEAB      KVGTSYKQHGQQAAIALGHELVCGALKAERLAAWKAFAEANPNGYLYCFRGGLRSQIVQQ
SELU_PSEAE      KVGTSYKQHGQQAAIALGHELVCGALKAERLAAWKAFAEANPNGYLYCFRGGLRSQIVQQ
SELU_PSEE4      KVGTCFKQQGQSAAIALGHQLVNGALKQQRLEAWAAFAQAHPDGYLYCFRGGLRSQIVQG
SELU_PSEPK      KVGTCYKQQGQAAAIALGHQLVSGATKQARLEAWAAFAKAHPDGYLYCFRGGLRSQIVQG
SELU_PSE14      KVGTCYKQHGQDAAIQLGHQLVCGQVKDERVNAWVEFAKANPDGYLYCFRGGLRSQTVQR
SELU_PSEU2      KVGTCYKQHGQDAAIQLGHQLVCGQVKDERVNAWIEFAKANPDGYLYCFRGGLRSQTVQR
SELU_PSESM      KVGTCYKQHGQDAAIQLGHQLVCGQVKDERVEAWVEFARANPNGYLYCFRGGLRSQTVQR
SELU_PSEPF      RVGTCYKHHGQQAAIELGHQLVSGPVKEERIQAWAEFARTHPEGYLYCFRGGLRSQIVQQ
SELU_PSEF5      RVGTCYKQQGQQAAIVLGHQLVSGAIKEQRIQAWADFARAHPDGLLYCFRGGLRSQIVQQ
SELU_BORBR      KVGLCYKQQGQDAAIALGHRLVSGAVKAERVAAWAAFAQAHPEGYLYCFRGGLRSQISQA
SELU_VEREI      QVGLCYRQQGQPAAIALGQQLVSGHTRRERIAAWAAFAQAHPDGLLYCLRGGLRSQIALQ
SELU_CUPNH      EVGLCYAQKGQQAAIELGHQLVSGLRKAARIAAWAEFARAHPDGYLYCFRGGLRSQLVQQ
SELU_CUPPJ      QVGLCYAEKGQHAAIELGHRLVWGALKATRIAQWADFARAHPDGYLYCFRGGLRSQIVQQ
SELU_HAHCH      QVGRCYKRHGQQAAIELGHRLAHGAVKESRVQGWREFAQRHPQGYLYCFRGGLRSSICQQ
SELU_ALCBS      RIGICYKQHGQQAAIDLGNTLVCGEERERRLYAWQQWWQANPNGYLYCFRGGLRSQTTQA
SELU_MARHV      RVGICYKEKGQDKAIELGHQLVSGDIKAQRIEAWKRFVAQHPEGYLFCFRGGLRSRLTQQ
SELU_HYDCU      TVGICYKQKGHDEAVKLGHRLVNDKVRLPRVSGWQSFMEKYPEAMLYCFRGGMRSKIAQQ
SELU_SULDN      KIGICYKNEGNAKAVELGHSMVSGDIKEERIKAWIAFMDANPNALLYCFRGGQRSKISQE
SELU_NITEC      LVGTTYKQQGSEAAVMLGHEMISGQAKQDRLQQWLDFIRQHPRTVLYCFRGGKRSQITQQ
SELU_NITEU      LVGTTYKQQGSEAAIKLGYEMVSGSVKQNRLQQWLDFIHQHPRAILYCFRGGKRSQITQQ
SELU_BDEBA      QVGTVYKNQGNEAAVKLGHELVSGLVKEQRVAAWKSFVQAHPEAVFYCFRGGQRSRISQA
                 :*  :   *   *: **  :  .     *:  *       *   : * *** **     

SELU_ECOK1      WLH-DAGIDYPLVEGGYKALRQTAIQATIELSQK------PIVLIGGCTGCGKTLLVQQQ
SELU_ECOUT      WLH-DAGIDYPLVEGGYKALRQTAIQATIELSQK------PIVLIGGCTGCGKTLLVQQQ
SELU_ECOL5      WLH-DAGIDYPLVEGGYKALRQTAIQATIELSQK------PIVLIGGCTGCGKTLLVQQQ
SELU_ECOL6      WLH-DAGIDYPLVEGGYKALRQTAIQATIELAQK------PIVLIGGCTGSGKTLLVQQQ
SELU_SHIBS      WLH-AAGIDYPLVEGGYKALRQTAIQATIELAQK------PIVLIGGCTGSGKTLLVQQQ
SELU_SHISS      WLY-AAGIDYPLVEGGYKALRQAAIQATIELAQK------PIVLIGGCTGSGKTLLVQQQ
SELU_SHIDS      WLH-AAGIDYPLVEGGYKALRQTAIQATIELAQK------PIVLIGGCTGSGKTLLVQQQ
SELU_ECOLI      WLH-AAGIDYPLVEGGYKALRQTAIQATIELAQK------PIVLIGGCTGSGKTLLVQQQ
SELU_ECO57      WLH-AAGIDYPLVEGGYKALRQTAIQATIELAQK------PIVLIGGCTGSGKTLLVQQQ
SELU_SHIF8      WLH-EAGIDYPLVEGGYKALRQTAIQATIELAQK------PIVLIGGCTGSGKTLLVQQQ
