CLUSTAL format seed alignment for MF_01627

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

DEOD_HELPH       -MTPHINAKIGDFYPQCLLCGDPLRVSYIAKKFLQDAKEITNVRNMLGFSGKYKGK-GIS
DEOD_HELPY       -MTPHINAKIGDFYPQCLLCGDPLRVSYIAKKFLQDAKEITNVRNMLGFSGKYKGR-GIS
DEOD_HELPJ       -MTPHINAKIGDFYPQCLLCGDPLRVSYIAKNFLQDAKEITNVRNMLGFSGKYKGK-GIS
DEOD_BUCAI       MSTPHINSKKDDFSDIVLMPGDPVRAKYIAEKYLSNFVQVNDTRLMLAYTGFYKNR-KIS
DEOD_BUCAP       MPTLHIKSEKNAFSNIVLMPGDPVRAKYIAENYLANPVQINDTRLMLAYTGYYKNK-KIS
DEOD_BUCBP       MVTPHINAKKGDFSDCVLMPGDPLRARYIAKNYLKNAIEVTNIRSMLGYTGRYKGH-RIS
DEOD_BACC1       -MSVHIEAKQGEIAESILLPGDPLRAKYIAETFLEDVTCYNNVRGMLGFTGTYKGK-RVS
DEOD_BACAH       -MSVHIEAKQGEIAESILLPGDPLRAKYIAETFLEDVTCYNNVRGMLGFTGTYKGK-RVS
DEOD_BACHK       -MSVHIEAKQGEIAESILLPGDPLRAKYIAETFLEDVTCYNNVRGMLGFTGTYKGK-RVS
DEOD_BACAN       -MSVHIEAKQGEIAESILLPGDPLRAKYIAETFLEDVTCYNNVRGMLGFTGTYKGK-RVS
DEOD_BACCR       -MSVHIEAKQGEIAESILLPGDPLRAKYIAETFLEDVTCYNNVRGMLGFTGTYKGK-RVS
DEOD_BACCE       -MSVHIEAKQGEIAESILLPGDPLRAKYIAETFLEDVTCYNNVRGMLGFTGTYKGK-RVS
DEOD_BACCZ       -MSVHIEAKQGEIAESILLPGDPLRAKYIAETFLEDVTCYNNVRGMLGFTGTYKGK-RVS
DEOD_BACCN       -MSVHIEAKQGEIAESILLPGDPLRAKYIAETFLEDVTCYNNVRGMLGFTGTYKGK-RVS
DEOD_GEOTN       -MSVHIGAKPGEIAEHILLPGDPLRAKYIAETFLEGAVCYNEVRGMLGFTGTYKGH-RIS
DEOD_GEOKA       -MSVHIGAKTGEIAERILLPGDPLRAKYIAETFLEGAVCYNEVRGMLGFTGTYKGE-RIS
DEOD_GEOSE       -MSVHIGAKEHEIADKILLPGDPLRAKYIAETFLEGATCYNQVRGMLGFTGTYKGH-RIS
DEOD_OCEIH       -MSVHIGAKQGEIADKILLPGDPLRAKYIAETFLEEPKLYNEVRGMYGYTGTYKGE-RVS
DEOD_LISW6       -MSVHIEAKQGEIAETILLPGDPLRAKYIAETFLEDVVLFNQVRGMLGFTGTYKGE-KVS
DEOD_LISIN       -MSVHIEAKQGEIAETILLPGDPLRAKYIAETFLEDVVLFNQVRGMLGFTGTYKGE-KVS
DEOD_LISMO       -MSVHIEAKQGEIAETILLPGDPLRAKYIAETFLEDVVLFNQVRGMLGFTGTYKGE-KVS
DEOD_LISMF       -MSVHIEAKQGEIAETILLPGDPLRAKYIAETFLEDVVLFNQVRGMLGFTGTYKGE-KVS
DEOD_BACSU       -MSVHIGAEKGQIADTVLLPGDPLRAKFIAETYLENVECYNEVRGMYGFTGTYKGK-KIS
DEOD_BACVZ       -MSVHINAEKGQIADTVLLPGDPLRAKFIAETYLENVECYNEVRGMYGFTGTYNGK-KVS
DEOD_BACLD       -MSVHIGAEKGQIAETVLLPGDPLRAKYIADTYLENVECYNEVRGMYGFTGTYKGK-RVS
DEOD_CALS4       -MSIHIGAKEGDIAETVLLPGDPLRAKYIAENLLEDAKCYNEVRGMYGFTGYYKGK-RVS
DEOD_ALKMQ       -MSIHIGAKKGEIAETILLPGDPLRAKFIAENFLENIECYNEVRGMYGFTGSYKGK-RIS
DEOD_CLOPS       -MSIHIGAKEGQIAETILLPGDPLRAKFIAETFLENPVCYNEVRGMLGYTGTYKGK-RIS
DEOD_CLOP1       -MSIHIGAKEGQIAETILLPGDPLRAKFIAETFLENPVCYNEVRGMLGYTGTYKGK-KIS
DEOD_CLOB8       -MSVHINAPEGAIAESVLLPGDPLRAKFIAENFLEDVVCYNEVRGMYGFTGTYKGK-KIS
DEOD_CLOTE       -MSIHINAPEGAIAESILLPGDPLRAKFIADTFLEDVVCYNEVRGMYGFTGTYKGK-RVS
DEOD_CLONN       -MSTHIGAKQNEIASTVLLPGDPLRAKFIAENFLEDVICYNDVRGMYGYTGTYKGK-RVS
DEOD_TREPA       -MSIHLGAKGEDIAPRVLLPGDPLRARFVAERFFHNAYCYNEVRGMLGFTGTYKGV-RVS
DEOD_LACLM       MPTPHIEAQKGEIADKILLPGDPLRAKFIAENFLEDAVQFNQVRGMLGFTGTYKGH-RVS
DEOD_LACLS       MPTPHIEAQKGEIADKILLPGDPLRAKFIAENFLEDAVQFNQVRGMLGFTGTYKGH-RVS
DEOD_LACLA       MPTPHIEAQKGEIADKILLPGDPLRAKFIAENFLEDAVQFNQVRGMLGFTGTYKGH-RVS
DEOD3_SHEON      -MTAHINAQPTDFAETVIMPGDPLRAKYIAETYLTDAVEVTNVRNMLGYTGYYQGQ-RIS
DEOD_MYXXD       MATPHISAAPGDFADVVLMPGDPLRARYISDRFLEGAREVTSVRNMLGFTGTFRGR-RVS
DEOD_HAHCH       MATPHIAANPGDFADTVLMPGDPLRAKHIAETYLANPVLVNDVRGMLGYTGEYRGR-MLS
DEOD_PSEHT       MSTPHINANVGDFAETVLMPGDPLRAKYIAENFLDDAKQVTSVRNMLGFTGTYKGK-PVS
DEOD_COLP3       MPTPHIEAQDGEFAETVLMPGDPLRAKFIADNFLDDAKCITQVRNMLGYTGTYKGK-RVS
DEOD_CHRVO       MATPHINAKDGAFAETVLMPGDPLRAQLIAETFLEGAELVTNVRNVFGYTGTYKGK-RLS
DEOD2_VIBVY      MATPHINAQPGDFAETVLMPGDPLRAKYIAETFLEDVKQVCDVRNMFGFTGTYKGK-KVS
DEOD2_VIBVU      MATPHINAQPGDFAETVLMPGDPLRAKYIAETFLEDVKQVCDVRNMFGFTGTYKGK-KVS
DEOD2_VIBPA      MATPHINAQPGDFAETVLMPGDPLRAKYIAETFLEDVKQVCDVRNMFGFTGTYKGK-KVS
DEOD2_ALIF1      MATPHINAQAGDFAETVLMPGDPLRAKFIAENFLEDVKQVCDVRNMFGYTGTYKGK-KVS
DEOD2_VIBCH      MATPHINAQPGDFAETVLMPGDPLRAKYIAETFLEDVKQVCDVRSMFGFTGTYKGK-KVS
DEOD2_PHOPR      MATPHINAELGDFAETVLMPGDPLRAKFIAENFLEDVKQVCDVRSMLGFTGTYKGK-RVS
DEOD1_VIBVY      MATPHINAEMGDFADVVLMPGDPLRAKYIAETFLEDVVQVCDVRNMYGFTGTYKGR-KVS
DEOD1_VIBVU      MATPHINAEMGDFADVVLMPGDPLRAKYIAETFLEDVVQVCDVRNMYGFTGTYKGR-KVS
DEOD1_VIBPA      MATPHINAEMGAFADVVLMPGDPLRAKYIAETFLEDVVQVCDVRNMFGYTGTYKGR-KIS
DEOD1_VIBCH      MATPHINAQMGDFADVVLMPGDPLRAKYIAENFLDNAVQVCDVRNMFGYTGTYKGR-KIS
DEOD1_ALIF1      MATPHINAEMGDFADVVLMPGDPIRAKYIAETFLDDVVQVCDVRNMYGFTGTYKGR-KIS
DEOD1_PHOPR      MATPHINAEMGDFADVVLMPGDPLRAKYIAETFLQDVKEVCNVRSMFGYTGTYKGR-KIS
DEOD_ACTP2       MATPHINAPEGAFADVVLMPGDPLRAKYIAETFLEDAVQVTDVRNMFGYTGTYKGR-RIS
DEOD_ACTPL       MATPHINAPEGAFADVVLMPGDPLRAKYIAETFLEDAVQVTDVRNMFGYTGTYKGR-RIS
DEOD_HAEDU       -MTPHINAPAGAFADVVLMPGDPLRAKYIAETFLENAEQVTNVRNMFGYTGTYKGR-RIS
DEOD_ACTSZ       -MTPHINAPAGAFADVVLMPGDPLRAKYIAETFLDQPELVTDVRNMLGYTGSYKGR-RIS
DEOD_MANSM       -MTPHINAPEGAFADVVLMPGDPLRAKYIAETFLENAKEVTNVRNMLGYTGTYKGR-PVS
DEOD_HAES1       -MTPHINAPAGAFADVVLMPGDPLRAKYIAETFLENAQEVTNIRNMLGYTGTYKGR-KIS
