CLUSTAL format seed alignment for MF_01628

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

Q2CGX3_OCEGH          ------------------------MEARAIIRKLREGETPGADELAWFAAGLASGAVSDA
Q161B1_ROSDO          -----------------------MADARSVLARLRHGAALTTTDMQWVAQALADHGMSDA
Q3J645_RHOS4          ------------------------MDARSINAKLRRGEVPSAAELGWFAEGLASGHVTDA
S5YWI4_PARAH          -----------------------MSDPRGVIAALRDGQGLDASGAALIARGLAEGTLSDA
TYPH_RHIME            ----------------------MAMLPQEIIRKKRDGDRLDPAEIAGFIAGVTDGSVSEG
TYPH_SINFN            ----------------------MALLPQEVIRKKRDGGRLDRAEIADFVSGLADGSISEG
Q2KDR8_RHIEC          ------------------------MIPQEIIRRKRDGEELDAADISSFIAALAAGQLSEG
TYPH_RHILO            ------------------------MLPQEIIRHKRDGHRLSAGEIAAFIGGVTSGAVTDG
A9CVM2_HOEPD          ------------------------MLPQEIVRTKRDGGELDREQIAAFITGLTDGSVSEG
TYPH_COLP3            ------------------MSVTAKIIPQEIIRLKRDGKILDEQAINGFVSGLVDGNFSDS
TYPH_ECOLI            -----------------------MFLAQEIIRKKRDGHALSDEEIRFFINGIRDNTISEG
TYPH_SALTY            -----------------------MFLAQEIIRKKRDGHALSDEEIRFFINGIRDNTISEG
TYPH_YERPE            -----------------------MFLAQEIIRKKRDGQPLSEEEIRFFINGIRDNVVSEG
TYPH_PECAS            -----------------------MFLIQEIIRKKRDGKTLSEEEIRFFINGIRDNTVSEG
TYPH_ALIF1            -----------------------MYLPQEIIRKKRDNKELTAEEINFFIQGVAKETVSEG
TYPH_PHOPR            -----------------------MYLPQEIIRKKRDNVELTADEINFFIQGIAKETMSEG
TYPH_VIBPA            -----------------------MYLPQEIIRKKRDGEVLTADEINFFIQGVANNTVSEG
TYPH_VIBVY            -----------------------MYLPQEIIRKKRDGEALTADEINFFIQGVANNTVSEG
TYPH_VIBCH            -----------------MSLSQAKYLPQEIIRRKRDGEVLTNDEINFFIQGVANNTVSEG
TYPH_SHEON            -----------------------MFLAQEIIRKKRNGLVLSAEEIQFFVKGITTNAVSEG
TYPH_CHRVO            -----------------------MFLPQEIIRKKRDNLTLSQQEIQQFVAGITDNSVADS
TYPH_IDILO            -----------------------MFLAQEVIRKKRDAVSLSDTDIQQFVNGICDDSVSEG
TYPH_BURPS            ----------------------MTFLPQEFIRKVRDRAPLDTADVARFVQGVTAGDVTEG
TYPH_BURCJ            -----------------------MFLPQEFIRRKRDGQPLDRDGMAAFVRGVTDGSVTEG
F0JBQ5_DESDE          ----------------------MTFIPQEIIRRKRDGLALDRADIRAMVRGITDGSASEG
E6VZ74_PSEA9          ------------------------MLPQEIIRAKRDGRPLSDEEITQFVAGMTDGTITEG
A5EY73_DICNV          ---------------------MTTYLPQEIIRKKRDKQPLSSEEIGFFVNEISQNRISEA
A9G2A4_SORC5          -----------------------MQTLVELVAKKRDGGRLSEDEIARIIRALSDGELADY
A0A0F6W2F7_9DELT      MQSRANAKKKTTKKSKPVAAEQPLPTVPELIVRKREGGRLSAREIQHLIEGFTAGTVADY