SELU_SHIFL      WLH-EAGIDYPLVEGGYKALRQTAIQATIELAQK------PIVLIGGCTGSGKTLLVQQQ
SELU_SALTY      WLQ-ETGIDCPLIEGGYKALRQTAIQATWQLAQK------PILLIGGCTGSGKTQLVRQQ
SELU_SALCH      WLQ-ETGIDCPLIEGGYKALRQTAIQATWQLAQK------PILLIGGCTGSGKTQLVRQQ
SELU_SALTI      WLQ-ETGIDCPLIEGGYKALRQTAIQATWQLAQK------PILLIGGCTGSGKTQLVRQQ
SELU_SALEN      WLQ-ETGIDCPLIEGGYKALRQTAIQATWQLAQK------PILLIGGCTGSGKTQLVRQQ
SELU_SALPA      WLK-ETGIDCPLIEGGYKALRQTAIQATWQLAQK------PILLIGGCTGSGKTQLVRQQ
SELU_PSYIN      FLK-DHGVDINIVPGGYKALRRYLINVIDQASEK------KLMIVGGNTGCGKTLLIQAL
SELU_PHOPR      WLK-EAGIDYPMVVGGYKALRRFLIETIDTVAQQ------PMTIVGGNTGSGKTIMVNEL
SELU_COLP3      WLK-ESGINYPLITGGYKALRQFLLNELEQLALH------PLTILAGNTGSGKTPFLAHC
SELU_CHRSD      WLQ-EAGITLPRIQGGWKAMRQCVNAEIEAAAAR------PVLVVAGLTGCAKTELVQSL
SELU_AERHH      WLH-EAGVTRPRIAGGYKDLRRFLIDTLDGAAAEC-----QWTVLTGMTGSGKTHMLAEV
SELU_AERS4      WLH-EAGVTRPRVAGGYKEMRRFLIDTLDKAAAEC-----HWTVLTGMTGSGKTHMLEHV
SELU_SHEDO      WIK-EAGFDIPYIQGGYKALRTFLIQILESSAALN-----SMLILSGRTGSGKTDFLQLR
SELU_SHEFN      WIK-ESGMDIPYIEGGYKAIRSFLINTIEQAPSQS-----KVLILSGITGSGKTEVIHQR
SELU_SHESM      WLQ-EAGVTVPYVQGGYKGMRQYLIGVIEAAPSLQ-----PLLSLSGMTGSGKTDFLKRR
SELU_SHESR      WLQ-EAGVTVPYVQGGYKGMRQYLIGVIEAAPSLQ-----PLLSLSGMTGSGKTDFLKRR
SELU_SHESA      WLQ-EAGVTAPYVQGGYKGMRQYLIGVIETAPSQQ-----PLLSLSGMTGSGKTDFLRLR
SELU_SHEON      WLK-EAGATVPYVQGGYKGMRQYLIGVIETTPSQQ-----PLLSLSGMTGSGKTDFLIQR
SELU_SHESW      WLK-EAGIEVPYIQGGYKAMRQYLIGVIEAAPTQQ-----PLLSLSGMTGCGKTDFLLQR
SELU_SHELP      WLA-EAGRDVPYIQGGYKAMRQYLIDTIDRAPEAR-----PMLILSGITGSGKTDFLLQR
SELU_SHEAM      WLK-EVGLDIPFIEGGYKAMRQFLIDEIDTAPGKS-----EMLILSGITGSGKTDFVRLR
SELU_PSEAB      WLKQDAGIDYPRVIGGYKALRNFLFETTRAAVDEC-----DFVLVGGLTGCGKTEVIAAL
SELU_PSEAE      WLKQDAGIDYPRVIGGYKALRNFLFETTRAAVDEC-----DFVLVGGLTGCGKTEVIAAL
SELU_PSEE4      WLK-EAGIQYPKVVGGYKAMRTFLLDTTQQAVEQC-----DFVLLGGLTGTGKTDVLQQL
SELU_PSEPK      WLRDEAGIQYPRVKGGYKAMRTFLLETTQQAVEQC-----DFVLVGGLTGTGKTDVLHQL
SELU_PSE14      WLK-DAGVDYPRIIGGYKAMRTFLLDTLHEAVSEC-----DIVVLGGMTSTGKTEVLTQL
SELU_PSEU2      WLK-DAGVDYPRVLGGYKAMRTFLLDTLHEAVSEC-----SIVVLGGMTGTGKTEVLTQL
SELU_PSESM      WLK-DAGVDYPRILGGYKAMRTFLLDTLHEAVTEC-----DLVVLGGMTGTGKTEVLTQL
SELU_PSEPF      WLKSEAGVDYPRIGGGYKALRGFLIDTLESALTDC-----DFVLLGGMTGTGKTEVLAQL
SELU_PSEF5      WLR-EAGIDYPRVGGGYKAMRTFLLDTTEQALQQC-----DFVLLGGMTGTGKTQVLGQL
SELU_BORBR      WLREEAGIAYPRVIGGYKAMRGFLLETIEQAIAEC-----GFVVLGGMTGTGKTDVLRQL
SELU_VEREI      WLHSEAGIAYPRVPGGYKALRMFLIDTTQAAAQEC-----DFVLLSGLTGTGKTALIAQL
