CLUSTAL format seed alignment for MF_01629

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

PDXH_AERHH       -------------------------MDVADLRREYTRGGLHRAD--------LPA----E
PDXH_AERS4       -------------------------MDVADLRREYTRGGLHRAD--------LPA----D
PDXH_ECOK1       -------------MSDND-----ELQQIAHLRREYTKGGLRRRD--------LPA----D
PDXH_ECOL6       -------------MSDND-----ELQQIAHLRREYTKGGLRRRD--------LPA----D
PDXH_SHISS       -------------MSDND-----ELQQIAHLRREYTKGGLRRRD--------LPA----D
PDXH_SHIF8       -------------MSDND-----ELQQIAHLRREYTKGGLRRRD--------LPA----D
PDXH_SHIBS       -------------MSDND-----ELQQIAHLRREYTKGGLRRRD--------LPA----D
PDXH_SHIDS       -------------MSDND-----ELQQIAHLRREYTKGGLRRRD--------LPA----D
PDXH_ECOLI       -------------MSDND-----ELQQIAHLRREYTKGGLRRRD--------LPA----D
PDXH_SHIFL       -------------MSDND-----ELQQIAHLRREYTKGGLRRRD--------LPA----D
PDXH_ECO57       -------------MSDND-----ELQQIAHLRREYTKGGLRRRD--------LPA----D
PDXH_SALCH       -------------MSDND-----QLQQIAHLRREYTKGGLRRRD--------LPA----E
PDXH_SALPA       -------------MSDND-----QLQQIAHLRREYTKGGLRRRD--------LPA----E
PDXH_SALTY       -------------MSDND-----QLQQIAHLRREYTKGGLRRRD--------LPA----E
PDXH_SALTI       -------------MSDNN-----QLQQIAHLRREYTKGGLRRRD--------LPA----E
PDXH_PECAS       ---------MTQERSPSDGTPLIQPADIADIRREYTRGGLRRGD--------LPA----N
PDXH_YERPE       -------------MTENN------EFDVADLRREYIRGGLRRSD--------LTE----N
PDXH_YERPS       -------------MTENN------EFDVADLRREYIRGGLRRSD--------LTE----N
PDXH_YERE8       -------------MTDNN------EFDVADLRREYIRGGLRRSD--------LTE----N
PDXH_PHOLL       -------------MSEHN------EFDVAELRREYIRGGLRRKD--------LTE----E
PDXH_VIBVU       -------------------------MELADIRREYTKGGLRRKD--------LKN----D
PDXH_VIBVY       -------------------------MELADIRREYTKGGLRRKD--------LKN----D
PDXH_VIBPA       -------------------------MELADIRREYTKGGLRRKD--------LKA----D
PDXH_VIBCH       -------------------------MDLSDIRREYIHGGLRRKD--------LQA----N
PDXH_ALIF1       -------------------------MELEDIRRDYSLGGLRRAD--------LPQ----E
PDXH_PHOPR       -------------------------MDLSDIRREYTRGGLRRND--------LPD----E
PDXH_SHEDO       ------------------------MSDLSDIRREYTKGGLRRKD--------LPD----N
PDXH_SHEFN       ------------------------MSDLSDIRREYTQGGLRRAN--------LPV----N
PDXH_SHESA       ------------------------MTDLSDIRREYTKGGLRRAD--------LPQ----N
PDXH_SHESM       ------------------------MTDLSDIRREYTKGGLRRAD--------LPQ----N
PDXH_SHESR       ------------------------MTDLSDIRREYTKGGLRRAD--------LPQ----N
PDXH_SHEON       ------------------------MTDLSDIRREYTQGGLRRAD--------LPK----N
PDXH_SHESW       ------------------------MTDLSDIRREYAKGGLRRAD--------LPQ----N
PDXH_SHEAM       ------------------------MTDLSDIRREYTKGGLRRSE--------LPE----D
PDXH_SHELP       ------------------------MSNLSDIRREYTLGGLHREE--------LPD----N