                                                   .    *            .   .     :: 

Q2CGX3_OCEGH          QAGAFAMAVCLNGMTDEGRIGLTLAMRDSGDVLGWD---LPGPVLDKHSTGGVGDCVSLV
Q161B1_ROSDO          QAGAFAMGICARGLRDPERVALTLAMRDSGKVLRWD---MPGPVLDKHSTGGVGDCISLV
Q3J645_RHOS4          QAGAFAMAVCLQGLGEEGRVALTRAMRDSGRVLAWD---LPGPVLDKHSTGGIGDCTSLL
S5YWI4_PARAH          QAGAFAMAVLLRGTGRAGRIALTEAMRDSGRVLRWD---LPGPVLDKHSTGGIGDTVSLI
TYPH_RHIME            QAAAFAMAVWFSGMNRDECVALTLAMRDSGETLDWS--DLARPIVDKHSTGGVGDNVSLM
TYPH_SINFN            QVAAFAMATWFSGMNRDECVALTLAMRDSGDILDWS--EFGRPIVDKHSTGGVGDNVSLM
Q2KDR8_RHIEC          QIGAFAMAVWFKGMSREEIVALTLAMANSGDRLQWA--GIDRPIADKHSTGGVGDNVSLM
TYPH_RHILO            QAAAFAMAVFFNGMNRDEAVALTLAMRDSGDVLDWS--DLPGPVTDKHSTGGVGDNVSLM
A9CVM2_HOEPD          QVAALAMAVFFNGMTRAEAVALTLAMRDSGEVLSWP--ELDRPVVDKHSTGGVGDNVSLM
TYPH_COLP3            QVGAMAMAIFQQGMSIDERVNFTKAMMRSGEVLSWE--GFDGPIVDKHSTGGVGDKVSFM
TYPH_ECOLI            QIAALAMTIFFHDMTMPERVSLTMAMRDSGTVLDWKSLHLNGPIVDKHSTGGVGDVTSLM
TYPH_SALTY            QIAALAMTIFFHDMTMPERVSLTMAMRDSGTVLDWKSLNLNGPIVDKHSTGGVGDVTSLM
TYPH_YERPE            QIAALAMTIYFHDMSMPERVALTMAMRDSGTVLNWKSLNLNGPLVDKHSTGGVGDVTSLM
TYPH_PECAS            QIAALAMTIYFHDMSMDERVALTLAMRDSGTVLNWKSLNLNGPLVDKHSTGGVGDVTSLM
TYPH_ALIF1            QIAAFAMAVYFNEMTMPERIALTCAMRDSGMVIDWSHMNFDGPIVDKHSTGGVGDVTSLM
TYPH_PHOPR            QIAAFAMAIYFNDMTMDERVALTCAMRDSGMVIDWSHMNFDGPIVDKHSTGGVGDVTSLM
TYPH_VIBPA            QIAAFAMTIFFNEMTMDERIALTCAMRDSGMVIDWSHMNFGGPIVDKHSTGGVGDVTSLM
TYPH_VIBVY            QIAAFAMTIFFNEMTMPERIALTCAMRDSGMVIDWSHMNFGGPIVDKHSTGGVGDVTSLM
TYPH_VIBCH            QIAAFAMAIFFREMTMPERIALTCAMRDSGMVIDWSHMNFDGPIVDKHSTGGVGDVTSLM
TYPH_SHEON            QIAALGMAVYFNDMNMDERIALTTAMRDSGTVLNWQSLNLNGPVIDKHSTGGVGDVISLM
TYPH_CHRVO            QIAALAMAIYFNGMELEENVHLALAMRDSGRRMHWKDLNLPGPIVDKHSTGGVGDVVSLM
TYPH_IDILO            QIAALAMAIYFRGMSAQEKTALTVAMRDSGDVLDWRQDNLNGPVLDKHSTGGVGDVVSLM
TYPH_BURPS            QIAAFAMAVYFNELPLSARIALTLAQRDSGDVLDWRGARLNGPVVDKHSTGGVGDLTSLV
TYPH_BURCJ            QVAAFAMAVYFNDLSTDERVALTLAQRDSGDVLDWRALDLDGPVIDKHSTGGVGDVVSLM
F0JBQ5_DESDE          QVAAFAMAVFFRGMTLRERIDLTEAMRDSGRVLDWPGMGLERGVVDKHSTGGVGDKVSLI
E6VZ74_PSEA9          QVAALGMAVYFQGMTGRESAALTLAMARSGAMLSW---DVDGPVLDKHSSGGVGDLVSLA
A5EY73_DICNV          QIAAFCMAVFFNGLTIDEQTALTLSMRDSGQCLRWQ---TTTPIVDKHSTGGIGDNVSLI
A9G2A4_SORC5          QMAALLMAIFFRGMDDAETVALTRAMLHSGDVLDLS--GVPGRKVDKHSTGGVGDKVSIC
A0A0F6W2F7_9DELT      QMSALAMAILLRGMDPDEIVALTLAMRDSGLVVDTS--DIPAVKVDKHSTGGVGDKVSLC
                      * .*: *              :: :   **  :            ****:**:**  *: 