SELU_CUPNH      WLH-AAGVDYPRVTGGYKAMRGFLIETTDAAAAEQ-----QWFVLGGLTGSGKTDVLADV
SELU_CUPPJ      WLRDEAGIDYPRVTGGYKAMRGFLIDVIEQAAAKQ-----DFLVLGGLTGTGKTDVIAEV
SELU_HAHCH      WLA-ESGVAYPRVLGGYKAMRRFLIESLESICQEA-----RLVLLAGHTGGGKTDLLARI
SELU_ALCBS      WLR-EIGIDAPLVTGGYKALRRFLIDEMEACIANL-----PLEVLCGRTGCAKTRVIEQQ
SELU_MARHV      WIR-DSGIDYPLVKGGYKALRRFLIDSLEAQIESG-----QFRILSGRTGTGKTRVLMQL
SELU_HYDCU      WLA-DNGCEIVRLKGGYKAFRRYLIDHLEIMPQRFSTEGIQTWALGGRTGCGKTRLLHTL
SELU_SULDN      WLH-VRGKEILRLKGGYKAFRTYLINKLSESTQHF-----KPIILGGRTGSGKTIVLEKM
SELU_NITEC      WLK-DAGVDRPLIIGGYKQARQFLINTIDRFSENH-----TLLVITGPTGSGKTQLIQEI
SELU_NITEU      WLR-DTGIDSPLITGGYKRARQFLISTIDRFSEHR-----KLLVITGPTGSGKTRLIHDI
SELU_BDEBA      WLK-EAGVERPLLVGGFKAARNYLIKQIEEFSVRQ-----ELISVSGPTGSGKTHFLRGL
                ::    *     : **:*  *                       : * *. .** .:   

SELU_ECOK1      PNG---VDLEGLARHRGSAFGRTLQPQLSQASFENLLAAEMLKTDAR-QNLRLWVLEDES
SELU_ECOUT      PNG---VDLEGLARHRGSAFGRTLQPQLSQASFENLLAAEMLKTDAR-QNLRLWVLEDES
SELU_ECOL5      PNG---VDLEGLARHRGSAFGRTLQPQLSQASFENLLAAEMLKTDAH-QDLRLWVLEDES
SELU_ECOL6      PNG---VDLEGLARHRGSAFGRTLQPQLSQASFENMLAAEMLKTDAH-QDLRLWVLEDES
SELU_SHIBS      PNG---VDLEGLARHRGSAFGRTLQPQLSQASFENLLAAEMLKTDAR-QDLRLWVLEDES
SELU_SHISS      PNG---VDLEGLARHRGSAFGRTLQPQLSQASFENLLAAEMLKTDAR-QDLRLWVLEDES
SELU_SHIDS      PNG---VDLEGLARHRGSAFGRTLQPQLSQASFENLLAAEMLKTDAR-QNLRLWVLEDES
SELU_ECOLI      PNG---VDLEGLARHRGSAFGRTLQPQLSQASFENLLAAEMLKTDAR-QNLRLWVLEDES
SELU_ECO57      PNG---VDLEGLARHRGSAFGRTLQPQLSQASFENLLAAEMLKTDAR-QNLRLWVLEDES
SELU_SHIF8      PNG---VDLEGLARHRGSAFGRTLQPQLSQASFENLLAAEMLKTDAR-QDLRLWVLEDES
SELU_SHIFL      PNG---VDLEGLARHRGSAFGRTLQPQLSQASFENLLAAEMLKTDAR-QDLRLWVLEDES
SELU_SALTY      PNG---VDLEGLARHRGSSFGRTLNPQLSQASFENKLAVELLKINAR-QTLKRWVLEDEG
SELU_SALCH      PNG---VDLEGLARHRGSSFGRTLNPQLSQASFENKLAVELLKINAR-QTLKRWVLEDEG
SELU_SALTI      PNG---VDLEGLARHRGSSFGRTLKPQLSQASFENKLAVELLKINAR-QTLKRWVLEDEG
SELU_SALEN      PNG---VDLEGLARHRGSSFGRTLNPQLSQASFENKLAVELLKINAR-QTLKRWVLEDEG
SELU_SALPA      PNG---VDLEGLARHRGSSFGRTLNPQLSQASFENKLAVELLKINAH-QTLKRWVLEDEG
SELU_PSYIN      DNG---LDIEGRANHRGSSFGKQVTEQPRQISYENQLAVDILHI--S-QHASSLVIEDES
SELU_PHOPR      ANG---IDLEGAANHRGSSFGRYVTAQRTQIDFENVLAVEMLKKQ-A-QGCTHFVFEDEG
SELU_COLP3      ANS---LDLEGAAGHRGSSFGSFVTPQSNQINFENKLAEQYIRGDFS-LEQR-LVLEDEG
SELU_CHRSD      DVG---IDLEGHARHKGSAFGRHPLQGPSQIDFEHALGAALSHA------THGCVVEDES
SELU_AERHH      AQA---LDLEGHAHHRGSSFGQLPGGQPSNINFENNLAIELLKRRHQ--GEQAFVVEDES