PDXH_PSEA6       ------------------------MQPLSQIRREYSQGHLTEAS--------LLA----D
PDXH_PSET1       -------------------------MKLEDIRREYLQNALSEDN--------LLD----D
PDXH_BLOPB       --------------------MLIDKTNISNIRREYISGQLRHTD--------LTN----Q
PDXH_BLOFL       ---------------------MLELSKIHNLRREYISKQFRRSN--------LTK----N
PDXH_WIGBR       --------------------MNKILKKILLKNREYSIGSLRKNQ--------LMN----N
PDXH_IDILO       -------------------------MDLQAMRREYGLGSLHREQ--------LEA----D
PDXH_PROM3       ------------------MGAPSPDQDIAAIRRNYQRASLRRVD--------LDA----D
PDXH_PROMM       ------------------MGAPSPDQDIAAIRRNYQRASLRSVD--------LEA----D
PDXH_RUTMC       -----------------------MKIDLTSLRHEFTQSGLNRAD--------LSS----N
PDXH_MARN8       -------------------------MDIGDMRRDFESEGLDREH--------LNE----D
PDXH_PSYIN       ---------------------MSFISKIRCAFTLGQGVLIENEA--------LKET--ND
PDXH_COLP3       ---------------------MTLFEKLRCLFTFGQGVALPLPE--------LSSN--TT
PDXH_LEGPA       ---------------------MSKFRSLADIRRDYGELQLSEES--------AEN----D
PDXH_LEGPH       ---------------------MSKFRSLADIRRDYGELQLSEES--------AEN----D
PDXH_LEGPL       ---------------------MSKFRSLADIRRDYGELQLSEES--------AEN----D
PDXH_COXBU       ---------------------------------------MFRLD--------LLS----D
PDXH_STRAW       --------MTDRD-----PIHDP-----AAMREHYRLEGLDETE--------L----AAH
PDXH_STRCO       -----MGGVTDRDADSAVPTADPVPFDLASMRKQYRAEGLSETE--------L----AAT
PDXH_FRAAA       MASNPPSAASPRRTAVSPGADRPDGPDPAGQRQSYHAGRLEPEQ--------L----ATT
PDXH_THEFY       -----------------MDYSDP-----AELRESYDGAPLDPRG--------L----APQ
PDXH_ACIC1       ------------MRHGTHTGSNP----YAEAYVEVTAGGLAETD--------L----AAD
PDXH_MYCA1       --------------------------------MEYGSVEKDGSP--DLDVDWL----DDG
PDXH_MYCPA       ---------------MPGPADEH----LQRMRVEYGSVEKDGSP--DLDVDWL----DDG
PDXH_MYCLE       ---------------MAGPDDQH----LSGMRVEYGSVEKDGSP--DLDTDWL----YDG
PDXH_MYCSK       ---------------MKKADNEH----LARMRVEYGSVEKDGSA--DLDVDWL----ADG
PDXH_MYCSS       ---------------MKKADNEH----LARMRVEYGSVEKDGSA--DLDVDWL----ADG
PDXH_MYCSJ       ------------------------------MRVEYGSVEKDGSA--DLDVDWL----ADG
PDXH_MYCVP       -----------------MGTSDY----LARMRVEYGSVEKDGSS--DLDVDWLGPDPATG
PDXH_MYCBO       ---------MDDDAQMVAIDKDQ----LARMRGEYGP-EKDGCG--DLDFDWL----DDG
PDXH_MYCTU       ---------MDDDAQMVAIDKDQ----LARMRGEYGP-EKDGCG--DLDFDWL----DDG
PDXH_MYCBP       ---------MDDDAQMVAIDKDQ----LARMRGEYGP-EKDGCG--DLDFDWL----DDG
PDXH_NOCFA       -------------------MAAD----LAAMRVDYGGVPSGSGEDVDLDEAWL----AGG
PDXH_SACEN       ------------MSEANSTPTAT----LPSMRVSYEAGSLDEGS--------L----AGT
PDXH_NOCSJ       -----------------MGHLDL-----AALREEYARAGLDEAD--------L----APD
PDXH_ACIAC       -----------MHNRGMSSPSSPLSSSIADLRKSYERAELGEEA--------S----HAD
PDXH_ACISJ       ----------------MSH--SPLSSSIADLRKSYERAELSEDA--------S----HAD