Q2CGX3_OCEGH          LAPALAACGVFVPMISGRGLGHTGGTLDKLEAIPGLVTQVDADTLRRVTRAAGCAIVGAT
Q161B1_ROSDO          LAPALAACGAYVPMISGRGLGHTGGTLDKLEAIPGLVTQLDEGRFRAVVAEAGCAIVGAS
Q3J645_RHOS4          LAPALAACGAYVPMISGRGLGHTGGTLDKLEAIPGFRVALGEERLRAQIEDVRCAIVAAD
S5YWI4_PARAH          LAPVLAAAGAFVPMISGRGLGHTGGTLDKLEAIPGCRVDLDEAALRRITAEVGTAIVAAS
TYPH_RHIME            LAPIVAACGAAVPMISGRGLGHTGGTLDKLESIPGYDIQPSPELFRRVADEVGCAIIGQT
TYPH_SINFN            LAPIVAACGPNVPMISGRGLGHTGGTLDKLESIPGYNIQPSPELFRQIVDEVGCAIIGQT
Q2KDR8_RHIEC          LAPIVAACGLAVPMISGRGLGHTGGTLDKLESIPGYRINPDAELFGKVVKEAGCAIIGQT
TYPH_RHILO            LAPIVAACGAYVPMISGRGLGHTGGTLDKMDAIPGYISQPDIALFRQAVLETGCAIIGQT
A9CVM2_HOEPD          LAPIAAACGLAVPMISGRGLGHTGGTLDKMEAIPGYQAMPDNALFRKVVASAGCAIIGQT
TYPH_COLP3            LAAIVAACGGYVPMISGRGLGHTGGTADKLESIAGFNVQPSISEFKRIVKDVGVAIISQT
TYPH_ECOLI            LGPMVAACGGYIPMISGRGLGHTGGTLDKLESIPGFDIFPDDNRFREIIKDVGVAIIGQT
TYPH_SALTY            LGPMVAACGGYVPMISGRGLGHTGGTLDKLEAIPGFDIFPDDNRFREIIQDVGVAIIGQT
TYPH_YERPE            LGPMVAACGGYVPMISGRGLGHTGGTLDKLEAIPGFDIFPDDNAFRKIIQNVGVAIIGQT
TYPH_PECAS            LGPMVAACGGYVPMISGRGLGHTGGTLDKLEAIPGLDIFPNDDHFRRIIQQVGVAIIGQT
TYPH_ALIF1            LGPMVAACGGYVPMISGRGLGHTGGTLDKLESIAGYNITPSNDVFGKVTKEAGVAIIGQT
TYPH_PHOPR            LGPMVAACGGFVPMISGRGLGHTGGTLDKLESIPGYNITPTNDVFGQVTKDAGVAIIGQT
TYPH_VIBPA            LGPMVAACGGFVPMISGRGLGHTGGTLDKLEAIPGYNITPTNEVFGQVTKDAGVAIIGQT
TYPH_VIBVY            LGPMVAACGGFVPMISGRGLGHTGGTLDKLEAIPGYNITPSNDVFGQVTKEAGVAIIGQT
TYPH_VIBCH            LGPMVAACGGYVPMISGRGLGHTGGTLDKLEAIPGYNITPTNDVFGKVTKQAGVAIIGQT
TYPH_SHEON            LGPMAAACGGYVPMISGRGLGHTGGTLDKFDAIPGYQTEPSSELFRKVVKDVGVAIIGQT
TYPH_CHRVO            LGPMVAACGGFVPMISGRGLGHTGGTLDKLSAVPGYNPFPEPELFRKVVKDVGVAIIGQT
TYPH_IDILO            LGPIVAACGGYVPMISGRGLGHTGGTLDKFDAIPGYQTAPDNRRFRDTVKQAGVAIIGQT
TYPH_BURPS            IGPMVAACGGYVPMISGRGLGHTGGTLDKLEAIPGYDVAPSVDMLRRVVRDAGLAIVGQT
TYPH_BURCJ            LGPMVAACGGYVPMISGRGLGHTGGTLDKLSAIPGYDVMPATDAFRRTVREVGVAIIGQT
F0JBQ5_DESDE          LGPLAAACGAFVPMISGRGLGHTGGTLDKFDAIPGYDTAPDLETFARVVREAGCAIIGQT
E6VZ74_PSEA9          LGPMVAACGGYVPMVSGRGLGHTGGTLDKLESIPGYRTMPGREEFRRAVLGAGVAIIGQT
A5EY73_DICNV          LAPLLAACGVYVPMIAGRGLGHTGGTIDKLESIPHFEAFPSAARMQKIVQHIGCAIVGQT
A9G2A4_SORC5          LAPLVAACGVPVPMVSGRGLGHTGGTLDKLEAIPGFDVALDVDAFARIVREVGTCMIGQT
A0A0F6W2F7_9DELT      LAPMVAACGVAVPMVSGRGLGHTGGTLDKLEAIPGFSVSMSTEQFVAQVRDIGCALIGQT
                      :..  **.*  :**::********** **:.::.          :         .::.  