SELU_AERS4      TQA---VDLEGHAHHRGSSFGQLPGGQPSNINFENKLAIELLKRRHQ--GEHAFVVEDES
SELU_SHEDO      DEA---VDLEQLANHRGSSFGKNLDPQPSQINFENQLAIAVLQHQTK--HHRHLLLEDES
SELU_SHEFN      DES---VDLEGLANHKGSSFGKNIDPQPSQINFENNLAVALLKHQQQ--QHNHLLLEDES
SELU_SHESM      KEA---IDLEGIANHRGSSFGKNIDPQPTQINFENRLAIALLHHQLG--NHACLLLEDES
SELU_SHESR      KEA---IDLEGIANHRGSSFGKNIDPQPTQINFENRLAIALLHHQLG--NHACLLLEDES
SELU_SHESA      KEA---IDLEGIANHRGSSFGKNIDPQPTQINFENQLAIALLRHQLG--NHACLLLEDES
SELU_SHEON      KEA---VDLEGIANHRGSSFGKNIDPQPTQINFENQLAIALLRHQQD--NHSCLLLEDES
SELU_SHESW      KEA---VDLEGIANHRGSSFGKNIDPQPTQINFENQLAIALLRHQQD--NHSCLLLEDES
SELU_SHELP      QEA---VDLEGLAHHRGSSFGRYHEGQPTQINFENSLGVALLKHQQS--PARILLLEDES
SELU_SHEAM      SES---VDLEGIANHRGSSFGRQHEGQPSQIDFENRLAIELLRHQER--EQAKLLLEDES
SELU_PSEAB      DNS---LDLEGHANHRGSSFGRRATPQPAQIDFENRLAIDILKKRHR--GVGQFVLEDEG
SELU_PSEAE      DNS---LDLEGHANHRGSSFGRRATPQPAQIDFENRLAIDILKKRHR--GVGQFVLEDEG
SELU_PSEE4      DNV---LDLEGHANHRGSSFGKRATAQPAQIDFENGLAIDMLKKRAR--GIGQFVLEDEG
SELU_PSEPK      DNV---LDLEGHANHRGSSFGKRATAQPAQIDFENQLAIDVLKKRAR--GIGQFVLEDEG
SELU_PSE14      RNS---LDLEGIANHRGSSFGKRATGQPAQIDFENRLAIDLLKKRAA--GIEQFVVEDES
SELU_PSEU2      RNS---VDLEGIANHRGSSFGKRATGQPAQIDFENRLAIDLLKKRAA--GIEQFVVEDES
SELU_PSESM      PNG---LDLEGVANHRGSSFGKRATGQPAQIDFENRLAINLLKKRAA--GIEQFVVEDES
SELU_PSEPF      RNS---VDLEGHANHRGSSFGKRATGQPSNIDFENRLAIDLLKKRAA--GIDQFVLEDES
SELU_PSEF5      DNA---LDLEGHANHRGSSFGRRATGQPSNIDFENRLAVDLLKKRER--GVQSFVLEDEN
SELU_BORBR      DHG---LDLEAHAHHRGSSFGKHATGQPAQIDFDNRLAIDILKKRAA--GCRQFVVEDES
SELU_VEREI      AQG---LDLEGHANHRGSSFGQRLDGQPSQVDFEHRLAIDILKKQAR--GHRAFVLEDEG
SELU_CUPNH      PAA---IDLEGHARHRGSAFGRRALAQPPQIDFENALAIDVLRHIDA--GWRALLVEDEG
SELU_CUPPJ      PAA---VDLEGLACHRGSAFGRRAQPQPQQIDFENSLAIDVLQRAEA--GYRALVVEDEG
SELU_HAHCH      PGA---VDLERLAHHRGSAFGRRADGQPSQIDFENALAVALLRQRHG-FANAPLLLEDES
SELU_ALCBS      PNA---IDLEGLAHHRGSSFGRRPGGQPSQIDFENSLSIALIKQRAA--QPVSILVEDES
SELU_MARHV      PNP---VDLEGLANHRGSSFGRQVTPQPSQIDFENRLGVAMLKARHQ--AGGPIYLEDES
SELU_HYDCU      DNA---IDLEGLANHRGSAFGGHVAPQPTQINFENTLAMAVMRFYAQ--GHSSLVLEDES
SELU_SULDN      KNS---IDLEGLANHRGSSFGSKLNAQPMQIDFENNLAYELIQKIED--GFKTLVFEDEG
SELU_NITEC      RNSYPVLDIEALARHRGSAFGGMSLPQPTQIDFENQLAVNLLKLKQN-YLFDPVVVEDES
SELU_NITEU      SNSHPVLDIEALARHRGSAFGGMSVPQPSQIDFENHLAVNLLKLEQN-NLSEPVIVEDES
SELU_BDEBA      KGC-PVIDLEALARHRGSAFGNWEVPQPTQVDYENNLAREILLLEDKIHGKIKPLVEDES
                      :*:*  * *:**:**        : .::: *.                 .***.