DEOD_HISS2       -MTPHINAPAGAFADVVLMPGDPLRAKYIAETFLENAQEVTNVRNMLGYTGTYKGR-KIS
DEOD_HAEIG       -MTPHINAPEGAFADVVLMPGDPLRAKYIAETFLQDVVEVTNVRNMLGFTGTYKGR-KIS
DEOD_HAEIE       -MTPHINAPEGAFADVVLMPGDPLRAKYIAETFLQDVVEVTNVRNMLGFTGTYKGR-KIS
DEOD_HAEIN       -MTPHINAPEGAFADVVLMPGDPLRAKYIAETFLQDVVEVTNVRNMLGFTGTYKGR-KIS
DEOD_HAEI8       -MTPHINAPEGAFADVVLMPGDPLRAKYIAETFLQDVVEVTNVRNMLGFTGTYKGR-KIS
DEOD_PASMU       -MTPHINAPAGAFADVVLMPGDPLRAKYIAETFLQDVKEITNVRNMLGFTGTYKGR-KIS
DEOD_XENNA       MATPHINAEMGDFADVVLMPGDPLRAQYIAETFLEDARQVNNVRGMLGFTGTYKGR-RIS
DEOD_PHOLL       MATPHINAEMGDFADVVLMPGDPLRAKYIAETFLENVRQVNDVRGMLGFTGTYKGR-PIS
DEOD_PECAS       MATPHINAEMGDFADVVLMPGDPLRAKFIAETFLDDAREVNNVRGMLGFTGTYKGR-KIS
DEOD_YERP3       MATPHINAEMGDFADVVLMPGDPLRAKFIAETFLQDVREVNNVRGMLGFTGTYKGR-KIS
DEOD_YERPS       MATPHINAEMGDFADVVLMPGDPLRAKFIAETFLQDVREVNNVRGMLGFTGTYKGR-KIS
DEOD_YERPN       MATPHINAEMGDFADVVLMPGDPLRAKFIAETFLQDVREVNNVRGMLGFTGTYKGR-KIS
DEOD_YERPP       MATPHINAEMGDFADVVLMPGDPLRAKFIAETFLQDVREVNNVRGMLGFTGTYKGR-KIS
DEOD_YERPA       MATPHINAEMGDFADVVLMPGDPLRAKFIAETFLQDVREVNNVRGMLGFTGTYKGR-KIS
DEOD_YERPE       MATPHINAEMGDFADVVLMPGDPLRAKFIAETFLQDVREVNNVRGMLGFTGTYKGR-KIS
DEOD_YERE8       MATPHINAEMGDFADVVLMPGDPLRAKHIAETFLKDVKQVNDVRGMLGFTGTYKGR-KIS
DEOD_ECOL6       MATPHINAEMGDFADVVLMPGDPLRAKYIAETFLEDAREVNNVRGMLGFTGTYKGR-KIS
DEOD_ECOL5       MATPHINAEMGDFADVVLMPGDPLRAKYIAETFLEDAREVNNVRGMLGFTGTYKGR-KIS
DEOD_ECOLC       MATPHINAEMGDFADVVLMPGDPLRAKYIAETFLEDAREVNNVRGMLGFTGTYKGR-KIS
DEOD_SHIFL       MATPHINAEMGDFADVVLMPGDPLRAKYIAETFLEDAREVNNVRGMLGFTGTYKGR-KIS
DEOD_SHIF8       MATPHINAEMGDFADVVLMPGDPLRAKYIAETFLEDAREVNNVRGMLGFTGTYKGR-KIS
DEOD_SHIDS       MATPHINAEMGDFADVVLMPGDPLRAKYIAETFLEDAREVNNVRGMLGFTGTYKGR-KIS
DEOD_ECOHS       MATPHINAEMGDFADVVLMPGDPLRAKYIAETFLEDAREVNNVRGMLGFTGTYKGR-KIS
DEOD_ECO24       MATPHINAEMGDFADVVLMPGDPLRAKYIAETFLEDAREVNNVRGMLGFTGTYKGR-KIS
DEOD_SHISS       MATPHINAEMGDFADVVLMPGDPLRAKYIAETFLEDAREVNNVRGMLGFTGTYKGR-KIS
DEOD_SHIBS       MATPHINAEMGDFADVVLMPGDPLRAKYIAETFLEDAREVNNVRGMLGFTGTYKGR-KIS
DEOD_ECO57       MATPHINAEMGDFADVVLMPGDPLRAKYIAETFLEDAREVNNVRGMLGFTGTYKGR-KIS
DEOD_ECOLI       MATPHINAEMGDFADVVLMPGDPLRAKYIAETFLEDAREVNNVRGMLGFTGTYKGR-KIS
DEOD_SALPA       MATPHINAEMGDFADVVLMPGDPLRAKHIAETFLEDVREVNNVRGMLGFTGTYKGR-KIS
DEOD_SALTI       MATPHINAEMGDFADVVLMPGDPLRAKHIAETFLEDVREVNNVRGMLGFTGTYKGR-KIS
DEOD_SALTY       MATPHINAEMGDFADVVLMPGDPLRAKHIAETFLENVREVNNVRGMLGFTGTYKGR-KIS
DEOD_SALPB       MATPHINAEMGDFADVVLMPGDPLRAKHIAETFLEDVREVNNVRGMLGFTGTYKGR-KIS
DEOD_SALCH       MATPHINAEMGDFADVVLMPGDPLRAKHIAETFLEDVREVNNVRGMLGFTGTYKGR-KIS
DEOD_SALAR       MATPHINAEMGDFADVVLMPGDPLRAKHIAETFLEDVREVNNVRGMLGFTGTYKGR-KIS
DEOD_CITK8       MATPHINAEMGDFADVVLMPGDPLRAKHIAETFLEDVREVNNVRGMLGFTGTYKGR-KIS
DEOD_ENT38       MATPHINAEMGDFADVVLMPGDPLRAKHIAETFLEDVREVNNVRGMLGFTGTYKGR-KIS
DEOD_CROS8       MATPHINAEMGDFADVVLMPGDPLRAKHIAETFLEDVREVNNVRGMLGFTGTYKGR-KIS
DEOD_KLEPN       MATPHINAEMGDFADVVLMPGDPLRANSIAETFLEDAREVNNVRGMLGFTGTYKGRRKIS
DEOD_SHEDO       MATPHINAVPGAFAETMLFPGDPLRAKYIAETFLENVEQVTDVRNMLGFTGTYKGK-RIS
DEOD_SHEFN       MATPHINAVEGAFAETVLFPGDPLRAKYIAETFLENVEQVTDVRNMLGFTGTYKGK-RIS
DEOD_SHESM       MATPHINAVEGAFAETVLFPGDPLRAKYIAETFLENVEQVTDVRNMLGFTGTYKGK-RIS
DEOD_SHESR       MATPHINAVEGAFAETVLFPGDPLRAKYIAETFLENVEQVTDVRNMLGFTGTYKGK-RIS
DEOD2_SHEON      MATPHINAVEGAFAETVLFPGDPLRAKYIAETFLENVEQVTDVRNMLGFTGTYKGK-RIS
DEOD_SHEB5       MATPHINAVEGAFAETMLFPGDPLRAKYIAETFLENVEQVTDVRNMLGFTGTYKGK-RIS
DEOD_SHEB8       MATPHINAVEGAFAETMLFPGDPLRAKYIAETFLENVEQVTDVRNMLGFTGTYKGK-RIS
DEOD_SHEAM       MATPHINAVEGAFAETVLFPGDPLRAKYIAETFLENVEQVTDVRNMLGFTGTYKGK-RIS
DEOD_SHELP       MATPHINAVDGAFADTVLFPGDPLRAKYIAETFLENVEQVTDVRNMLGFTGTYKGV-RIS
DEOD_PSYIN       MTTPHINAVDGAFAETVLMPGDPLRAKYIAENFLKDAVQVTDVRNMLGFTGTYKGK-RVS
DEOD_DICNV       -MTPHINAPAGAFAETVLFCGDPLRAQFIAHHFLKNAQEITNVRAMLGFTGEYQQH-KLS
DEOD1_SHEON      MSTPHINANPGDFAKTIIMSGDPLRAKLIAETYLEDVKEVTNVRGILGFTGKYKSK-DIS
DEOD3_ALIF1      MSTPHINAPLDAFADTILMPGDPLRAKLIAETYLENVVQVTDVRGMLGFTGEFKGR-KIS
DEOD_MYCGE       -MTPHISAKKDDISKVVLMPGDPLRAKWIAEQFLDQAKLVNEVRGMFAYTGQYKSK-TVT
DEOD_MYCPN       -MTPHINAKKDDIAKVVLMPGDPLRAKWIAEQFMEKPRLVNEVRGMLAFTGQYKGK-TIT
                   : *: :    :    :: ***:*.  ::.  :       . * : .::* :.    ::

DEOD_HELPH       LMGHGMGIASCTIYVTELIKTYQVKELLRIGTCGAISPKVGLKDIIMAMGASTDSKTNRV
DEOD_HELPY       LMGHGMGIASCTIYVTELIKTYQVKELLRIGTCGAISPKVGLKDIIMATGASTDSKTNRV
DEOD_HELPJ       LMGHGMGIASCTIYVTELIKTYQVKELLRIGTCGAISPKVGLKDIVMATGASTDSKTNRV
DEOD_BUCAI       IMSHGIGIPSASLYTRELIIEFNVKKIIRIGTCGAVRDDIKLRDIVISMGASTDSKVNRI
DEOD_BUCAP       VMSHGMGIPSASLYVRELILEYNVKKIIRVGTCGTIQNNIKLRDIVISMGASTDSKINRI
DEOD_BUCBP       VMSHGIGIPSSLIYVKELVSEYNVKKIIRIGTCGTVIEHININDIIICLGASTDSKVNRL
DEOD_BACC1       VQGTGMGVPSISIYVNELIQSYGVKNLIRVGTCGAIQKDVKVRDVIIAMTACTDSNMNRL