PDXH_VEREI       -----------------------MNLSIAELRKSYGRAELNEDA--------A----HAD
PDXH_POLNA       ---------------------MSSPTSIADLRKSYERAELNEDA--------S----HAD
PDXH_METPP       -----------------------MRPDIADLRKSYEQGELDEAH--------S----AAD
PDXH_BURCH       ------------------------MTTLADLRINYSRASLDEAD--------A----APD
PDXH_BURCM       ------------------------MTTLADLRINYSRASLDEAD--------V----APD
PDXH_BURMA       ------------------------MTTLADLRTNYSRASLDAAD--------V----NPN
PDXH_BURPS       ------------------------MTTLADLRTNYSRASLDAAD--------V----NPN
PDXH_CUPNH       ------------------------MTQLADLRRSYVLGSLSETD--------V----APD
PDXH_CUPPJ       ------------------------MTQLADLRRTYVLGSLNESD--------V----AGD
PDXH1_RALSO      ------------------------MTSIADIRTDYARASLDIAD--------V----DPN
PDXH_BORBR       -------------------------MSVSDLRQSYEKGVLVEEQ--------A----AAS
PDXH_BORPA       -------------------------MSVSDLRQSYEKGVLVEEQ--------A----AAS
PDXH_BORPE       -------------------------MSVSDLRQSYEKGVLVEEQ--------A----AAS
PDXH_THEVB       ------------------------MTRIADLRRDYRRQRLLESD--------A----AED
PDXH_PSEAB       -----------------------MTQSLADMRREYTRDGLSEAN--------A----PSD
PDXH_PSEAE       -----------------------MTQSLADMRREYTRDGLSEAN--------A----PSD
PDXH_PSEE4       -----------------------MTQSLADMRRDYTRDGLAEAQ--------A----PGE
PDXH_PSEPK       -----------------------MTQSLADMRRDYTRDGLAEDQ--------A----PGE
PDXH_PSEF5       -----------------------MTQSLADMRRDYTRDGLSEAQ--------A----PAE
PDXH_PSE14       -----------------------MTQTLADMRRDYTRDGLTEAQ--------S----PDE
PDXH_PSEU2       -----------------------MTQTLADMRRDYTRDGLTEAQ--------S----PDE
PDXH_PSESM       -----------------------MTQTLADMRRDYTRDGLTEAQ--------S----PQE
PDXH_SYNY3       ----------------------MDGVSLADLRLNYTQGGLIEAE--------V----ADH
PDXH_NOSS1       -----------------------MDRTIADLRKDYTLEGLSEIE--------V----DPN
PDXH_ACTP2       -------------------------MDLHNIREDYSKQELSQAN--------C----HAD
PDXH_HAEDU       -------------------------MDLHNIRADYTKQQLSKKE--------C----DAN
PDXH_HAEIN       -------------------------MELHNIRDEYTKRVLSQHD--------C----HEN
PDXH_HAEI8       -------------------------MELHNIRDEYTKRVLSQHD--------C----HKN
PDXH_NEIMF       -------------------------MDLHNIREDYSKRELSEGD--------C----ADN
PDXH_NEIMA       -------------------------MDLHNIREDYSKRELSEGD--------C----ADN
PDXH_NEIMB       -------------------------MDLHNIREDYSKRELSEAD--------C----ADN
PDXH_NEIG1       -------------------------MDLHNIREDYSKRELSEAD--------C----ADN
PDXH_MANSM       ------------------------MIDLHNIRNEYSQQALSEKQ--------C----DDD
PDXH_CHRVO       -----------------------MSLNLADIRLEYSKKELSPED--------C----LPD
PDXH_BACFN       --MSTDHVSTHPDSPLHGNGIGSEAINLAAIRQEYTKGGLKEGD--------L----PDN
PDXH_BACFR       --MSTDHVSTHPDSPLHGNGIGSEAINLAAIRQEYTKGGLKEGD--------L----PDN
