CLUSTAL format seed alignment for MF_01624

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

ARSC2_BACC1           MENKKTIYFLCTGNSCRSQMAEAWGKQYLGD-KWNVYSAGIEAHGVNPNAIKAMNEVNID
ARSC_BACHK            MENKKTIYFLCTGNSCRSQMAEAWGKQYLGD-KWNVYSAGIEAHGVNPNAIKAMNEVNID
ARSC_BACCR            MENKKTIYFLCTGNSCRSQMAEAWGKQYLGD-KWNVYSAGMEAHGVNPNAIKAMNEVNID
ARSC_BACAN            MENKKTIYFLCTGNSCRSQMAEAWGKQYLGD-KWNVYSAGIEAHGVNPNAIKAMNEVNID
ARSC_BACC7            MENKKTIYFLCTGNSCRSQMAEAWGKKYLGD-NWNVYSAGIEAHGVNPNAIKAMNEVNID
ARSC_BACCZ            MENKKTIYFLCTGNSCRSQMAEAWGKQYLGD-KWNVYSAGIEVHGVNPNAIKAMNEVNID
J8EX11_BACCE          MENKKTIYFLCTGNSCRSQMAEALGKKYLGD-KWNVYSAGIEAHGVNLNVIKAMKEVNID
J8DVX5_BACCE          MENKKTIYFLCTGNSCRSQMAEAFGKKYLGD-KWHVYSAGIEAHGVNPNAIKAMNEVNID
ARSC1_BACC1           MENKKTIYFLCTGNSCRSQMAEAWGKKYLGD-KWNVLSAGIEAHGVNPNAIKAMKEVDID
ARSC1_STAS1           -MDKKTIYFICTGNSCRSQMAEGWGKEILGE-DWNVYSAGIETHGVNPRAIEAMKEVDID
ARSC_STAXY            -MDKKTIYFICTGNSCRSQMAEGWGREILGE-DWNVYSAGIETHGVNPKAIEAMKEVDID
ARSC_STAAU            -MDKKTIYFICTGNSCRSQMAEGWGKEILGE-GWNVYSAGIETHGVNPKAIEAMKEVDID
ARSC1_STAHJ           -MDKKTIYFICSGNSCRSQMAEGWGKEILGE-DWNVYSAGIETHGVNPKAIEAMKEVDID
W1I733_STAPS          -MDKKTIYFICTGNSCRSQMAEGWGKEILGE-DWNVYSAGIETHGVNPKAIEAMKEVDID
ARSC2_STAS1           -MDKKTIYFICTGNSCRSQMAEGWGREILGE-EWNVYSAGIETHGVNPKAIEAMKEVDID
ARSC2_STAEQ           -MDKKTIYFICTGNSCRSQMAEGWGKKILGD-EWQVYSGGIEAHGVNPKAIEAMKEVGID
ARSC_STAES            -MDKKTIYFICTGNSCRSQMAEGWGKKILGD-EWQVYSGGIEAHGVNPKAIEAMKEVGID
ARSC2_STAHJ           -MDKKTIYFICTGNSCRSQMAEGWGKKILGD-EWQVYSGGIEAHGVNPKAIEAMKEVGID
ARSC_STAAC            -MTKKTIYFICTGNSCRSQMAEGWAKQILAD-DWNVYSAGIETHGVNPKAIEAMKEVGID
ARSC1_STAEQ           -MQKKTIYFICTGNSCRSQMAEGFGKLILGD-KWNVYSAGIETHGVNPHAIKAMKEVGID
A0A269XGU7_9STAP      -MAKKIIYFICTGNSCRSQMAHGFADNILDS-NWDVYSGGIETHGVNPKAIEAMKEVNID
ARSC_BACLD            -MSKKTIYFLCTGNSCRSQMAEGWAKKHLGD-EWNVYSAGIEAHGLNPNAVKAMREAGID
ARSC_PRIM3            -MSKKTLYFLCTGNSCRSQMAEGWAKKYLNNNEWDVRSAGLEAHGLNPNAVKAMKEAGVD
ARSC_BACSU            -MENKIIYFLCTGNSCRSQMAEGWAKQYLGD-EWKVYSAGIEAHGLNPNAVKAMKEVGID