Q2CGX3_OCEGH          GRIAPADARLYAVRDVTATVESIDLITASILSKKLAAGLGGLVLDVKIGSGAFMKSPAEA
Q161B1_ROSDO          ADIAPADRRLYAVRDVTSTVDSLDLITASILSKKLAAGLEGLVLDVKIGSGAFMKDAQAA
Q3J645_RHOS4          EGMAPADRRLYLIRDVTGTVESIDLITASILSKKLAAGLEGLVLDVKVGSGAFMKSMDEA
S5YWI4_PARAH          GDLAPADRRLYAIRDESGTVESLDLITASILSKKLAAGLDGLVLDVKCGSGAFSRDLDTA
TYPH_RHIME            ADLAPADKRLYAIRDVTATVDSVPLITASILSKKLAAGLRSLVLDVKLGNGSFMTDPAET
TYPH_SINFN            ANLAPADKRLYAIRDVTATVDSVPLITASILSKKLAAGLQSLVLDVKLGNGSFMTDARAT
Q2KDR8_RHIEC          GTLAPADGRLYAVRDVTATVDSIPLITASILSKKLAAGLETLVLDVKLGNGAFMADRRQA
TYPH_RHILO            ADLAPADRRLYAIRDVTGTVESVPLITASILSKKLAAGLGSLVLDVKVGNGAFMERSRDA
A9CVM2_HOEPD          GNLAPADKRFYGIRDVTATVESVPLITASILSKKLAAGLGALVLDVKCGNGAFMDNPVRA
TYPH_COLP3            DNLAPADKRLYSIRDVTATVESIPLITASILSKKLAAGLDVLVMDVKVGNGAMMNNLDDA
TYPH_ECOLI            SSLAPADKRFYATRDITATVDSIPLITASILAKKLAEGLDALVMDVKVGSGAFMPTYELS
TYPH_SALTY            SSLAPADKRFYATRDITATVDSIPLITGSILAKKLAEGLDALVMDVKVGSGAFMPTYELS
TYPH_YERPE            SSLAPADKRFYATRDITATVDSIPLITASILAKKLAEGLDALVMDVKVGSGAFMPTYSLS
TYPH_PECAS            SSLAPADKRFYATRDITATVDSIPLITASILAKKLAEGLDALVMDVKVGSGAFMPTYELS
TYPH_ALIF1            GDLAPADKRVYATRDVTATVDNISLITASILSKKLAAGLDSLVMDVKVGSGAFMPTYEAS
TYPH_PHOPR            GDLAPADKRVYATRDVTATVDNISLITASILSKKLAAGLGSLVMDVKVGSGAFMPTYEAS
TYPH_VIBPA            GDLAPADKRVYATRDITATVDNISLITASILSKKLAAGLESLVMDVKVGSGAFMPTYEAS
TYPH_VIBVY            GDLAPADKRVYATRDITATVDNISLITASILSKKLAAGLESLVMDVKVGSGAFMPTYEAS
TYPH_VIBCH            GDLAPADKRVYATRDITATVDNISLITASILSKKLAAGLESLVMDVKVGSGAFMPTYEAS
TYPH_SHEON            GDLVPADKRFYSIRDNTATVESISLITASILSKKLACSLDALAMDVKVGSGAFMPTYEAS
TYPH_CHRVO            SDLAPADRRFYATRDVTATVESIALITASILSKKLAAGLDVLVMDVKAGSGAFMPTMQKS
TYPH_IDILO            GRLAPADSRFYATRDVTATVESIPLITASILAKKLAEGLDGLVMDVKAGNGAFMPGYDES
TYPH_BURPS            AQLAPADKRIYAVRDVTATVESISLITASILSKKLAAGVGALAMDVKVGSGAFMPSAEQS
TYPH_BURCJ            ARLAPADKRIYAIRDVTATVESVAMITASILSKKLAAGLDGLVMDVKVGSGAFMPTAEKS
F0JBQ5_DESDE          TDLAPADRRLYAVRDVTATVESVDLITASILSKKLAAGLQGLVMDVKFGSGAFMEDFADA
E6VZ74_PSEA9          DDLAPADRIFYAVRDVTATVESIPLITASILSKKLAAGLHGLVMDIKAGCGAFMPTFEQA
A5EY73_DICNV          DELAPADKRIYAVRDISATVESIALITASILSKKLAEGLDGLVMDIKVGNGAFMTDITQA
A9G2A4_SORC5          ARIAPADKRIYALRDVTATVESIPLIVASILSKKLAEGIDALVLDVKVGRGAFMKTLGDA
A0A0F6W2F7_9DELT      ADIAPADKRLYALRDVTGTVESIPLITASILSKKLAEGIDGLVLDVKVGRGAFMKSLADA
                        :.***  .*  ** :.**:.: :*..***:**** .:  *.:*:* * *::      :