DEOD_BACAH       VQGTGMGVPSISIYVNELIQSYGVKNLIRVGTCGAIQKDVKVRDVIIAMTACTDSNMNRL
DEOD_BACHK       VQGTGMGVPSISIYVNELIQSYGVKNLIRVGTCGAIQKDVKVRDVIIAMTACTDSNMNRL
DEOD_BACAN       VQGTGMGVPSISIYVNELIQSYGVKNLIRVGTCGAIQKDVKVRDVIIAMTACTDSNMNRL
DEOD_BACCR       VQGTGMGVPSISIYVNELIQSYGVKNLIRVGTCGAIQKDVKVRDVIIAMTACTDSNMNRL
DEOD_BACCE       VQGTGMGVPSISIYVNELIQSYGVKNLIRVGTCGAIQKDVKVRDVIIAMTACTDSNMNRL
DEOD_BACCZ       VQGTGMGVPSISIYVNELIQSYGVKNLIRVGTCGAIQKDVKVRDVIIAMTACTDSNMNRL
DEOD_BACCN       VQGTGMGVPSISIYVNELIQSYGVKNLIRVGTCGAIQKDVKVRDVIIAMTACTDSNINRL
DEOD_GEOTN       VQGTGMGVPSISIYVNELIQSYGVKTLIRVGTCGAIQPDVRVRDVILAMSASTDSNMNRL
DEOD_GEOKA       VQGTGMGVPSISIYVNELIQSYGVKTLIRVGTCGAIQPDVRVRDVILAMSASTDSNMNRL
DEOD_GEOSE       VQGTGMGVPSISIYITELMQSYNVQTLIRVGTCGAIQKDVKVRDVILAMTSSTDSQMNRM
DEOD_OCEIH       VQGTGMGVPSISIYVNELIQSYDVKKLIRVGTCGAIQKDVNVRDVILAQGATTDSQMNRL
DEOD_LISW6       VMGTGMGIPSISIYVNELIQSYDVKNLIRVGTMGGIQADVKVRDVVIAQAASTDSQINRN
DEOD_LISIN       VMGTGMGIPSISIYVNELIQSYDVKNLIRVGTMGGIQADVKVRDVVIAQAASTDSQINRN
DEOD_LISMO       VMGTGMGIPSISIYVNELIQSYDVKNLIRVGTMGGIQADVKVRDVVIAQAASTDSQINRN
DEOD_LISMF       VMGTGMGIPSISIYVNELIQSYDVKNLIRVGTMGGIQADVKVRDVVIAQAASTDSQINRN
DEOD_BACSU       VQGTGMGVPSISIYVNELIQSYDVQNLIRVGSCGAIRKDVKVRDVILAMTSSTDSQMNRV
DEOD_BACVZ       VQGTGMGVPSISIYVNELIQSYDVQNLIRVGSCGAIRNDVKVRDVILAMTSSTDSQMNRV
DEOD_BACLD       VQGTGMGVPSISIYVNELIRSYDVKNLIRVGSCGAIRKDVNVRDVILAMTSSTDSQINRV
DEOD_CALS4       VQGTGMGVPSISIYVNELITSYGVKNLIRIGTCGSLQPDIKIRDIVIAMSASTDSAINKI
DEOD_ALKMQ       VQGTGMGMPSISIYVNELISDYGVKNLIRVGTCGAMQEEIQLRDVILAMSASTDSNMNKL
DEOD_CLOPS       VQGTGMGVPSISIYVNELIRDYGVKNLIRVGTAGGMQEDIKVRDLVLAMSSHTDSAINKV
DEOD_CLOP1       VQGTGMGVPSISIYVNELIRDYGVKNLIRVGTAGGMQEDIKVRDLVLAMSSHTDSAINKV
DEOD_CLOB8       VQGTGMGIPSISIYANELIQSYGVKNLIRVGTCGGYSEKVKVRDLIIAMSASTDSNLNLV
DEOD_CLOTE       VQGTGMGIPSMSIYATELIESYGVKNLIRVGTCGSYVEKVKVRDLIIAMSACTNSNINLV
DEOD_CLONN       VQGTGMGIPSISIYANELIESYGVKNLIRVGTCGSINKDIKVRDIILAMGACTNSGTNRM
DEOD_TREPA       VQGTGMGLPSHSIYVTELFQDYGVQKAIRVGTAGGLQEEVALKSVVCALGAATDSAINAR
DEOD_LACLM       VMGTGMGIPSISIYANELITEYGVKRLIRVGTAGSVNEDVHIRDLVIGQAAATTSAIVRH
DEOD_LACLS       VMGTGMGIPSISIYANELITEYGVKRLIRVGTAGSVNEDVHIRDLVIGQAAATTSAIVRH
DEOD_LACLA       VMGTGMGIPSISIYANELITEYGVKRLIRVGTAGSVNEDVHIRDLVIGQAAATTSAIIRN
DEOD3_SHEON      VMGHGMGISSMVLYGHELINFFGVKRIIRIGSLGATQQHVEMRDVILAQAAGTDSPTNAK
DEOD_MYXXD       VMGHGMGVPSISIYATELIKTYGVRVIIRVGSCGALSTDVKVREVIVATGAGTDSNVNRM
DEOD_HAHCH       VMGSGMGVPSISIYAHELFTQFNVKNIVRIGSCGSIRDEVKVRDIVIGMGAGTDSLVNRV
DEOD_PSEHT       IMGSGMGIPSMSLYARELIVTFGVKNLIRIGTCGGIGSDVKIRDVIFAQGACTDSNVNRA
DEOD_COLP3       VMGSGMGVPSISIYATELYKDYGVEKIIRIGSCGAVRDDIKIRDIVIGMAASTDSNVNRQ
DEOD_CHRVO       VMAHGMGIPSASIYTTELIKDYGVKNIIRIGSCGAVTPDIKLRELFVAMGASTDSKVNRM
DEOD2_VIBVY      VMGHGMGIPSACIYVHELIAEYGVKNVIRVGSCGAVRDDVNLMDVVIGMGASTDSKVNRI
DEOD2_VIBVU      VMGHGMGIPSACIYVHELIAEYGVKNVIRVGSCGAVRDDVNLMDVVIGMGASTDSKVNRI
DEOD2_VIBPA      VMGHGMGIPSCCIYVHELIAEYGVKNVIRVGSCGAVRDDVNLMDVVIGMGASTDSKVNRI
DEOD2_ALIF1      VMGHGMGIPSCCIYVHELIAEYGVKNVIRVGSCGAVHDDVKLMDVVIGMGASTDSKVNRI
DEOD2_VIBCH      VMGHGMGIPSCSIYVHELIAEYGVKNIIRIGSCGAVRDDVKLMDVVIGMGASTDSKVNRI
DEOD2_PHOPR      VMGHGMGIPSCSIYVHELIKDFGVKNIIRVGSCGAVHDDVKLMDIIIGMGASTDSKVNRI
DEOD1_VIBVY      VMGHGMGIPSCSIYATELIKDYGVKKIIRVGSCGAVSTDIKVRDVVIGMGACTDSKVNRI
DEOD1_VIBVU      VMGHGMGIPSCSIYATELIKDYGVKKIIRVGSCGAVSTDIKVRDVVIGMGACTDSKVNRI
DEOD1_VIBPA      VMGHGMGIPSCSIYATELIKDFGVKKIIRVGSCGAVNEDIKVRDVVIGMGACTDSKVNRI
DEOD1_VIBCH      VMGHGMGIPSCSIYVTELIKDYGVKKIIRVGSCGAVNEGIKVRDVVIGMGACTDSKVNRI
DEOD1_ALIF1      VMGHGMGIPSCSIYMTELIKDFGVKKVIRVGSCGAVNEGIKVRDVVIGMGACTDSKVNRI
DEOD1_PHOPR      VMGHGMGIPSCSIYATELIKDFGVKKIIRVGSCGAVRDDVKLRDVVIGMGASTDSKVNRI
DEOD_ACTP2       VMGHGMGIPSCSIYAKELITEYGVKKIIRVGSCGAVRQDVKVRDVIIGSGACTDSKVNRI
DEOD_ACTPL       VMGHGMGIPSCSIYAKELITEYGVKKIIRVGSCGAVRQDVKVRDVIIGSGACTDSKVNRI
DEOD_HAEDU       IMGHGMGIPSCSIYAKELITEYGVKKIIRVGSCGAVRADVKLRDIVIGSGACTDSKVNRI
DEOD_ACTSZ       VMGHGMGIPSCSIYSKELITEYGVKKIIRVGSCGAVRQDVHVRDVIIGLGACTDSKVNRI
DEOD_MANSM       VMGHGMGIPSCSIYTKELITEYGVKKIIRVGSCGAVRNDVKVRDVIIGLGACTDSKVNRI
DEOD_HAES1       VMGHGMGIPSCSIYAKELITEYGVKKIIRVGSCGAVNMDVKIRDVIIGLGACTDSKVNRI
DEOD_HISS2       VMGHGMGIPSCSIYAKELITEYGVKKIIRVGSCGAVNMDVKIRDVIIGLGACTDSKVNRI
DEOD_HAEIG       IMGHGMGIPSCSIYAKELITEYGVKKIIRVGSCGTVRMDVKVRDVIIGLGACTDSKVNRI
DEOD_HAEIE       IMGHGMGIPSCSIYAKELITEYGVKKIIRVGSCGSVRMDVKVRDVIIGLGACTDSKVNRI
DEOD_HAEIN       IMGHGMGIPSCSIYAKELITEYGVKKIIRVGSCGTVRMDVKVRDVIIGLGACTDSKVNRI
DEOD_HAEI8       IMGHGMGIPSCSIYAKELITEYGVKKIIRVGSCGTVRMDVKVRDVIIGLGACTDSKVNRI
DEOD_PASMU       VMGHGMGIPSCSIYTKELITEYGVKKIIRVGSCGAVRMDVKLRDVVIGFGACTDSKVNRI
DEOD_XENNA       VMGHGMGIPSCSIYAKELITEFGVKKIIRIGSCGAVSEDVKIRDVVIGMGACTDSKVNRM
DEOD_PHOLL       VMGHGMGIPSCSIYAKELITDFGAKVLIRVGSCGSVRHDVKLRDVVIGMGACTDSKVNRI
DEOD_PECAS       VMGHGMGIPSCSIYAKELITEFGVKKIIRVGSCGAVREDVKLRDVVIGMGACTDSKVNRM