SELU_ECOK1      RMIGSNHLPECLRERMTQATIAVVEDPFEIRLERLNEEYFLRMHHDFTHAYG--------
SELU_ECOUT      RMIGSNHLPECLRERMTQATIAVVEDPFEIRLERLNEEYFLRMHHDFTHAYG--------
SELU_ECOL5      RMIGSNHLPECLRERMTQATIAVVEDPFEIRLERLNEEYFLRMHHDFTHAYG--------
SELU_ECOL6      RMIGSNHLPECLRERMTQATIAVVEDPFEIRLERLNEEYFLRMHHDFTHAYG--------
SELU_SHIBS      RMIGSNHLPECLRERMTQAAIAVVEDPFEIRLERLNEEYFLRMHHDFTHAYG--------
SELU_SHISS      RMIGSNHLPECLRERMTQAAIAVVEDPFEIRLERLNEEYFLRMHHDFTHAYG--------
SELU_SHIDS      RMIGSNHLPECLRERMTQAAIAVVEDPFEIRLERLNEEYFLRMHHDFTHAYG--------
SELU_ECOLI      RMIGSNHLPECLRERMTQAAIAVVEDPFEIRLERLNEEYFLRMHHDFTHAYG--------
SELU_ECO57      RMIGSNHLPECLRERMTQAAIAVVEDPFEIRLERLNEEYFLRMHHDFTHAYG--------
SELU_SHIF8      RMIGSNHLPECLRERMTQAAIAVVEDPFEIRLERLNEEYFLRMHHDFTHAYG--------
SELU_SHIFL      RMIGSNHLPECLRERMTQAAIAVVEDPFEIRLERLNEEYFLRMHHDFTHAYG--------
SELU_SALTY      RTIGANHLPECLRERMAQAPIAVVEDPFALRLERLREEYFIRMHHDFTHAYG--------
SELU_SALCH      RTIGANHLPECLRERMAQAPIAVVEDPFALRLERLREEYFIRMHHDFTHAYG--------
SELU_SALTI      RTIGANHLPECLRERMAQAPIAVVEDPFALRLERLREEYFIRMHHDFTHAYG--------
SELU_SALEN      RTIGANHLPECLRERMAQAPIAVVEDPFALRLERLREEYFIRMHHDFTHAYG--------
SELU_SALPA      RTIGANHLPECLRERMAQAPIAVVEDPFALRLERLREEYFIRMHHDFTHAYG--------
SELU_PSYIN      KAVGALYVPERLFAGMTRAPMVVVNDPLEIRLQRLCYEYCTLMTEKFNLALG--------
SELU_PHOPR      RAIGSASVPLSINAAMGNADVAIVDDPLDVRIDRLIDDYVVRMQRDYIAQNG--------
SELU_COLP3      RLIGSVHLPESLRNAMTLAPLVVIEESLEYRLEQIYQEYIIKMTAQYQAAYG--------
SELU_CHRSD      RMIGQLDIPLSFWQTMETAPRIRVEMPLDWRLEQIRKDYIDTLWRTYRDHYG--------
SELU_AERHH      RLIGRCCLPNPLFDAMSQAPLVVVEVPQEERAEQIRQDYVHDLWLRYQAMFG--------
SELU_AERS4      RLIGRCCLPNPLFDAMCEAPLVVVDVPQSERAEQIRQDYVHDLWLRYQAMFG--------
SELU_SHEDO      FLIGRSALPKAFYNSMQHADIVLLEEDDEQRLQRLLFDYVDNKLASFVSRLG--------
SELU_SHEFN      MLIGRSALPKHFYSAMQQADIIVLDEPLDARLPRLLNDYVEQKLTDYVSGLG--------
SELU_SHESM      FLIGRSALPQSFYSAMQTADIVVLEEDDDIRLTRLLDEYVHKMHRGFIERLG--------
SELU_SHESR      FLIGRSALPQSFYSAMQTADIVVLEEDDDIRLTRLLDEYVHKMHRGFIERLG--------
SELU_SHESA      FLIGRSALPQSFYSAMQTADIVVLEEDDDIRLTRLLDEYVHKMHLGFSERLG--------
SELU_SHEON      FLIGRSALPQSFYNAMQAADILVLEEADDIRLNRLLDEYVHKMHQGFVERLG--------
SELU_SHESW      FLIGRSALPQSFYSAMQAAEILVLEEPDDTRLKRLRNEYVHKMYSGFCERLG--------
SELU_SHELP      YLIGRSALPKAFYMGMQAASVVILEEPLEARLTRLLDEYVHKMHRGYVERLG--------
SELU_SHEAM      FLIGRNAIPKTFFEKMQQAPVLVLTSTLEERLPRLLDDYVHKMHAGYVERLG--------
SELU_PSEAB      RIVGSCSLPLELYQGMQGYPLVWLEDAFEQRVERILRDYVIDLRSEFERVVG--------
SELU_PSEAE      RIVGSCSLPLELYQGMQGYPLVWLEDAFEQRVERILRDYVIDLRSEFERVVG--------
SELU_PSEE4      RIVGSCTVPLGLYQGMQRYPLVWLEDAFDNRVERILRDYVTNLCAEFVAVHG--------
SELU_PSEPK      RIVGSCTVPLELYQGMQHYPLVWLEDSFTNRVERILRDYVVNLSAEFKAVHG--------
SELU_PSE14      RLVGSCNVPLELHQTMQGCPMVWLEDSFENRVERILDDYVINLCAEFITVKG--------
SELU_PSEU2      RLVGSCNVPLELHQAMQGCPMVWLEDSFENRVERILEDYVINLCAEFITVKG--------
SELU_PSESM      RLVGSCNVPLELHQAMQGCPVVWLEDSFEHRVERILADYVVNLCAEFISVKG--------
SELU_PSEPF      RVVGSCALPLPLYQGMQQYPMVWLEDRFEQRVERILRDYVVDLSAEFQAVHG--------
SELU_PSEF5      RMIGSCALPLPLYQSMQGLPMVWLEDSLANRVQRILDDYVVNLCAEFVAVHG--------