Q2CGX3_OCEGH          TALAESLTGTANGAGCPTAALITDMNQPLAPALGNALEVAVSMEVLSGNRAAAPRLHDLT
Q161B1_ROSDO          RALAQALVSTANAAECKTTALISDMSQPLAPSLGNALEVAEVMRVLTG--AADGPLVELS
Q3J645_RHOS4          EALARALVGTAQGAGCMTSALITDMSQPLATAAGNALEVIEVMETLTGT-SINAALWDVT
S5YWI4_PARAH          RDLARALVETANGAGCKTMACITDMDQPLAPAAGNALEIRAVLEAFRTG---EGALCALA
TYPH_RHIME            EVLARSLVEVANGAGVRTSALITDMNEPLADAAGNALEIENCLAYLRGE-KAGTRLDQVV
TYPH_SINFN            KTLARSLVDVANGAGVNTLALITDMNEPLADAVGNALEVENCLAYLRGE-KSGTRLDQVV
Q2KDR8_RHIEC          EMLAHSLVEVANGAGVKTSALITDMNEPLADCAGNAVEMRNCLDFLAGR-KSGTRLETVV
TYPH_RHILO            TALANSLVEVASGAGLKVSALITGMNEPLASAAGNAVEVHNAVDFLTGR-LRDRRLEDVT
A9CVM2_HOEPD          AELARSLVEVATGAGMPTTALITDMNQPLASAAGNAVEVQNAADFLTGD-ARDPRLEAVT
TYPH_COLP3            KALAQSITSVANGAGVKTQAIITDMNQVLGTSAGNAIEMYETVKYLTGK-QREPRLHKIV
TYPH_ECOLI            EALAEAIVGVANGAGVRTTALLTDMNQVLASSAGNAVEVREAVQFLTGE-YRNPRLFDVT
TYPH_SALTY            EALAEAIVGVANGAGVRTTALLTDMNQVLASSAGNAVEVREAVQFLTGE-YRNPRLFDVT
TYPH_YERPE            ADLAQAIVGVANGAGCKTTALLTDMNQVLASSAGNGVEVREAVRFLTGE-YRNPRLLEVT
TYPH_PECAS            EQLAQAIVGVANNAGCRTSALLTDMNQVLASSAGNALEVREAVRFLTGE-SRNPRLYDVT
TYPH_ALIF1            EELAKSIVAVANGAGTKTTALLTDMNQVLASTAGNALEVREAIRFLTGE-YRNPRLYEVT
TYPH_PHOPR            EDLAKSIVAVANGAGTKTTALLTDMNQVLASTAGNALEVREAVQFLTGE-YRNPRLFEVT
TYPH_VIBPA            EELAKSIVAVANGAGTKTTAILTDMNQVLASSAGNAVEVREAVRFLTGE-YRNPRLLEVT
TYPH_VIBVY            EELAKSIVAVANGAGTKTTAILTDMNQVLASSAGNAVEVREAVRFLKGE-YRNPRLLEVT
TYPH_VIBCH            EELAKSIVAVANGAGTNTTAILTDMNQVLASSAGNAVEVREAVRFLTGE-YRNPRLLEVT
TYPH_SHEON            EELARSIAAVANGAGTKTTALLTDMNQVLASCAGNALEVKEAIDFLTGA-YRNPRLYAVT
TYPH_CHRVO            IELAERIVKVGNGAGVATTALITEMSQPLASTAGNSIETREAVRYLKGD-QRNPRLHEVT
TYPH_IDILO            RELAQSLVSVGRKLGVETTALITDMNQALGSAAGNAVEVQLAVDYLTGK-RRDKRLHQVT
TYPH_BURPS            AELARSIVDVGNGAGMRTAATLTDMNQALAPCAGNAIEVRCAIDFLTGA-ARPARLEAVS
TYPH_BURCJ            AELARSIVDVGNGAGMKTTAILTDMNQSLAPCAGNALEVACAIDYLTGK-SRPARLHDVT
F0JBQ5_DESDE          CALAESIVTVATGAGVPTTALLTDMNEVLGDCVGNAVEVREAVDFLTGV-RREPRLAEVT
E6VZ74_PSEA9          EALARSIVSVAAGAGLPTVALITSMDEPLAPCAGNAVEVREAVRYLTCA-ARDPRLHAVT
A5EY73_DICNV          RALAHNIVRVANAAGCQTSALLTDMNQPLAASIGNAVEVAEAVQFLRGD-DQNPRLKNVT
A9G2A4_SORC5          RALATALVRVGTAAGKRVSALLTDMSAPLGRTVGNAIETREAIEVLHGR--GPGDLVACT
A0A0F6W2F7_9DELT      RELASSLARVGGLAGKQVTAILTRMDAPLGRTIGNALETAEAFEILHGR--GPADLLEIT