DEOD_YERP3       VMGHGMGIPSCSIYAKELITDFGVKKIIRVGSCGAVRTDVKLRDVVIGMGACTDSKVNRM
DEOD_YERPS       VMGHGMGIPSCSIYAKELITDFGVKKIIRVGSCGAVRTDVKLRDVVIGMGACTDSKVNRM
DEOD_YERPN       VMGHGMGIPSCSIYAKELITDFGVKKIIRVGSCGAVRTDVKLRDVVIGMGACTDSKVNRM
DEOD_YERPP       VMGHGMGIPSCSIYAKELITDFGVKKIIRVGSCGAVRTDVKLRDVVIGMGACTDSKVNRM
DEOD_YERPA       VMGHGMGIPSCSIYAKELITDFGVKKIIRVGSCGAVRTDVKLRDVVIGMGACTDSKVNRM
DEOD_YERPE       VMGHGMGIPSCSIYAKELITDFGVKKIIRVGSCGAVRTDVKLRDVVIGMGACTDSKVNRM
DEOD_YERE8       VMGHGMGIPSCSIYAKELITDFGVKKIIRVGSCGAVREDVKLRDVVIGMGACTDSKVNRL
DEOD_ECOL6       VMGHGMGIPSCSIYTKELITDFGVKKIIRVGSCGAVLPHVKLRDVVIGMGACTDSKVNRI
DEOD_ECOL5       VMGHGMGIPSCSIYTKELITDFGVKKIIRVGSCGAVLPHVKLRDVVIGMGACTDSKVNRI
DEOD_ECOLC       VMGHGMGIPSCSIYTKELITDFGVKKIIRVGSCGAVLPHVKLRDVVIGMGACTDSKVNRI
DEOD_SHIFL       VMGHGMGIPSCSIYTKELITDFGVKKIIRVGSCGAVLPHVKLRDVVIGMGACTDSKVNRI
DEOD_SHIF8       VMGHGMGIPSCSIYTKELITDFGVKKIIRVGSCGAVLPHVKLRDVVIGMGACTDSKVNRI
DEOD_SHIDS       VMGHGMGIPSCSIYTKELITDFGVKKIIRVGSCGAVLPHVKLRDVVIGMGACTDSKVNRI
DEOD_ECOHS       VMGHGMGIPSCSIYTKELITDFGVKKIIRVGSCGAVLPHVKLRDVVIGMGACTDSKVNRI
DEOD_ECO24       VMGHGMGIPSCSIYTKELITDFGVKKIIRVGSCGAVLPHVKLRDVVIGMGACTDSKVNRI
DEOD_SHISS       VMGHGMGIPSCSIYTKELITDFGVKKIIRVGSCGAVLPHVKLRDVVIGMGACTDSKVNRI
DEOD_SHIBS       VMGHGMGIPSCSIYTKELITDFGVKKIIRVGSCGAVLPHVKLRDVVIGMGACTDSKVNRI
DEOD_ECO57       VMGHGMGIPSCSIYTKELITDFGVKKIIRVGSCGAVLPHVKLRDVVIGMGACTDSKVNRI
DEOD_ECOLI       VMGHGMGIPSCSIYTKELITDFGVKKIIRVGSCGAVLPHVKLRDVVIGMGACTDSKVNRI
DEOD_SALPA       VMGHGMGIPSCSIYTKELITDFGVKKIIRVGSCGAVRMDVKLRDVVIGMGACTDSKVNRI
DEOD_SALTI       VMGHGMGIPSCSIYTKELITDFGVKKIIRVGSCGAVRMDVKLRDVVIGMGACTDSKVNRI
DEOD_SALTY       VMGHGMGIPSCSIYTKELITDFGVKKIIRVGSCGAVRMDVKLRDVVIGMGACTDSKVNRI
DEOD_SALPB       VMGHGMGIPSCSIYTKELITDFGVKKIIRVGSCGAVRMDVKLRDVVIGMGACTDSKVNRI
DEOD_SALCH       VMGHGMGIPSCSIYTKELITDFGVKKIIRVGSCGAVRMDVKLRDVVIGMGACTDSKVNRI
DEOD_SALAR       VMGHGMGIPSCSIYTKELITDFGVKKIIRVGSCGAVRMDVKLRDVVIGMGACTDSKVNRI
DEOD_CITK8       VMGHGMGIPSCSIYTKELITDFGVKKIIRVGSCGAVRNDVKLRDVVIGMGACTDSKVNRI
DEOD_ENT38       VMGHGMGIPSCSIYTKELITDFGVKKIIRVGSCGAVRMDVKLRDVVIGMGACTDSKVNRM
DEOD_CROS8       VMGHGMGIPSCSIYTKELITDFGVKKIIRVGSCGAVRADVKLRDVVIGMGACTDSKVNRL
DEOD_KLEPN       VMGHGMGIPSCSIYTKELITDFGVKKIIRVGSCGAVREDVKLREVVIGHGACTDSKVNRL
DEOD_SHEDO       VMGSGMGIPSASIYAYELIKEYGVKNLIRVGTCGAISTDVKVRDVIIAMGACTDSKVNRL
DEOD_SHEFN       VMGSGMGIPSCSIYAHELIKDYGVKNLIRVGTCGAISTDVKVRDVIIGMGACTDSRVNRL
DEOD_SHESM       VMGSGMGIPSCSIYATELIKDYGVKNLIRVGTCGAISTDVKVRDVIIGMGACTDSQVNRL
DEOD_SHESR       VMGSGMGIPSCSIYATELIKDYGVKNLIRVGTCGAISTDVKVRDVIIGMGACTDSQVNRL
DEOD2_SHEON      VMGSGMGIPSCSIYATELIKDYGVKNLIRVGTCGAISTDVKVRDVIIGMGACTDSQVNRL
DEOD_SHEB5       VMGSGMGIPSCSIYATELIRDYGVKNLIRVGTCGAISTDVKVRDVIIGMGACTDSAVNRL
DEOD_SHEB8       VMGSGMGIPSCSIYATELIRDYGVKNLIRVGTCGAISTDVKVRDVIIGMGACTDSAVNRL
DEOD_SHEAM       VMGSGMGIPSCSIYATELIKDYGVKNLIRVGTCGAISTDVKVRDVIIGMGACTDSQVNRL
DEOD_SHELP       VMGSGMGIPSCSIYATELIKDYGVKNLIRVGTCGAISTDVKVRDVIIGMGACTDSQVNRL
DEOD_PSYIN       VMGSGMGIPSCSIYATELFREYGVQNIIRVGSCGAVSRDIKLRDVIIGMGASTDSKANRI
DEOD_DICNV       VMGHGMGIPSCSIYAKELITEYGVKNLIRVGSCGAVLDEIKLHDVIIALSAATDSNVNRL
DEOD1_SHEON      IMGHGMGAPSASIYFHELMATYGVKNFIRVGSCGAISDNIHLKDLIVAMGASTDSKINRI
DEOD3_ALIF1      VMGHGMGAPSASIYFHELMTTYKVKNFIRIGSCGAIHDDVKLKDLIVAIGASTDSKMNRI
DEOD_MYCGE       VMGHGMGIPSIGIYSYELMNFYEVETIIRIGSCGALAPQLKLKDLVIASKAWSESIYAKD
DEOD_MYCPN       IMGHGMGIPSIGIYSYELMKFYEVNTIIRIGSCGALQGSLNLQDLIIAAKAWSESIYAND
                 : . *:* .*  :*  **   : ..  :*:*: *     : : .:.    : : *     

DEOD_HELPH       RFLNH--DLSATPDFELSLRAYQTAKRLGIDLKVGNVFSSDFFYSFET-HAFDLMAQYNH
DEOD_HELPY       RFLNH--DLSATPDFELSLRAYQTAKRLGIDLKVGNVFSSDFFYSFET-HAFDLMAKYNH
DEOD_HELPJ       RFLNH--DLSATPDFELSLRAYQTAKRLGIDLKIGNVFSSDFFYSFET-HAFGLMAQYNH
DEOD_BUCAI       RFNDH--DFAAIADFDMIYNIVSISKKMKIKVSIGNFFTTDSFYNDDK-KMLNILKKYNI
DEOD_BUCAP       RFNNH--DYAAIADFEMIFHAFSTAKKMNFKVHIGNFFTTDSFYTESE-DMLKILKKYNI
DEOD_BUCBP       RFHDN--DFSSVADFYLILDLFNSANNAGIKINIGNFFTTDLFYVKND-KLLDTLQRYNI
DEOD_BACC1       TFPGF--DFAPAANFDLLKKAYDAGTEKGLHVRVGNVLTADVFYRESMD-MVKKLGDYGV
DEOD_BACAH       TFPGF--DFAPAANFDLLKKAYDAGTEKGLHVRVGNVLTADVFYRESMD-MVKKLGDYGV
DEOD_BACHK       TFPGF--DFAPAANFDLLKKAYDAGTEKGLHVRVGNVLTADVFYRESMD-MVKKLGDYGV
DEOD_BACAN       TFPGF--DFAPAANFDLLKKAYDAGTEKGLHVRVGNVLTADVFYRESMD-MVKKLGDYGV
DEOD_BACCR       TFPGF--DFAPAANFDLLKKAYDAGTEKGLHVRVGNVLTADVFYRESMD-IVKKLGDYGV
DEOD_BACCE       TFPGF--DFAPAANFDLLKKAYDAGTEKGLHVRVGNVLTADVFYRESMD-MVKKLGDYGV
DEOD_BACCZ       TFPGF--DFAPAANFDLLKKAYDAGTEKGLHVRVGNVLTADVFYRESMD-MVKKLADYGV
DEOD_BACCN       TFPGF--DFAPAANFDLLKKAYDAGTEKGLHIRVGNVLTADVFYRESMD-MVKKLGDYGV
DEOD_GEOTN       IFRGR--DYAPTADFHLLRTAYDVGMEKGLALKVGNVFTADMFYNDEPN--WETWARYGV
DEOD_GEOKA       IFRGR--DYAPTADFHLLRTAYEVGVEKGLALKVGNVFTADMFYNDEPN--WETWARYGV