ARSC_ALKCK            -MSKKIIYFLCTGNSCRSQMAEGFGKHYLSD-EWEVYSAGMEAHGLNPNAVKAMNEVGID
ARSC_OCEIH            -MSKKIIYFLCTGNSCRSQMAEGWGKKILGE-EWDVYSAGIEAHGLNPNAIKAMREVDID
L0EJU3_THECK          MTEKPILYFLCTGNSCRSQMAEGFGKKYLGD-RFDVYSAGIEAHGLNPYAVKVMREVGID
ARSC_ALKHC            -MNKKVIYFLCTGNSCRSQMAEGWGKKYLGD-EWDVYSAGIEAHGVNPNAVKAMKEIGID
W4QXG0_BACA3          -MSKPIIYFLCTGNSCRSQMAEGWGKQLLSD-KYDVYSAGIEAHGVNPNAVKAMAEAGVD
                         :  :**:*:*********.. .   * .  :.* *.*:*.**:*  .::.* * .:*

ARSC2_BACC1           ITNQTSDIIDANILNRADLVVTLCSHADSVCPSTPPHINRVHWGFDDPAGKEWSE-----
ARSC_BACHK            ITNQTSDIIDANILNRADLVVTLCSHADSVCPSTPPHVNRVHWGFDDPAGKEWSE-----
ARSC_BACCR            ITNQTSDIIDANILNSADLVVTLCSHADSVCPSTPPHVNRVHWGFDDPAGKEWSE-----
ARSC_BACAN            ITNQTSDIIDANILNRADLVVTLCSHADAVCPSTPPHVNRVHWGFDDPAGKEWPE-----
ARSC_BACC7            ITNQTSDIIDANILNRADLVVTLCSHADSVCPSTPPDVNRVHWGFDDPAGKEWSE-----
ARSC_BACCZ            ITNQTSDIIDANILNRADLVVTLCSHADSVCPSTPPDVNRVHWGFDDPAGKEWSE-----
J8EX11_BACCE          ITNQTSDMIDPNILNNADLVVTLCSHADSVCPSTPPHVNRVHWGFDDPAGKEWSE-----
J8DVX5_BACCE          ITNQTSDMIDSTILNNADLVVTLCSHADSVCPSTPPHVNRVHWGFDDPAGKEWPE-----
ARSC1_BACC1           ITDQTSDIIDRDILDKADLVVTLCGHANDVCPTTPPHVKRVHWGFDDPAGQEWSV-----
ARSC1_STAS1           ISNHTSDLIDNDILKQSDLVVTLCSDADDNCPILPPNVKKEHWGFEDPAGKEWSE-----
ARSC_STAXY            ISNHTSDLIDNHILKQSDLVVTLCSDADDNCPILPPNVKKEHWGLEDPAGKEWSE-----
ARSC_STAAU            ISNHTSDLIDNDILKQSDLVVTLCSDADNNCPILPPNVKKEHWGFDDPAGKEWSE-----
ARSC1_STAHJ           ISNHTSDLIDSDILEQSDLVVTLCSDADDNCPILPPNVKKEHWGFDDPAGKEWPE-----
W1I733_STAPS          I------------LEQSALVVTLCSDADDNCPILPPNVKKEHWGFDDPAGKEWPE-----
ARSC2_STAS1           ISNHTSDLIDNKILRQSDLVVTLCSDADENCPVIPPNVKKEHWGFDDPAGKSWSE-----
ARSC2_STAEQ           ISNHTSNLIDQNILHQSDLVVTLCSDADKNCPILPPSVKKEHWGFDDPAGKPWSE-----
ARSC_STAES            ISNHTSNLIDQNILHQSDLVVTLCSDADKNCPILPPSVKKEHWGFDDPAGKPWSE-----
ARSC2_STAHJ           ISNHTSNLIDKNILNQSDLVVTLCSDADNNCPILPPNVKKEHWGFDDPAGKPWSE-----
ARSC_STAAC            ISNHTSDLIDNNIIKNSNLVVTLCSDADVNCPSLPTNVKKEHWGFDDPAGKPWSE-----
ARSC1_STAEQ           ISHHTSDLINNDILIASDIVVTLCSDADANCPVLPKNVTKEHWGFDDPAGKDWSE-----