                        **  :. ..      . * :: *.  *.   **.:*       :         *    

Q2CGX3_OCEGH          VALGGRLLALAGEAEG--EAEEKVADAIASGRAMAHFARMVAELGGPPDMESDWRTHLPA
Q161B1_ROSDO          VALGGVLLANAGSVNDVQAGADAIRAAIREGRAATQFGRMVAAMGGPVHFVENWQRFLPE
Q3J645_RHOS4          VALGGEALALGGLAADAEDGAHRIEQALESGHAAEFFARMVAAQGGPVDFVERWPDRLPS
S5YWI4_PARAH          LDLAGEGLTLAGIDPA------RASEAFASGRAAEIFGRMIAAQGGPCDLIERPDTYLGP
TYPH_RHIME            MALAAEMLVAAGIAAHEAEAEAMARRVLGSGEAMERFGLMVHRLGGPADFVDRPGAYLAK
TYPH_SINFN            MAFAAEMLVAARMAAHPAAGEAMARQALESGDAMERFALMVHRLGGPADFVDRSEAYLEK
Q2KDR8_RHIEC          FALVAEMLVKSGIAASSEEADAMARRALSSGQAAESFARMVSMLGGPADLVENSERYLAR
TYPH_RHILO            LALAAEMLQSTGLVSSNQDGLRRATETLTSGRAAATFARMVAVLGGPADFIEKPEKYLAV
A9CVM2_HOEPD          VALAAEMLVSGGLASDPEAGAVQARRALEQGYAAEHFNRMVAALGGPTDFLADPARHLAK
TYPH_COLP3            QALASAMLINTNLASSEKDAREKIDKVLNSGLAAEKFDRMVSALGGPKNFIEKPWDSMKK
TYPH_ECOLI            MALCVEMLISGKLAKDDAEARAKLQAVLDNGKAAEVFGRMVAAQKGPTDFVENYAKYLPT
TYPH_SALTY            MALCVEMLISGQLAKDDAEARAKLQAVLDNGKAAEVFGRMVAAQKGPSDFVENYDKYLPT
TYPH_YERPE            MALCVEMLLSGGLAHDEADARAKLQAVLDNGKAAEVFGRMVAAQKGPADFVERYDSYLPV
TYPH_PECAS            MALCGEMLLAGGLASSADDAHSRLQAVLDNGKAADVFGRMVAAQRGPGDFVEHYDRYLPV
TYPH_ALIF1            MALCAEMLVIANLAKDEQDARAKLQTVLDNGKAAECFGKMVFGLGGPSDIIENYDNHLES
TYPH_PHOPR            MALCAEMLVNSGLASDIEQAREQLQAVLDNGKAATCFGKMVAGLGGPVDFMENYDNYLEK
TYPH_VIBPA            MASCAEMLVLAKLAENTDDARAKLMEVLDNGKAAACFGKMVAGLGGPADFVENYDNYLEK
TYPH_VIBVY            MASCAEMLVLGKLAENTEDARAKLMEVLDNGKAAECFGKMVAGLGGPVDFMDNYDNYLDK
TYPH_VIBCH            MASCAEMLVLGKLAKDTAQAREKLQAVLDNGQAADRFGKMVAGLGGPSDFVENYDKYLAK
TYPH_SHEON            MGLCAEMLLLGGLATDEADARAKLNRVLDNGRAAEIFGKMVSGLGGPVDFVENYSKYLPQ
TYPH_CHRVO            MALCAQMLIGGKLAADEADARAKLQAALDSGRAAEIFGRMVTALGGPADFMEHYDRHLAP
TYPH_IDILO            KALSAELLVSGNLAKSTDQAEVMVENVLGSGLAAERFAKMVGSLGGPHDFLEKSDQYLPQ
TYPH_BURPS            FALAAQMLTMGGLAADAHDARRRLRAVLESGAAAERFARMVAALGGPADLVERPERHLPR
TYPH_BURCJ            MALSAELLVTGGLARDVGHAREKLQQALDSGAAAERFARMVVALGGPADLLDAPARHLAR
F0JBQ5_DESDE          LALTGEMLVLAGVVADPDAAARRMEQALASGAAAERFGRMVAGLGGPRDILERTDVYLPK
E6VZ74_PSEA9          MALGGRMLTLGGLAGDEAAARAMLERALDSGAAAERFSRMVAALGGPVDFIEACDRYLPR
A5EY73_DICNV          FTLAAEALRHAQLAPDQGAALKIVQKALDSGAAADRFDRMIAAQSGVQDFCQHYARLLPQ
A9G2A4_SORC5          LALGEEMLIAGGAAASAAEARPKLEAAIASGAAAEVLARMIAAQKGDPAVVQDAG-RLPS
A0A0F6W2F7_9DELT      LRLGAEMLRLGGVAKTNAQARKMLEASIADGSAAAKMREIVRAQGGDPRTVDEPE-RLPR