SELU_BORBR      QAIGSCSLPFGLYQGMQRYPVVWLEDTQPARVQRILRDYVIDLCGEFTALHG--------
SELU_VEREI      RHVGRCSVPLALRQRLERAPIVCLQDSFGARVERIVGDYVIGQCADFVAAHG--------
SELU_CUPNH      RFIGSRDVPQVLTQRMQASPLVWLEASFDERVERVLRDYVQGLAAEFIAEKG--------
SELU_CUPPJ      RFIGGRDLPKVLWQRMQASPMVWLEASFEERVERVLRDYVLGLAAEHIEQLG--------
SELU_HAHCH      HLIGRCALPQSLRRAMAQAPLVVVEVALEQRVEHSFRNYILHKLDEWRRRQG--------
SELU_ALCBS      KLIGRCHLPFSLQDQIKSQPRIIIEESLESRVQVTLEDYVIGPLQEYARYFG--------
SELU_MARHV      RLIGRCALPETLRARMSESPLLILEQAMEERIAIIRADYVEGMLASYRARDG--------
SELU_HYDCU      HCIGSVSVPKTFFDFFKGGRQVLLEAPLEERVSITREEYVEQAQAEY-ETT---------
SELU_SULDN      KHIGNAFMPENLISTAINAPLIILETQIDKRVEITLNEYVVQAQEAY-LEAG--------
SELU_NITEC      RHTGRVYLPASFFEHMRSSEIIWVDEPLNTRVDNIFGDYIVATPIGQAQQARRNTQPLSS
SELU_NITEU      RHTGKVYLPDSFFHHLRNSEIIWVDEPLATRVDNIFEDYILTTPIGQAQRIRQAIPPLAS
SELU_BDEBA      RLIGRISQPATFFIRLRSSPVIWIDEPLPVRVDNVFDDYILNSSIGKSLEAA------PR
                   *    *  :           :      *      :*                     

SELU_ECOK1      -------DEQGWQEYCEYLHHGLSAIKRRLGLQRYNELAARLDAALTTQLTTGSTDGHLA
SELU_ECOUT      -------DEQGWQEYCEYLHHGLSAIKRRLGLQRYNELAARLDAALTTQLTTGSTDGHLA
SELU_ECOL5      -------DEQGWQEYCEYLHHGLSAIKRRLGLQRYNELAARLDAALTTQLTTGSTDGHLA
SELU_ECOL6      -------DEQGWQEYCEYLHHGLSAIKRRLGLQRYNELAARLDAALTTQLTTGSTDGHLA
SELU_SHIBS      -------DEQGWQEYCEYLHHGLSAIKRRLGLQRYNELAAQLDTALTTQLTTGSTDGHLA
SELU_SHISS      -------DEQGWQEYCEYLHHGLSAIKRRLGLQRYNELAAQLDTALTTQLTTDSTDGHLA
SELU_SHIDS      -------DEQGWQEYCEYLHHGLSAIKRRLGLQRYNELAARLDAALTTQLTTGSTDGHLA
SELU_ECOLI      -------DEQGWQEYCEYLHHGLSAIKRRLGLQRYNELAARLDAALTTQLTTGSTDGHLA
SELU_ECO57      -------DEQGWQEYCEYLHHGLSAIKRRLGLQRYNELAARLDAALTTQLTTGSTDGHLA
SELU_SHIF8      -------DEQGWQEYCEYLHHGLSAIKRRLGLQRYNELAAQLDTALTTQLTTGSTDGHLA
SELU_SHIFL      -------DEQGWQEYCEYLHHGLSAIKRRLGLQRYNELAAQLDTALTTQLTTGSTDGHLA
SELU_SALTY      -------DEAGWQAYSEYLHHGLFAIRRRLGLQRFAELTDTLDRALAEQLSSGSTDGHMA
SELU_SALCH      -------DEAGWQAYSEYLHHGLFAIRRRLGLQRFAELTDTLDRALAEQLSSGSTDGHMA
SELU_SALTI      -------DGAGWQAYSEYLHHGLFAIRRRLGLQRFAELTDTLDRALAEQLSSGSTDGHMA
SELU_SALEN      -------DEAGWQAYSKYLHHGLFAIRRRLGLQRFAELTDTLDRALAEQLSSGSTDGHMA
SELU_SALPA      -------DEAGWQAYSEYLHHGLFAIRRRLGLQRFAELTDTLDRALAEQLSSGSTDGHMA
SELU_PSYIN      -------AEQGWQAYEKYLQNGLYGIRKRLGTEKFKVMNTVLEAALKQQKNTGSVEGHLN
SELU_PHOPR      -------EQQGWELFTEYLERGMFGIRKRLGMKRYEELLAAQKQAIATQKSNGTLAEHDN
SELU_COLP3      -------VEQGFTAFSEYLEHGLFKVRKRLGTQRYGQLKEIQSTALTQQ-NKGQPQYHLD
SELU_CHRSD      -------EWLGWSLMRKQLSSALKRVRKRLGSARFQRLQRLQALAFREH-QRGNTQAHEA
SELU_AERHH      -------AEEGWPLFAAYLTDALARLKRRLGDQAHRELDTLMQSALAEQASSGDTSLHLA
SELU_AERS4      -------AEEGWPLFAAYLTDALARLKRRLGDQAHRELDQLMQIALAEQANSGTTERHLA
SELU_SHEDO      -------DEAGLKAFGDYLNASLNGIKKRLGGKFLQELLDSVARALAHQISQNDTSLHLD
SELU_SHEFN      -------EQAGFDAFKAYLAQSLLGIRKRLGGKQHQELQDLVDNALNVQQSQNDTSKHLD
SELU_SHESM      -------LEAGFEAFSHYLLQSLGSIRKRLGGKQYQELQDIMQQALSQQLNQNQTSQHLA
SELU_SHESR      -------LEAGFEAFSHYLLQSLGSIRKRLGGKQYQELQDIMQQALSQQLNQNQTSQHLA