DEOD_GEOSE       TFGGI--DYAPTANFDLLKTAYEIGKEKGLQLKVGSVFTADMFYNENAQ--FEKLARYGV
DEOD_OCEIH       IFNGI--DYAPIADFELLKNAYDAGVDKGLHLRVGNVFTSDTFYRDNAQQVNELLAKYQV
DEOD_LISW6       TFAGV--DFAPVADFSLLKKAYDAGVEKGLSLKVGNVFSADRFYNDQLD--KQQLADYGV
DEOD_LISIN       TFAGV--DFAPVADFSLLKKAYDAGVEKGLSLKVGNVFSADRFYNDQLD--KQQLADYGV
DEOD_LISMO       TFAGV--DFAPVADFSLLKKAYDAGIEKGLSLKVGNVFSADRFYNDQLD--KQQLADYGV
DEOD_LISMF       TFAGV--DFAPVADFSLLKKAYDAGIEKGLSLKVGNVFSADRFYNDQLD--KQQLADYGV
DEOD_BACSU       AFGSV--DFAPCADFELLKNAYDAAKDKGVPVTVGSVFTADQFYNDDSQ--IEKLAKYGV
DEOD_BACVZ       AFGSV--DYAPCADFELLNKAYQEAQKNNLPVAVGSVFTADQFYNEDSQ--IEKLARYGV
DEOD_BACLD       AFGSI--DFAPCADFGLLKAAYDAASERNIPVTAGNVFTADQFYNDDSQ--IEKLAKHGV
DEOD_CALS4       RFNGM--DYAPTASFKLLKKAYDKAVEMGIEPKVGNILTTDTFYHDDPE-SWRLWAKFGV
DEOD_ALKMQ       RFGGM--DYAPTASFRLLKKAYDVAQEKGILTRVGNVLTVDTFYNEDVN-SWKKWAEFGT
DEOD_CLOPS       RFNGL--DFAPTASFKLLKAAYDTAVEKGYSPKVGSVFTADSFYNDNPE-AWKQWAKFGT
DEOD_CLOP1       RFNGL--DFAPTASFKLLKAAYDTAVEKGYSPKVGSVFTADSFYNDNPE-AWKQWAKFGT
DEOD_CLOB8       RFQGR--TFAPTASFELLKPAYDIAVEKGFDPKVGSIYSSDVFYGDDDE-DWKKWAKFGC
DEOD_CLOTE       PFKGR--TFAPTASFDLLKPAYDIAVEKGFEPKVGSIYSSDIFYDDDKE-DWKTWAKYGC
DEOD_CLONN       RFNGM--DFAPIASFDLLKKAYDIGKSKGLDIKVGNILSSDLFYNDDKD-AIKLWSKYGV
DEOD_TREPA       RFSGM--HFAPTASWSLLRTAVSVADEMGTGVQVGNVISSDVFYDESGS--WRLWARYGV
DEOD_LACLM       DFPDF--DFPQIADFDLLDKAYHIAKDLGITTHVGNILSSDLFYGGPDA---VKVGKLGV
DEOD_LACLS       DFPDF--DFPQIADFDLLDKAYHIAKDLGITTHVGNILSSDLFYGGPDA---VKVGKLGV
DEOD_LACLA       DFPDF--DFPQIADFDLLDKAYHIAKDLGITTHVGNILSSDLFYGGPDA---VKVGKLGV
DEOD3_SHEON      RSSGY--HMATSATFSLLHKAYTKANEKGISVKVGNVFSGDLYYDPDED-MIPALERFGV
DEOD_MYXXD       RLMGH--DFAAVADFTLARRAMEAAERRNKPVRAGPVFTSDLFYHPQE-QLNATLARMGV
DEOD_HAHCH       RLNHY--DFAAIADYDLLEPVVNAARRREARFHVGALFTTDLFYAADP-GLTERLSAHGV
DEOD_PSEHT       RVRGT--DFAAIADFDLLLNGVNAAKDLGIKAKVGNVFTTDTFYQADD-TFYKDLDKLGV
DEOD_COLP3       RFHNV--DFAACADFSLLKSVVDTAEKLGKPVHVGNIFTADLFYTPQP-EKFATMEKYGI
DEOD_CHRVO       RFNDH--DYAAIADYTLLRTVVDTAAEQGKKVTVGNVFSADLFYGVQP-NMLDVLSKLQV
DEOD2_VIBVY      RFNDH--DFAALADYGLLEEAVKQARAQNVPVKVGNVFSADLFYTPEA-DIFEKMEKLGI
DEOD2_VIBVU      RFNDH--DFAALADYGLLEEAVKQARAQNVPVKVGNVFSADLFYTPEA-DIFEKMEKLGI
DEOD2_VIBPA      RFNNH--DFAAIADFSLLEEAVKQARAQEVPVKVGNVFSADLFYTPEA-DIFEKMEKLGI
DEOD2_ALIF1      RFNNH--DFAAIADFGLLETAVGQARELNVPVKVGNVFSADLFYSPEA-DLFDKMEKLGI
DEOD2_VIBCH      RFSGH--DFAAIADYDLLETAVNQARAQQVPVKVGNVFSADLFYTPEP-EIFEKMKKLGI
DEOD2_PHOPR      RFNDH--DFAAIADFHLLETSVQQARLQNVNVRVGNIFSADLFYSPEE-GLFDKMEKLGM
DEOD1_VIBVY      RFKGH--DFAAIADYKMVKAAEEAAKARGIDVKVGNLFSAELFYTPDP-EMFDVMDKYGI
DEOD1_VIBVU      RFKGH--DFAAIADYKMVKAAEEAAKARGIDVKVGNLFSAELFYTPDP-EMFDVMDKYGI
DEOD1_VIBPA      RFKGH--DFAAIADYKMVRAAEDAAKARGIDVKVGNLFSAELFYTPDP-EMFDVMDKYGI
DEOD1_VIBCH      RFKDH--DFAAIADYKMVKAAEEAAKARGIDVKVGNLFSAELFYTPDP-SMFDVMDKYGI
DEOD1_ALIF1      RFKDH--DFAAIADYEMVRNAELAAQARGIDVKVGNLFSAELFYTPDP-SMFDLMDKYGI
DEOD1_PHOPR      RFGGH--DFAAIADFGMVQNAVDAAKAKGIPVKVGNIFSADLFYNPDF-EFFKTMDKYGI
DEOD_ACTP2       RFRDN--DFAAISDFDMTLAAVQAAKQKGIAARVGNLFSADLFYTPDV-EMFDVMEKYGI
DEOD_ACTPL       RFRDN--DFAAISDFDMTLAAVQAAKQKGIAARVGNLFSADLFYTPDV-EMFDVMEKYGI
DEOD_HAEDU       RFRDN--DFAAIADFEMTLAAYQVAKQKNISVQVGNLFSADLFYTPDV-AMFDVMEKYGI
DEOD_ACTSZ       RFRDN--DFAAIADFGMAQAAVQAAKNKKIKVHVGNLFSADLFYTPDV-EMFDVMEKYGI
DEOD_MANSM       RFKDN--DFAAIADFDMTQAAVQAAKAKGINYRVGNLFSADLFYTPDV-EMFDVMEKYGI
DEOD_HAES1       RFKDN--DFAAIADFGMAQAAVQAAKNKGIDVKVGNLFSADLFYTPDP-EMFDVMEKYGI
DEOD_HISS2       RFKDN--DFAAIADFGMARAAVQAAKNKGIDVKVGNLFSADLFYTPDL-EMFDVMEKYGI
DEOD_HAEIG       RFKDN--DFAAIADFDMAQAAVQAAKAKGKAVRVGNLFSADLFYTPDV-EMFDVMEKYGI
DEOD_HAEIE       RFKDN--DFAAIADFDMAQAAVQAAKAKGKAVRVGNLFSADLFYTPDV-EMFDVMEKYGI
DEOD_HAEIN       RFKDN--DFAAIADFDMAQAAVQAAKAKGKVVRVGNLFSADLFYTPDV-EMFDVMEKYGI
DEOD_HAEI8       RFKDN--DFAAIADFDMAQAAVQAAKAKGKVVRVGNLFSADLFYTPDV-EMFDVMEKYGI
DEOD_PASMU       RFKNH--DFAAIADFDMTMAAVQAAKAKGLNVHVGNLFSADLFYTPDV-EMFDVMEKYGI
DEOD_XENNA       RFKDH--DFAAIADFDLVRHAVDAAKAKNINTRVGNIFSVDLFYSPDP-QMFDVMEKYGI
DEOD_PHOLL       RFKDH--DFAAIADFDLVRNAVDAAKAKNINVRVGNIFSVELFYTPDP-QLFDIMEKYGI
DEOD_PECAS       RFKDH--DYAAIADFDMVRNAVDAAKARDVSVRVGNIFSADLFYTPDP-QMFDVMEKYGI
DEOD_YERP3       RFKDH--DYAAIADFEMTRNAVDAAKAKGVNVRVGNLFSADLFYTPDP-QMFDVMEKYGI
DEOD_YERPS       RFKDH--DYAAIADFEMTRNAVDAAKAKGVNVRVGNLFSADLFYTPDP-QMFDVMEKYGI
DEOD_YERPN       RFKDH--DYAAIADFEMTRNAVDAAKAKGVNVRVGNLFSADLFYTPDP-QMFDVMEKYGI
DEOD_YERPP       RFKDH--DYAAIADFEMTRNAVDAAKAKGVNVRVGNLFSADLFYTPDP-QMFDVMEKYGI
DEOD_YERPA       RFKDH--DYAAIADFEMTRNAVDAAKAKGVNVRVGNLFSADLFYTPDP-QMFDVMEKYGI
DEOD_YERPE       RFKDH--DYAAIADFEMTRNAVDAAKAKGVNVRVGNLFSADLFYTPDP-QMFDVMEKYGI
DEOD_YERE8       RFKDH--DYAAIADFDMTRNAVDAAKAKGLNVRVGNLFSADLFYTPDP-QMFDVMKKYGI
DEOD_ECOL6       RFKDH--DFAAIADFDMVRNAVDAAKALGVDARVGNLFSADLFYSPDG-EMFDVMEKYGI