                             *                   : .* *   :  ::    *           :  

Q2CGX3_OCEGH          APVVGEVPAPVAG---HLAAIDGEALGLAVVGLGGGRQVETDKVDPAVGISDFAGLGARL
Q161B1_ROSDO          ATVIREVSALQSG---RIAAIDGEALGLAVVNLGGGRRIETDKIDRRVGLTQVVRLGAAV
Q3J645_RHOS4          APVMREVPSLRTG---FVLRIDTAALGQAVVHLGGGRLRETDRVNPSVGLADIAGIGEEV
S5YWI4_PARAH          APVVRAVEAGGAG---FVAAVDGTALGRAVVALGGGRVRASDRIDPRVGLSQLLRKGDQV
TYPH_RHIME            APAILAVPAGRHG---YLTSCKTRELGMAVIELGGGRIRPDDRIDHRVGLTGLRPLGTKV
TYPH_SINFN            APAVVIVPANRDG---YLAACETRELGMAVIALGGGRTRPDDRIDHRVGLAGLKPLGTKV
Q2KDR8_RHIEC          APVEKEVPAARSG---WLAACDARGVGISVIDLGGGRRHPADRIDHRVGFSGLLPLGTRV
TYPH_RHILO            APTEFAVRATTDG---FVTGIATRDIGLAVVGLGGGRTRPDDKIDPSVGITRLLPIGAEV
A9CVM2_HOEPD          APIVADCLAEAEG---FVTGYDTRGIGLAVVELGGGRVRPSDPVDHAVGLTDLLPVGTRL
TYPH_COLP3            ANVITEVRALQHG---YIAQTDTRAIGMSVVGLGGGRTAPTQQVDHSVGFDRILPLGVQV
TYPH_ECOLI            AMLTKAVYADTEG---FVSEMDTRALGMAVVAMGGGRRQASDTIDYSVGFTDMARLGDQV
TYPH_SALTY            AMLSKAVYADTEG---FISAMDTRALGMAVVSMGGGRRQASDTIDYSVGFTDMARLGDSI
TYPH_YERPE            ATLSKPVFAEQTG---IITAMDTRALGMAVVALGGGRRRATDPIDYSVGLTEMARLGTRV
TYPH_PECAS            ATLSKPVFATREG---VVTAMDTRALGMAVVSLGGGRRQASDTIDYSVGLDSMISLGERV
TYPH_ALIF1            AQIIKPVFADTTG---FVQAMDTRDLGMAVVGMGGGRRVASDTIDYAVGLSDMIRLGQTA
TYPH_PHOPR            AEIAKPVFAETTG---YAYAMDTRGLGMAVVGMGGGRRVASDSIDYAVGLSDMIRLGDEV
TYPH_VIBPA            AEIIKPVYATETG---IVSAMDTRAIGMAVVSMGGGRRVATDEIDYAVGFDNFIRLGEVA
TYPH_VIBVY            AEIIKPVYAKETG---VVSAMDTRAIGMAVVAMGGGRRVATDSIDYAVGFDQFIRLGEIA
TYPH_VIBCH            AEIIRPVYAQQSG---VISAMDTRAIGMAVVGMGGGRRVATDRIDYAVGFDQFIRLGEIA
TYPH_SHEON            SQIIRPVFADTQG---YAHSMDTRELGLAVVTLGGGRRKPGDELDYSVGLTQVCALGDKI
TYPH_CHRVO            APIMRPVYADRAG---YVGAMDTRGIGMAVCALGGGRRLATDVLDFRVGLSQFVELGQNI
TYPH_IDILO            ANLRKPLKLPAEYHGLYLSEVNTRELGMAVVCLGGGRRKADDKLDLSVGMTDILTVGSKV
TYPH_BURPS            AAAAAPVAAARAG---WIERIDARALGLAVVGLGGGRAKIGDTLDYSVGLSALAELGERV
TYPH_BURCJ            AVVIVPVPAPASG---VVQRVDCRALGLAVVALGGGRTRAEDAIDVSVGLSALAEIGQRV
F0JBQ5_DESDE          PPVARPVYPNRTG---FVAAMDSRAVGMTLVAMGGGRTRADQAIDHGVGMTGFARIGDPV
E6VZ74_PSEA9          ARTTLPVLATRGG---RLAAWDTRALGLAVVELGGGRTAAGQGVDHSVGLTDIARTGQCV
A5EY73_DICNV          AAVQKPLFAPHAG---TITAMNSREMGLAVIQLGGGRVRTDDRIDYCVGFSQILPIGSAV
A9G2A4_SORC5          APVVVEVAAQDEG---YVAAVDPLEIGLSAVALGAGRTRADQRVDPAVGIELAAVRGDRV
A0A0F6W2F7_9DELT      AAQIVDVHAPKSG---WVLGIDALELGLTGVAIGAGRTRADQAVDPAVGIVIKTHVGEKA