PDXH_BACTN       ------------------------MKNIADIRQEYTKSGLRESE--------L----PCD
PDXH_PORGI       -----------------------MDLHFENIRREYDKRSLSASD--------L----TPT
PDXH_LEPBJ       -----------------------MNSKISEIRKNYSLSSLDIGD--------I----GDD
PDXH_LEPBL       -----------------------MNSKISEIRKNYSLSSLDIGD--------I----GDD
PDXH_LEPIC       -----------------------MDPKISEIRKSYTLSSLEIED--------A----GSD
PDXH_LEPIN       -----------------------MDPKISEIRKSYTLSSLEIED--------A----GSD
PDXH_RHOBA       -------------------MSDFIPPAMDQMRKNYSLGGLHEND--------A----KSD
PDXH_GRAFK       -----------------------MEKDLANYRRSYEKGELLERD--------I----PDD
PDXH_ACIAD       --------------------MKDVIKDLSELRMSYEKGELHEAQ--------V----DTH
PDXH_DEIRA       ------------------------MTDLTSLRLSYTRAELRRED--------L----NPD
PDXH_PSYA2       -----------------------MNMDFTDQRLSYEKGQLDQQS--------V----PIS
PDXH_ALKEH       ---------------------------------------MQLLE---------------Q
PDXH_HALHL       -------------------------------MTEPGMDSDTIYQ---------------E
PDXH_XANAC       -----------------------------------MTD---LYA---------------E
PDXH_XANC5       -----------------------------------MTD---LYA---------------E
PDXH_XANOR       -----------------------------------MTD---LYA---------------E
PDXH_XANC8       -----------------------------------MTD---LYA---------------E
PDXH_XANCP       -----------------------------------MTD---LYA---------------E
PDXH_XYLFA       --------------------------MIFPCLFQSMLN---LYA---------------E
PDXH_XYLFT       --------------------------MIFPCLFQSMLN---LYA---------------E
PDXH_MYXXA       -------------MRTLTCVPDESTAKVHTCRAPFMLHRVMIPP---------------D
PDXH_BARHE       ---------------------------MGNTVQTDN--DFMQMQ---------------K
PDXH_BARQU       ---------------------------MSNKVQMDN--DFMQMQ---------------K
PDXH_BARBK       -------------------MLAKFESMMSNKVQTDD--DFTQTQ---------------N
PDXH_AGRFC       ---------------------------MSETGLTSS--DFTEEN---------------E
PDXH_RHIME       ---------------------------MTANELITG--DFTDAS---------------E
PDXH_RHILO       ---------------------------MSDTELTTS--DFTEAA---------------E
PDXH_BRUME       ---------------------------MEPVKMTNSSDDFTQSA---------------E
PDXH_BRUSU       ---------------------------MEPVKMTNSSDDFTQSA---------------E
PDXH_RHOPS       --------------------MSD-TSIQQQSQLTSG--DFTAAE---------------N
PDXH_RHOPA       --------------------MSD-PTIRPQSELTPG--DFTAAE---------------N
PDXH_RHOP5       --------------------MSDATSMKHPSGLTSG--DFTAAE---------------E
PDXH_BRADU       --------------------MTDTTSMKHQTPLTSG--DFTAAD---------------E
PDXH_NITWN       --------------------MNDTTDIKHTSQLTSG--DFTEAR---------------E
PDXH_MARMM       -------------MSDDKLIPATPDADAYAKTADANAAEIFDRD---------------E