DEOD_ECOL5       RFKDH--DFAAIADFDMVRNAVDAAKALGVDARVGNLFSADLFYSPDG-EMFDVMEKYGI
DEOD_ECOLC       RFKDH--DFAAIADFDMVRNAVDAAKALGVDARVGNLFSADLFYSPDG-EMFDVMEKYGI
DEOD_SHIFL       RFKDH--DFAAIADFDMVRNAVDAAKALGVDARVGNLFSADLFYSPDG-EMFDVMEKYGI
DEOD_SHIF8       RFKDH--DFAAIADFDMVRNAVDAAKALGVDARVGNLFSADLFYSPDG-EMFDVMEKYGI
DEOD_SHIDS       RFKDH--DFAAIADFDMVRNAVDAAKALGVDARVGNLFSADLFYSPDG-EMFDVMEKYGI
DEOD_ECOHS       RFKDH--DFAAIADFDMVRNAVDAAKALGIDARVGNLFSADLFYSPDG-EMFDVMEKYGI
DEOD_ECO24       RFKDH--DFAAIADFDMVRNAVDAAKALGIDARVGNLFSADLFYSPDG-EMFDVMEKYGI
DEOD_SHISS       RFKDH--DFAAIADFDMVRNAVDAAKALGIDARVGNLFSADLFYSPDG-EMFDVMEKYGI
DEOD_SHIBS       RFKDH--DFAAIADFDMVRNAVDAAKALGIDARVGNLFSADLFYSPDG-EMFDVMEKYGI
DEOD_ECO57       RFKDH--DFAAIADFDMVRNAVDAAKALGIDARVGNLFSADLFYSPDG-EMFDVMEKYGI
DEOD_ECOLI       RFKDH--DFAAIADFDMVRNAVDAAKALGIDARVGNLFSADLFYSPDG-EMFDVMEKYGI
DEOD_SALPA       RFKDH--DFAAIADFDMVRNAVDAAKALGVDARVGNLFSADLFYSPDG-EMFDVMEKYGV
DEOD_SALTI       RFKDH--DFAAIADFDMVRNAVDAAKALGVDARVGNLFSADLFYSPDG-EMFDVMEKYGV
DEOD_SALTY       RFKDH--DFAAIADFDMVRNAVDAAKALGVDARVGNLFSADLFYSPDG-EMFDVMEKYGV
DEOD_SALPB       RFKDH--DFAAIADFDMVRNAVDAAKALGVDARVGNLFSADLFYSPDG-EMFDVMEKYGV
DEOD_SALCH       RFKDH--DFAAIADFDMVRNAVDAAKALGVDARVGNLFSADLFYSPDG-EMFDVMEKYGV
DEOD_SALAR       RFKDH--DFAAIADFDMVRNAVDAAKALGVDARVGNLFSADLFYSPDG-DMFDVMEKYGI
DEOD_CITK8       RFKDH--DFAAIADFDMVRNAVDAAKALGVDARVGNLFSADLFYSPDG-EMFDVMEKYGI
DEOD_ENT38       RFKDH--DFAAIADFGMVRNAVDAAKALGVDARVGNIFSADLFYSPDGGEMFDVMEKYGI
DEOD_CROS8       RFKDH--DFAAIADFDMVRNAVDAAKALGVEARVGNIFSADLFYTPDP-SMFDVMEKYGI
DEOD_KLEPN       RFKDH--DFPAIADFGMVRNAVDA-KALGVEARRSNIFSADLFYTPDP-SMFDVMEKYGI
DEOD_SHEDO       RFKDH--DFAAIADYSLLSAVVDSAKEHGTQIRVGNVFSADLFYTPDP-QMFDVMEKMGV
DEOD_SHEFN       RFKDN--DFAAIADYSLLSAVVDSAKAHGTKIRVGNVFSADLFYTPDP-QMFDVMEKMGI
DEOD_SHESM       RFKGQ--DFAAIANYELMNAVIESAKVKGTKIRVGNVFSADLFYTPDP-QMFDVMEKMGV
DEOD_SHESR       RFKGQ--DFAAIANYELMNAVIESAKVKGTKIRVGNVFSADLFYTPDP-QMFDVMEKMGV
DEOD2_SHEON      RFKGQ--DFAAIANYELMNAVIESAKVKGTKIRVGNVFSADLFYTPDP-QMFDVMEKMGV
DEOD_SHEB5       RFKGQ--DFAAIANYELMNAVIESAKVRGTKVRVGNIFSADLFYTPDP-QMFDVMEKMGV
DEOD_SHEB8       RFKGQ--DFAAIANYELMNAVIESAKVRGTKVRVGNIFSADLFYTPDP-QMFDVMEKMGV
DEOD_SHEAM       RFKGQ--DFAAIADYSLLSAVVESAKTHGIQTRVGNVFSADLFYTPDP-EMFDVMEKMGV
DEOD_SHELP       RFKGQ--DFAAICDYSLLSAVVKAAEEKGTKYRVGNVFSADLFYTPDP-EMFDVMEKMDV
DEOD_PSYIN       RFKGH--DFAAIASYELLEKAVNAARALGIKARVGNIFSADTFYTPEP-EVFDTLEKYNI
DEOD_DICNV       RFRHY--DFAATADYSIFSALIAAAAQQNITARVGTVFSTDSFYHADT-ELMDLLKRFHI
DEOD1_SHEON      RFLDH--DLAAIANYDLLQACIEVLKTTTVNYKVGNVFSSDLFYRPNE-NDYTLMAKYGV
DEOD3_ALIF1      RFKDN--DFAATANYNMLSECVNTLKTTDINYLVGNVFSSDLFYRPDE-EQYDMMARYGI
DEOD_MYCGE       MGVEIPEDKILFATSSLVELAKETAIKNKLDFHEGLVFCEDAFYQTRK-DVISLAKEKNS
DEOD_MYCPN       MGVEVPADKILMASPQLVELAKKTANQLQLAFHEGLVFCEDAFHQIRK-DVLKLAQEKHA
                                 :                 . .   : ::                

DEOD_HELPH       LAIEMEAAGLYATAMELSAKALCLCSVSDHLITKEALSPKERVESFDNMIILALEMMS--
DEOD_HELPY       LAIEMEAAGLYATAMELNAKALCLCSVSDHLITKEALSPKERVESFDNMIILALEMMS--
DEOD_HELPJ       LAIEMEAAGLYATAMELNAKALCLCSVSDHLITKEALSPKERIESFDNMITLALEMMS--
DEOD_BUCAI       IGVDMETAGIYGVASELKVQALSICTVSDHITNKEFLSSKERESSFNDMIELALESVL--
DEOD_BUCAP       IGIDMETAGIYAVAAELKAQALSICTVSDHIIKKDAVSSKDRESSFHNMITLSLETTLLL
DEOD_BUCBP       LGIDMETAGIYSLASELGIQVASICTVSDHILKKDQMSYIDRESNLNNMIYISLEALILK
DEOD_BACC1       LAVEMETTALYTLAAKYGVNALSVLTVSDHIFTGEETTSEERQTTFNEMIEIALDAAIQQ
DEOD_BACAH       LAVEMETTALYTLAAKYGVNALSVLTVSDHIFTGEETTSEERQTTFNEMIEIALDAAIQQ
DEOD_BACHK       LAVEMETTALYTLAAKYGVNALSVLTVSDHIFTGEETTSEERQTTFNEMIEIALDAAIQQ
DEOD_BACAN       LAVEMETTALYTLAAKYGVNALSVLTVSDHIFTGEETTSEERQTTFNEMIEIALDAAIQQ
DEOD_BACCR       LAVEMETTALYTLAAKYGVNALSVLTVSDHIFTGEETTSEERQTTFNEMIEIALDAAIQQ
DEOD_BACCE       LAVEMETTALYTLAAKYGVNALSVLTVSDHIFTGEETTSEERQTTFNEMIEIALDAAIQQ
DEOD_BACCZ       LAVEMETTALYTLAAKYGVNALSVLTVSDHIFTGEETTSEERQTTFNEMIEIALDAAIQQ
DEOD_BACCN       LAVEMETTALYTLAAKYGVNALSVLTVSDHIFTGEETTAEERQTTFNEMIEIALEAAIQQ
DEOD_GEOTN       LAVEMETAALYTLAAKFDCRALSVLTVSDHIITGEETTAEERQTTFNDMIEVALEAASRN
DEOD_GEOKA       LAVEMETAALYTLAAKFGCRALSVLTVSDHILTGEETTAEERQMTFNEMIEVALEAAIRN
DEOD_GEOSE       LAVEMETTALYTLAAKFGRKALSVLTVSDHILTGEETTAEERQTTFNEMIEVALETAIRQ
DEOD_OCEIH       LAIEMESTALYTLAAKYGRQALSVLTVSDHIITGEETTAEERQTTFNDMMEIALDTIIK-
DEOD_LISW6       LGIEMEAAALYTLAQKYGRRALAILTVSDHIFTGEETSAEERQTTFNDMIVVALEAAIK-
DEOD_LISIN       LGIEMEAAALYTLAQKYGRRALAILTVSDHIFTGEETSAEERQTTFNDMIVVALEAAIK-
DEOD_LISMO       LGIEMEAAALYTLAQKYGRRALAILTVSDHIFTGEETSAEERQTTFNDMIVVALEAAIK-
DEOD_LISMF       LGIEMEAAALYTLAQKYGRRALAILTVSDHIFTGEETSAEERQTTFNDMIVVALEAAIK-
DEOD_BACSU       LGVEMETTALYTLAAKHGRKALSILTVSDHVLTGEETTAEERQTTFHDMIEVALHSVSQ-
DEOD_BACVZ       LGVEMETTALYTLAAKYGKKALSILTVSDHVLTGEETTAEERQTTFHDMIKLALHTVS--
DEOD_BACLD       LAVEMETTALYTLAAKFGRKALSILTVSDHVITGEETTAEERQTTFNDMILLALDTAL--