                      .                        :* :   :*.**    : ::  **:      *   

Q2CGX3_OCEGH          ERGAPICTLHARDEESAERAAHAILAAVTIGETAA-EP-PPLVHARIDP---------
Q161B1_ROSDO          RKGQPLAVVHASRPDDADRAVAAVRAAISLTDSAT-VAVPDLIHERVG----------
Q3J645_RHOS4          SEDLPLAMIHAATEADADAAVAAIQAAYVISDQEP-AE-PPLIHARIA----------
S5YWI4_PARAH          STGAPLALVHARSEAEAEAAAAQVRAAYVIGEAPA-QG--PLILERILA---------
TYPH_RHIME            EKGEPIAFVHAADQSQAEAIAKRVVTLYAIADEEP-ARR-PVIVSKLRAG--------
TYPH_SINFN            ERGEPIAFVHAADRQQAEAVRDRIAGFYAIADERP-ASR-PVIVSRIT----------
Q2KDR8_RHIEC          NAGDPIAVVHAADEAAAEKAAAALAVHYRIAADRP-ELA-PVIAGLV-----------
TYPH_RHILO            HAGDALALVHARSPADAEAAAATVVSAYAIGASKP-AAD-KTVMRRILPRG-------
A9CVM2_HOEPD          EKNRPIARIHARTPDQVEQVQAQLKRAIRIGADLP-QLD-PVIVGREV----------
TYPH_COLP3            NRGEVIARLHAKDEDSANRAIEQFNNAITYSEESP-ELP-PVIY--------------
TYPH_ECOLI            DGQRPLAVIHAKDENNWQEAAKAVKAAIKLADKAP--ESTPTVYRRISE---------
TYPH_SALTY            DGQRPLAVIHAKDEASWQEAAKAVKAAIILDDKAP--ASTPSVYRRITE---------
TYPH_YERPE            DGQQPLAVIHANNEDDWQQEAEVVRAAITLGNNTP--EETPVIYRRITE---------
TYPH_PECAS            DAQRPLAVIHANTEAQWQQAANEVRAAIQLGDTAP--EKTPMVYRRVSAEA-------
TYPH_ALIF1            DNQQPLAMIHARNEEQWQQAANAVKAAIVISEKQP--EATPEVYRKIRPEDV------
TYPH_PHOPR            NTDTALCVIHARSEAQWQEAANAVRANITIADEKP--APTPDVYRRIRAEDI------
TYPH_VIBPA            DSDKPLAVIHARSEGQWEEAAKALRSAIKVGGEY---TPTPEVYRQIRAEDI------
TYPH_VIBVY            SSEKPLAMIHARNEAQWQEAANALQAAIKVGGEY---TPTPDVYRQIRQEDI------
TYPH_VIBCH            DSNKPLAMIHARNEEQWQQAANALQSAIKVGGDY---LPTPDVYRQIRAQDV------
TYPH_SHEON            DASTPIAVIHAQSEEAFAQAEDAVKKAIHIDEIAP--EKTPEIYAYIRATDL------
TYPH_CHRVO            GKDTPLMMIHAADEASFEDAARRVKAAIRIDEAAP--SELPLVYQIIRGE--------
TYPH_IDILO            DSESVIATVHASNESDWQEAADSILKALSFSSTPP--EPDSVIYERIAGETE------
TYPH_BURPS            EAGQPLATVHARDADSAAQATDAVRRAYRIGAEPP--AQTRVVHAVIE----------
TYPH_BURCJ            EAGEPLGFVHARDEATAAHAADAIRRGYVLGDTGE--APPTLYQRVD-----------
F0JBQ5_DESDE          APDIPLCVVHARDTAQADMAAERIRRAVTISDAPP--APRPVVRRRITAREEPAQETN
E6VZ74_PSEA9          RAKDVLAVVHAASPAMAEAVRDRVLAAAVIDPMSEEGAPQDPVSVVLGCCE-------
A5EY73_DICNV          DEHTPLVMIHARDEYSWQRAANAYLAAVTIDDAVV--APLNCVYEIVRAENISS----
A9G2A4_SORC5          DRGAPLARIHARRADDARAAADRVRAAFRLGPAPA--EAPALVLERIEA---------
A0A0F6W2F7_9DELT      KKGEALAELHLAAGVDPDPIAQRVAAAWTFGTKKP--RAKPAVLDIIRS---------
                           :  :*