A0A269XGU7_9STAP      ISHHTSDLIQQDILDRADLVVTLCSHADQHCPTLPPSVKKEHWGFDDPAGKDWSE-----
ARSC_BACLD            ISEQTSDIIDPDILHNADLVITLCGDAADKCPMTPPHVKREHWGFDDPAKAEGTEEEKWA
ARSC_PRIM3            ISNQTSDVIDPEILNNADLVVTLCGHAADHCPVTPPHVKREHWGFDDPAKAEGTDEEKWA
ARSC_BACSU            ISNQTSDIIDSDILNNADLVVTLCGDAADKCPMTPPHVKREHWGFDDPARAQGTEEEKWA
ARSC_ALKCK            ISDQTSDLIHIDLLNNADFVVTLCGDAADKCPLTPAHVKREHWGFDDPAKAEGTKEERWM
ARSC_OCEIH            ITNQTSDQIDKDILNKADFVVTLCGDAKDKCPMTPPHVKRDHWGFEDPAKAQGTEEEKWT
L0EJU3_THECK          ISNQTSDVIDPELLNKADYVITLCGDANDRCPMTPPHVTRWHWGFDDPAKATGTEEERLV
ARSC_ALKHC            ISEQTSDTIDQELLQKADLVVTLCGHAADVCPATPSNKERVHWGFDDPAKAEGTDEEKWA
W4QXG0_BACA3          ITNQTSDTIDPDLLKKADFVVTLCGHAADVCPATPPNKDRAHWGFDDPAKAEGTEEEKWA
                      *            :  :  *:***..*   **  *    : ***::***    .      

ARSC2_BACC1           -FQRVRDEIGERIKRFSETGE
ARSC_BACHK            -FQRVRDEIGERIKCFSETGE
ARSC_BACCR            -FQRVRDEIGERIKRFSKTGE
ARSC_BACAN            -FQRVRDEIGERIKRFSETGE
ARSC_BACC7            -FQRVRDEIGERIKRFSETGE
ARSC_BACCZ            -FQRVRDEIGERIKRFSETGE
J8EX11_BACCE          -FQRVRNEVGERIKRFSETGE
J8DVX5_BACCE          -FQRVRDEIGERIQRFSETGE
ARSC1_BACC1           -FQRVRDEIGARIKKYAETGE
ARSC1_STAS1           -FQRVRDEIKLAIEKFKLR--
ARSC_STAXY            -FQRVRDEIKLAIENFKLR--
ARSC_STAAU            -FQRVRDEIKLAIEKFKLR--
ARSC1_STAHJ           -FQRVRDEIGKRIQEFKETLV
W1I733_STAPS          -FQRVRDEIGKRIQEFKETLV
ARSC2_STAS1           -FQRVRDEIGQKIKQFYDN--
ARSC2_STAEQ           -FQRVRDEIKTAIESFKTR--
ARSC_STAES            -FQRVRDEIKTAIESFKTR--
ARSC2_STAHJ           -FQRVRDEIKTAIESFKTR--
ARSC_STAAC            -FQRVRDEIKIAIENFKSR--
ARSC1_STAEQ           -FQRVRDEIKAAIETFAHRV-
A0A269XGU7_9STAP      -FQRVRDEIKAAIEDFSQKQ-
ARSC_BACLD            FFQRVRDEIGERIKRFAETGE
ARSC_PRIM3            FFQRVRDEIAERIQRFAETGK
ARSC_BACSU            FFQRVRDEIGNRLKEFAETGK
ARSC_ALKCK            VFQRVRDEIGARIKKFAETGE
ARSC_OCEIH            VFQQVRDKIGDRIKVFAKTGE
L0EJU3_THECK          VFRRVRDEIEERIKRFRDMGA
ARSC_ALKHC            VFRRVRDEIGKRIKTFAETGK
W4QXG0_BACA3          FFQRVRDEIKDRIQTFAETGK
                       *::**:::   :: :