DEOD_CALS4       LAVEMETAGLYTLAAKYGVDALTILTVSDSLVTGEATSAEERQKTFMDMVKIALEIA---
DEOD_ALKMQ       LAVEMETAALYTLAAKFGVDALTLLTVSDSLITGGQTTSEERQNTFMGMVKIALELAE--
DEOD_CLOPS       LAVEMETAALYTLAAKYGVNALTILTISDHLITAEETTSEERQTTFTKMMEVALDAAITL
DEOD_CLOP1       LAVEMETAALYTLAAKYGVNALTILTISDHLITAEETTSEERQTTFTKMMEVALDAAITL
DEOD_CLOB8       LGVEMEAAALYTIAAKFGVNALALLTVSDHFVTGEVTSAEERQLTFTNMMEVALDTIAKI
DEOD_CLOTE       LGVEMETAALYTIAAKYGVNALTLLTVSDHFVTHEVTSAEERQTTFKAMMEVALDTIVNL
DEOD_CLONN       LGIEMEASGLYTLGAKYGVNTLAILTVSDSIVTGEETTAKERETTFTKMMEIALELAE--
DEOD_TREPA       LAVEMETAELYTLAAKFRREALSILTISDHLVTGAVTSAQERERSFTQMIEIALEAIIQ-
DEOD_LACLM       KAVEMEAAGLYYLGAKYKVQTLGIMTISDHILTGESTTSEERQLTFTDMMKVGLETLIAE
DEOD_LACLS       KAVEMEAAGLYYLGAKYKVQTLGIMTISDHILTGESTTSEERQLTFTDMMKVGLETLIAE
DEOD_LACLA       KAVEMEAAGLYYLGAKYKVQTLGIMTISDHILTGESTTSEERQLTFTDMMKVGLETLISE
DEOD3_SHEON      LGIDMEVAGLYGLAHQQGIESLAILTVSDHCLTGEETTAQERQLSFNNMIELALETALN-
DEOD_MYXXD       LAVEMEVAGLYGVAAESGARALGLLTVSDHIITGESLTPQERQTTFDEMIELALDVAHAE
DEOD_HAHCH       KAVEMEAAGLYGVAAECGGKALALCTVSDHLLSGERLSPEERRTSFNDMVEIALEAAVGF
DEOD_PSEHT       LAVDMETAGLYGVAAEYGAKAMALFTVSDHVITGEATPADERQSTFNEMVKIALESI---
DEOD_COLP3       LAVEMEAAGLYGVAAEYGKKALTVLTVSDHIKTGEKTTSEERETTFKDMMELTLESVL--
DEOD_CHRVO       NVIEMELAGIYSVAAQYGARAVGILTVSDIIPTGEATSAEERQTSFRDMMEVALDAAIKL
DEOD2_VIBVY      LGVDMEAAGIYGVAADLKAKALTILTVSDHIIRGEKLSSEDRQKSFNDMMKVALETAINL
DEOD2_VIBVU      LGVDMEAAGIYGVAADLKAKALTILTVSDHIIRGEKLSSEDRQKSFNDMMKVALETAINL
DEOD2_VIBPA      LGVDMEAAGIYGVAADLGAKALTILTVSDHIIRGEKLSSEERQKSFNDMMKVALETAINI
DEOD2_ALIF1      LGVDMEAAGIYGVAADLGAKALTILTVSDHIKRGEKLSSEDRQKSFNDMMTVALETAIKL
DEOD2_VIBCH      LGVDMEAAGIYGVAADLGARALTILTVSDHILRGEKLSSEDRQKSFNDMMKVALETAINI
DEOD2_PHOPR      LGIDMEAAGIYGVAAELGAKALTILTVSDHIKRGEKLSSEDRQKSFGEMMNVALETAVNI
DEOD1_VIBVY      VGVEMEAAGIYGVAAEYGAKALTICTVSDHIKTGEQTTSEERQNTFNDMMIVALDSVLLG
DEOD1_VIBVU      VGVEMEAAGIYGVAAEYGAKALTICTVSDHIKTGEQTTSEERQNTFNDMMIVALDSVLLG
DEOD1_VIBPA      VGVEMEAAGIYGVAAEYGAKALTICTVSDHIKTGEQTTSDERQTTFNDMMLIALDSVLLG
DEOD1_VIBCH      VGVEMEAAGIYGVAAEYGAKALAICTVSDHIKTGEQTTSEERQNTFNEMIEIALDSVLIG
DEOD1_ALIF1      VGVEMEAAGMYGVAAEYGAKALAICTVSDHIKTGEQTTSDERATTFDEMMLIALDSVLLG
DEOD1_PHOPR      VGVEMEAAGIYGVAAEFGAKALTICTVSDHILRGEATTSEERQLTFNEMMEIALESVLLG
DEOD_ACTP2       LGVEMEAAGIYAVAAEYGAKALAICTVSDHIRTGEQTSSEERQLTFNDMITIALESVLIG
DEOD_ACTPL       LGVEMEAAGIYAVAAEYGAKALAICTVSDHIRTGEQTSSEERQLTFNDMITIALESVLIG
DEOD_HAEDU       LGVEMEAAGIYVVAAEYGVKSLAICTVSDHIRSGEKLSAEDRQLTFNEMIEIALESVLIG
DEOD_ACTSZ       LGVEMEAAGIYGVAAEFGAKALSICTVSDHIRSGEQTSSEERQTTFNEMIEIALESVLLG
DEOD_MANSM       LGVEMEAAGIYGVAAEFGAKALSICTVSDHIRTGEQTSSEERQLTFNDMIEIALESVLLG
DEOD_HAES1       LGVEMEAAGIYGVAAEFKAKALTICTVSDHIRTHEQTSAEERQLTFNEMIEIALESVLLG
DEOD_HISS2       LGVEMEAAGIYGVAAEFKAKALTICTVSDHIRTHEQTSAEERQLTFNEMIEIALESVLLE
DEOD_HAEIG       LGVEMEAAGIYGVAAEYGAKALTICTVSDHIRTHEQTTAEERQLTFNDMIEIALDSVLIG
DEOD_HAEIE       LGVEMEAAGIYGVAAEYSAKALTICTVSDHIRTHEQTTAEERQLTFNDMIEIALDSVLIG
DEOD_HAEIN       LGVEMEAAGIYGVAAEYGAKALTICTVSDHIRTHEQTTAEERQLTFNDMIEIALDSVLIG
DEOD_HAEI8       LGVEMEAAGIYGVAAEYGAKALTICTVSDHIRTHEQTTAEERQLTFNDMIEIALDSVLIG
DEOD_PASMU       LGVEMEAAGIYGVAAEFGAKALTICTVSDHIRTHEQTTPEERQLTFNDMIEIALESVLIG
DEOD_XENNA       LGVEMEAAGIYGVAAEFGAKALAICTVSDHIRTGEQTTAEERQHTFNDMIEIALESILLG
DEOD_PHOLL       LGVEMEAAGFYGVAAEYGAKALTICTVSDHIRTHEKLTAEERQTTFNEMIEIALESVLLG
DEOD_PECAS       LGVEMEAAGIYGVAAEFGAKALAICTVSDHIRTGAQTTSEERQTTFNEMIEIALESVLLG
DEOD_YERP3       LGVEMEAAGIYGVAAEFGAKALTICTVSDHIRTGEQTTAAERQTTFNDMIEIALESVLLG
DEOD_YERPS       LGVEMEAAGIYGVAAEFGAKALTICTVSDHIRTGEQTTAAERQTTFNDMIEIALESVLLG
DEOD_YERPN       LGVEMEAAGICGVAAEFGAKALTICTVSDHIRTGEQTTAAERQTTFNDMIEIALESVLLG
DEOD_YERPP       LGVEMEAAGICGVAAEFGAKALTICTVSDHIRTGEQTTAAERQTTFNDMIEIALESVLLG
DEOD_YERPA       LGVEMEAAGICGVAAEFGAKALTICTVSDHIRTGEQTTAAERQTTFNDMIEIALESVLLG
DEOD_YERPE       LGVEMEAAGICGVAAEFGAKALTICTVSDHIRTGEQTTAAERQTTFNDMIEIALESVLLG
DEOD_YERE8       LGVEMEAAGIYGVAAEFGAKALTICTVSDHIVSGEQTTAAERQTTFNDMIEIALESVLLG
DEOD_ECOL6       LGVEMEAAGIYGVAAEFGAKALTICTVSDHIRTHEQTTAAERQTTFNDMIKIALESVLLG
DEOD_ECOL5       LGVEMEAAGIYGVAAEFGAKALTICTVSDHIRTHEQTTAAERQTTFNDMIKIALESVLLG
DEOD_ECOLC       LGVEMEAAGIYGVAAEFGAKALTICTVSDHIRTHEQTTAAERQTTFNDMIKIALESVLLG
DEOD_SHIFL       LGVEMEAAGIYGVAAEFGAKALTICTVSDHIRTHEQTTAAERQTTFNDMIKIALESVLLG
DEOD_SHIF8       LGVEMEAAGIYGVAAEFGAKALTICTVSDHIRTHEQTTAAERQTTFNDMIKIALESVLLG
DEOD_SHIDS       LGVEMEAAGIYGVAAEFGAKALTICTVSDHIRTHEQTTAAERQTTFNDMIKIALESVLLG
DEOD_ECOHS       LGVEMEAAGIYGVAAEFGAKALTICTVSDHIRTHEQTTAAERQTTFNDMIKIALESVLLG
DEOD_ECO24       LGVEMEAAGIYGVAAEFGAKALTICTVSDHIRTHEQTTAAERQTTFNDMIKIALESVLLG
DEOD_SHISS       LGVEMEAAGIYGVAAEFGAKALTICTVSDHIRTHEQTTAAERQTTFNDMIKIALESVLLG
DEOD_SHIBS       LGVEMEAAGIYGVAAEFGAKALTICTVSDHIRTHEQTTAAERQTTFNDMIKIALESVLLG