SELU_SHESA      -------LEAGFEAFSHYLLQSLGSIRKRLGGKQYQELQDMMQQALSQQLNQNQTSQHMA
SELU_SHEON      -------IEAGFNAFSQYLLQSLTSIRKRLGGKQYQELQDTMQQALSQQLNQNQTSQHLA
SELU_SHESW      -------LEAGFAAFSEYLLQSLMSIRKRLGGKQHQELQDLMQQALNQQISQNDTSLHLV
SELU_SHELP      -------EEAGFEAFAEYLANSISGIKKRLGGKQHDELQQMITDALAVQTQRGDTQAHLE
SELU_SHEAM      -------EEQGFIAYRDYLLGSLKGIYKRLGGKLHAEMTELMNKALATEQSRRDTSAHLD
SELU_PSEAB      -------VEEGFAAFSAYLQKSLAGIVKRLGGERYQRLAAILVQALEEQGRDGSVDTHRG
SELU_PSEAE      -------VEEGFAAFSAYLQKSLAGIVKRLGGERYQRLAAILVQALEEQGRDGSVDTHRG
SELU_PSEE4      -------EEDGRRLFAERMRQSMANIYKRLGGERFQRLSELLGQALDEQLRSGDVSLHRG
SELU_PSEPK      -------EEDGPRLFAERMLQSMANIYKRLGGERHQRLSEMLREALQEQQRSGAVDLHRG
SELU_PSE14      -------EEQGFGLFAERLLQSLNNIHKRLGGERHQRLSGLMQTALEEQQRSGTVDLHRG
SELU_PSEU2      -------EEQGFGLFAERLLQSLNNIHKRLGGERHQRLSDLMQAALEEQQRSGAVDLHRG
SELU_PSESM      -------EELGFGLFADRLLQSLNNIHKRLGGERHQRLLALMQTALEEQQRSGAVELHRG
SELU_PSEPF      -------EE-GFGRFCERLLESLDNVHKRLGGERHRRMRVLMEEALAEQGRSGAVELHRA
SELU_PSEF5      -------EQ-GFALFAERLLESLNKIHKRLGGERHQRLFLLMEAALAEQARSGDVERHRA
SELU_BORBR      -------EQDGFGLYAARLRQSLDNIARRLGGERHRRLAALMDEALARQAGDGSVDAHRA
SELU_VEREI      -------PALGFERFSTRLLDSLGKLARRLGGARYQQLHADMQAALARQQASGDIDLHRH
SELU_CUPNH      -------STEGFEAYATRLREAMAGISPRLGGARYGKLSALLDQALAQQAERGEVDLHRG
SELU_CUPPJ      -------PVAGFEAYATRLRDAMAAISPRLGSERYGRLSALLEQALTSQSERGETAPHRA
SELU_HAHCH      -------EDEGFERFADDLRQSMYNIRTRLGGLRYQQLSEMLEAALARHRQ-GDPAYHRD
SELU_ALCBS      -------EHDALKQLGDELLASMDRIRRRLGGIRHQQLRQQLQEALAVQANCGNTELHRE
SELU_MARHV      -------EDAGWLNFRDYLLSAIDRIRKRLGGERYQKLRNLMLQALDQQEANGSLEGHHG
SELU_HYDCU      ------------EDWTVFMRSAFGRIRKRLGGERYQRVLKKFDQACENQHRTQEFDAHDD
SELU_SULDN      -------FDFVLEEWSQSIQNAMKRIVRRLGNEKYTKVTAIFESALDEQKKSGSYDGYKE
SELU_NITEC      ATEIQEILCQQALLLFDKYASALQAISKKLGGVRFQEVSQDLENARSSFVNRNEIQSNKT
SELU_NITEU      TVETREILRQQARQLFDKYAGALQAISKKLGGDRFQEVSEDLENARSDFENKNEIQSNKI
SELU_BDEBA      CAEENDILRAQALQLFARYRQSLLAIQRKLGGLRAQEVMADLEKAELAYLNHAELSGNKV
                                     .:  :  :**      :      *               

SELU_ECOK1      WLVPLLEEYYDPMYRYQLEKKAEKVVFRGEWAEVAEWVKAQ-------------------
SELU_ECOUT      WLVPLLEEYYDPMYRYQLEKKAEKVVFRGEWAEVAEWVKAQ-------------------
SELU_ECOL5      WLVPLLEEYYDPMYRYQLEKKAEKVVFRGEWAEVAEWVKAQ-------------------
SELU_ECOL6      WLVPLLEEYYDPMYRYQLEKKAEKVVFRGEWAGSGGMG----------------------
SELU_SHIBS      WLVPLLKEYYDPMYRYQLEKKAEKVVFRGEWAEVAEWVKAR-------------------
SELU_SHISS      WLVPLLKEYYDPMYRYQLEKKAEKVVFRGEWAEVAEWVKTQ-------------------
SELU_SHIDS      WLVPLLEEYYDPMYRYQLEKKAEKVVFRGEWAEVAEWVKAR-------------------
SELU_ECOLI      WLVPLLEEYYDPMYRYQLEKKAEKVVFRGEWAEVAEWVKAR-------------------
SELU_ECO57      WLVPLLEEYYDPMYRYQLEKKAEKVVFRGEWAEVAEWVKAQ-------------------
SELU_SHIF8      WLVPLLKEYYDPMYRYQLEKKAEKVVFRGEWAEVAVWVKAQ-------------------
SELU_SHIFL      WLVPLLKEYYDPMYRYQLEKKAEKVVFRGEWAEVAVWVKAQ-------------------
SELU_SALTY      WLVPLLNEYYDPMYRYQLEKKAANIVFRGTWQDVANWLKAQ-------------------
SELU_SALCH      WLVPLLNEYYDPMYRYQLEKKAANIVFRGPWQDVANWLKAQ-------------------