DEOD_ECO57       LGVEMEAAGIYGVAAEFGAKALTICTVSDHIRTHEQTTAAERQTTFNDMIKIALESVLLG
DEOD_ECOLI       LGVEMEAAGIYGVAAEFGAKALTICTVSDHIRTHEQTTAAERQTTFNDMIKIALESVLLG
DEOD_SALPA       LGVEMEAAGIYGVAAEFGAKALTICTVSDHIRTHEQTTAAERQTTFNDMIKIALESVLLG
DEOD_SALTI       LGVEMEAAGIYGVAAEFGAKALTICTVSDHIRTHEQTTAAERQTTFNDMIKIALESVLLG
DEOD_SALTY       LGVEMEAAGIYGVAAEFGAKALTICTVSDHIRTHEQTTAAERQTTFNDMIKIALESVLLG
DEOD_SALPB       LGVEMEAAGIYGVAAEFGAKALTICTVSDHIRTHEQTTAAERQTTFNDMIKIALESVLLG
DEOD_SALCH       LGVEMEAAGIYGVAAEFGAKALTICTVSDHIRTHEQTTAAERQTTFNDMIKIALESVLLG
DEOD_SALAR       LGVEMEAAGIYGVAAEFGAKALTICTVSDHIRTHEQTTAAERQTTFNDMIKIALESVLLG
DEOD_CITK8       LGVEMEAAGIYGVAAEFGAKALTICTVSDHIRTHEQTTAAERQTTFNDMIKIALESVLLG
DEOD_ENT38       LGVEMEAAGIYGVAAEFGAKALTICTVSDHIRTHEQTSAAERQTTFNDMIKIALESVLLG
DEOD_CROS8       LGVEMEAAGIYGVAAEFGAKALTICTVSDHIRTHEQTTAAERQTTFNDMIKIALESVLLG
DEOD_KLEPN       LGVEMEAAGIYGVAAEFGAKALTICTVSDHIRTHEQTIAAERQTTFNDMIKIALESVLLR
DEOD_SHEDO       LGVEMEAAGLYGVAHELGAKALCVVTVSDHIRTGEKTTSDERQTTFNDMIIMTLDAAITL
DEOD_SHEFN       LGVEMEAAGLYGVAHELGAKALCVVTVSDHIRTGEKTTSDERQTTFSDMIIMTLDAALTL
DEOD_SHESM       LGVEMEAAGLYGVAHEFGARALCVVTVSDHIRTGEKTTSDERQTTFNDMIVMTLDAAITL
DEOD_SHESR       LGVEMEAAGLYGVAHEFGARALCVVTVSDHIRTGEKTTSDERQTTFNDMIVMTLDAAITL
DEOD2_SHEON      LGVEMEAAGLYGVAHEFGARALCVVTVSDHIRTGEKTTSEERQTTFNDMIVMTLDAAITL
DEOD_SHEB5       LGVEMEAAGLYGVAHEFGARALCVVTVSDHIRTGEKTSAEERQTTFNDMIIMTLEAAITL
DEOD_SHEB8       LGVEMEAAGLYGVAHEFGARALCVVTVSDHIRTGEKTSAEERQTTFNDMIIMTLEAAITL
DEOD_SHEAM       LGVEMEAAGLYGVAHEFGARALCVVTVSDHIRTGEKTTSDERQTTFNDMIIMTLDAAINL
DEOD_SHELP       LGVEMEAAGLYGVAKEFGAKALCVVTVSDHIRTGEKTSSDERQTTFNEMIEMTLEAAITL
DEOD_PSYIN       LGVEMEAAGLYGVAAEEGKNALCILTVSDHIRTGEKTTSDERQSSFNEMLIIALDSIVAE
DEOD_DICNV       LGVEMEAAGLFGVAAEYGARAGCILTVSDHILRQETTTALERQTRFHDMITIALEAAVRL
DEOD1_SHEON      LGVEMEVNALYALAAEHQCRALALCTVTDHIVQHEHLTADERRTDLHEMVKVALETAIKI
DEOD3_ALIF1      LGVEMEVNALYSAAAENHCNAVALCTVTDHIKNHEHLTADERRTELHEMINVALDVALKL
DEOD_MYCGE       LAVEMEAHALYANAILLKKKALTLLTVSDSLVTHEALSSELRQKSFKQMALLALEMTQKL
DEOD_MYCPN       LAVEMEAHALYANAMLLNKQALTMLTVSDSLVTHAALPAEQRQATFKNMAILSLEMASQL
                   ::**   :   .         : :::*            *   :  *  : *.     

DEOD_HELPH       -----
DEOD_HELPY       -----
DEOD_HELPJ       -----
DEOD_BUCAI       -----
DEOD_BUCAP       -----
DEOD_BUCBP       KV---
DEOD_BACC1       -----
DEOD_BACAH       -----
DEOD_BACHK       -----
DEOD_BACAN       -----
DEOD_BACCR       -----
DEOD_BACCE       -----
DEOD_BACCZ       -----
DEOD_BACCN       -----
DEOD_GEOTN       DA---
DEOD_GEOKA       GA---
DEOD_GEOSE       -----
DEOD_OCEIH       -----
DEOD_LISW6       -----
DEOD_LISIN       -----
DEOD_LISMO       -----
DEOD_LISMF       -----
DEOD_BACSU       -----
DEOD_BACVZ       -----
DEOD_BACLD       -----
DEOD_CALS4       -----
DEOD_ALKMQ       -----
DEOD_CLOPS       -----
DEOD_CLOP1       -----
DEOD_CLOB8       EN---
DEOD_CLOTE       -----
DEOD_CLONN       -----
DEOD_TREPA       -----
DEOD_LACLM       -----
DEOD_LACLS       -----
DEOD_LACLA       -----
DEOD3_SHEON      -----
DEOD_MYXXD       PTP--
DEOD_HAHCH       -----
DEOD_PSEHT       -----
DEOD_COLP3       -----
DEOD_CHRVO       -----
DEOD2_VIBVY      -----
DEOD2_VIBVU      -----
DEOD2_VIBPA      -----
DEOD2_ALIF1      -----
DEOD2_VIBCH      -----
DEOD2_PHOPR      -----
DEOD1_VIBVY      DAE--
DEOD1_VIBVU      DAE--
DEOD1_VIBPA      DAE--
DEOD1_VIBCH      DQAGY
DEOD1_ALIF1      DK---
DEOD1_PHOPR      DADEA
DEOD_ACTP2       DKAE-
DEOD_ACTPL       DKAE-
DEOD_HAEDU       DQT--
DEOD_ACTSZ       DND--
DEOD_MANSM       DQA--
DEOD_HAES1       DSL--
DEOD_HISS2       DSL--
DEOD_HAEIG       DAQ--
DEOD_HAEIE       DAQ--
DEOD_HAEIN       DAL--
DEOD_HAEI8       DAL--
DEOD_PASMU       DNA--
DEOD_XENNA       DN---
DEOD_PHOLL       DK---
DEOD_PECAS       DNE--
DEOD_YERP3       DNA--
DEOD_YERPS       DNA--
DEOD_YERPN       DNA--
DEOD_YERPP       DNA--
DEOD_YERPA       DNA--
DEOD_YERPE       DNA--
DEOD_YERE8       DKESY
DEOD_ECOL6       DKE--
DEOD_ECOL5       DKE--
DEOD_ECOLC       DKE--
DEOD_SHIFL       DKE--
DEOD_SHIF8       DKE--
DEOD_SHIDS       NKE--
DEOD_ECOHS       DKE--
DEOD_ECO24       DKE--
DEOD_SHISS       DKE--
DEOD_SHIBS       DKE--
DEOD_ECO57       DKE--
DEOD_ECOLI       DKE--
DEOD_SALPA       DKE--
DEOD_SALTI       DKE--
DEOD_SALTY       DKE--
DEOD_SALPB       DQE--
DEOD_SALCH       DQE--
DEOD_SALAR       DKE--
DEOD_CITK8       DKA--
DEOD_ENT38       DKE--
DEOD_CROS8       DKE--
DEOD_KLEPN       DKE--
DEOD_SHEDO       -----
DEOD_SHEFN       -----
DEOD_SHESM       -----
DEOD_SHESR       -----
DEOD2_SHEON      -----
DEOD_SHEB5       -----
DEOD_SHEB8       -----
DEOD_SHEAM       -----
DEOD_SHELP       -----
DEOD_PSYIN       -----
DEOD_DICNV       AH---
DEOD1_SHEON      -----
DEOD3_ALIF1      PTE--
DEOD_MYCGE       I----
DEOD_MYCPN       V----