SELU_SALTI      WLVPLLNEYYDPMYRYQLEKKAANIVFRGTWQDVANWLKAQ-------------------
SELU_SALEN      WLVPLLNEYYDPMYRYQLEKKAANIVFRGTWQEVANWLKAQ-------------------
SELU_SALPA      WLVPLLNEYYDPMYRYQLEKKAANIVFRGTWQDVANWLKEQ-------------------
SELU_PSYIN      WIASILRDYYDPMYQYQLEKKADRVQFRGTFQEVKEWLTVNTK-----------------
SELU_PHOPR      WLRPLLIEYYDPMYTYQLSKKADRIVFRGNYQEVKSWLADK-------------------
SELU_COLP3      WLKPLLSEYYDPMYQYQLGLKSDRVIFRGNNSECLAFLRD--------------------
SELU_CHRSD      WLAPLMLEYYDPMYRYQLEQSPYEALHVGDWESCLAFARDWSAALPR-------------
SELU_AERHH      WITLLLTRYYDPMYLYQLGNKRERIIFQGDKQACLDFFAKQRA-----------------
SELU_AERS4      WITLLLTRYYDPMYLYQLGNKRERIVFRGEKQACLDFFAEQHAARQQG------------
SELU_SHEDO      WISQLLTRYYDPMYDYQLSQKQQRVLFKGDHASMHAWLDELRK-----------------
SELU_SHEFN      WINLLLDIYYDPMYLYQLEKKQDRVIFQGDRQAIHQWLDKHKS-----------------
SELU_SHESM      WISLLLHKYYDPMYEYQLQKKAGNILFRGSHQATHEWLDNYQRDNYHRNNDPLNSQHSKG
SELU_SHESR      WISLLLHKYYDPMYEYQLQKKAGNILFRGSHQATHEWLDNYQSER---------------
SELU_SHESA      WISLLLHKYYDPMYEYQLQKKAGNILFRGSHQAMHEWLDNY-------------------
SELU_SHEON      WINLLLQKYYDPMYEYQLEKKAHRVLFRGNHQAMHEWLDNLSQDSLSQENLG--------
SELU_SHESW      WIHLLLHKYYDPMYQYQLQKKSERVLFKGSHQAMHEWLNNFKSTQ---------------
SELU_SHELP      WIALLLSKYYDPMYQYQIGKKADRVIFQGDHQAMHQWLDEYATR----------------
SELU_SHEAM      WISLLLESYYDPMYHYQLGKKAARVRFTGTHAEMHEYLSSLGK-----------------
SELU_PSEAB      WIEGLLKEYYDPMYAFQRQSKEDRVEFRGNQAEVIGYLRQRQALRPS-------------
SELU_PSEAE      WIEGLLKEYYDPMYAFQRQSKEDRVEFRGNQAEVIGYLRQRQALRPS-------------
SELU_PSEE4      WIEGLLKEYYDPMYAYQREAKAGRIEFAGDGVEVREYLKARARRQHRVDL----------
SELU_PSEPK      WIEGLLNEYYDPMYAYQRAAKAERIEFAGDAVEVREYLKARALRQPRK------------
SELU_PSE14      WIEGLLGEYYDPMYAYQREHKAARIEFAGNQVDVLDYLRERSDKR---------------
SELU_PSEU2      WIEGLLGEYYDPMYAYQREHKAARIEFAGDQTQVLAYLRERSEQR---------------
SELU_PSESM      WIEGLLGEYYDPMYAYQREHKAARIEFAGNQFEVSGYLSERSSRR---------------
SELU_PSEPF      WIEGLLREYYDPMYVFQREKKGGRIEFAGERQAVIEYLRQRGKSQA--------------
SELU_PSEF5      WIEGLLGEYYDPMYAFQRESKGARIEFSGEHGAVLDYLRQRSPR----------------
SELU_BORBR      WIEPLLTEYYDPMYAYQRQAKAARIVFTGDHQEVLDYLRGPGRALP--------------
SELU_VEREI      WIAALVRDYYDPMYAFQRQSRPGRIVFEGDLPAVLAYLRAGCG-----------------
SELU_CUPNH      WIEVLLREYYDPMYAFQREQREARIVFRGDRAAVTDWLRAHTAQRG--------------
SELU_CUPPJ      WIEVLLRDYYDPMYAYQEEKRAARVVFRGDRAAVTDWLRERSAR----------------
SELU_HAHCH      WIRCLLEDYYDPMYAYQLQKRAERICFRGDAAAVRDYFAHSSSTTATVRDKRL-------
SELU_ALCBS      WIHSLLADYYDPMYDYMLSRRAGTILFQGSRAEVSAFLNSR-------------------
SELU_MARHV      WIEALLTDYYDPMYDYQLTQKQGEILVRGGPEVITEWARSRTST----------------
SELU_HYDCU      WIRILLTEYYDPMYDYQMQKKQCKIDFSGNFDAVKDFLSQQS------------------
SELU_SULDN      WAKFLLEEYYDPMYDYQIQKRSHMVAFRGDAQEVQNYIERLSDI----------------
SELU_NITEC      WIEKLVRYYYDPLYLGSLQRRQVNPCFKGSRQAAIDYLRARKQHA---------------
SELU_NITEU      WIEKLVRYYYDPLYLGSLQRRRVNPCFKGSGQAVMDYLQARK------------------
SELU_BDEBA      WIEKLLQYYYDPMYLGSLERRHVTVLFKGTRFEAEKFVHSLT------------------
                *   ::  ****:*              *