PDXH2_RALSO      ----------------------MNATDMDTEAAFRNDHETIAGE---------------D
PDXH_CAUVC       -----------MSADPTLIPASPSEDDYVRQVREATPPPLLSEE---------------D
PDXH_CERS1       ----------------------------------MDRTGIFAGD---------------D
PDXH_RUEPO       ---------------------------------MSDRTGIFAGD---------------D
PDXH_JANSC       ---------------------------------MSERSGIFAGD---------------D
PDXH_PARDP       ---------------------------------MSDRGGIFAGD---------------D
PDXH_HYPNA       ----------------MTSSVIPPSPSAADYAAEGDRPLVPETD---------------N
PDXH_ERYLH       -------------------------MQSEESIMTDLATSEIPET---------------D
PDXH_GLUOX       --------------------------------MSDIPLIDL-KA---------------D
PDXH_GRABC       -------------------------MSMDSDAKSPFQTAELAFD---------------D
PDXH_ZYMMO       -----------------------------------------MTQ---------------D
PDXH_PELUB       ---------------------------MNQKNSLGLNKCFLDKI---------------D
PDXH_EHRRG       --------------------------------------MITKD-----------------
PDXH_EHRRW       --------------------------------------MITKD-----------------
PDXH_EHRCJ       --------------------------------------MIKRD-----------------
PDXH_WOLPM       ----------------MAVALIFATRARIKILFFDMIFSLEKD-----------------
PDXH_ANAMM       -------------------MIDFFEGVSWLIMPFSGVCVREADS---------------S
PDXH_BDEBA       ------------------------------------MFDINKD-----------------
                                                                             

PDXH_AERHH       PLALFEKWLAQACE---AK-LTDPTAMVVGTVDAD---GQPWQRTVLLKHYDAE-----G
PDXH_AERS4       PLALFEKWLAQACE---AK-LTDPTAMVVATVDAE---GQPWQRTVLLKHYDAQ-----G
PDXH_ECOK1       PLTLFERWLSQACE---AK-LADPTAMVVATVDEH---DQPYQRIVLLKHYDEK-----G
PDXH_ECOL6       PLTLFERWLSQACE---AK-LADPTAMVVATVDEH---DQPYQRIVLLKHYDEK-----G
PDXH_SHISS       PLTLFERWLSQACE---AK-LADPTAMVVATVDEH---AQPYQRIVLLKHYDEK-----G
PDXH_SHIF8       PLTLFERWLSQACE---AK-LADPTAMVVATVDEH---GQPYQRIVLLKHYDEK-----G
PDXH_SHIBS       PLTLFERWLSQACE---AK-LADPTAMVVATVDEH---GQPYQRIVLLKHYDEK-----G
PDXH_SHIDS       PLTLFERWLSQACE---AK-LADPTAMVVATVDEH---GQPYQRIVLLKHYDEK-----G
PDXH_ECOLI       PLTLFERWLSQACE---AK-LADPTAMVVATVDEH---GQPYQRIVLLKHYDEK-----G
PDXH_SHIFL       PLTLFERWLSQACE---AK-LADPTAMVVATVDEH---GQPYQRIVLLKHYDEK-----G
PDXH_ECO57       PLTLFERWLSQACE---AK-LADPTAMVVATVDEH---GQPYQRIVLLKHYDEK-----G
PDXH_SALCH       PLTLFERWLGQACD---AR-LADPTAMVVATVDDK---GQPYQRIVLLKHYDEK-----G
PDXH_SALPA       PLTLFERWLGQACD---AR-LADPTAMVVATVDDK---GQPYQRIVLLKHYDEK-----G
PDXH_SALTY       PLTLFERWLGQACD---AR-LADPTAMVVATVDDK---GQPYQRIVLLKHYDEK-----G
PDXH_SALTI       PLTLFERWLGQACD---AR-LADPTAMVVATVDDK---GQPYQRIVLLKHYDEK-----G
PDXH_PECAS       PLDLFERWLKQACE---AK-LADPTAMSVATVDER---GQPYQRIVLLKHYDEK-----G
PDXH_YERPE       PLELFERWLKQACE---AR-LPDPTAMCVATVDTN---GQPYQRIVLLKHYDDQ-----G
PDXH_YERPS       PLELFERWLKQACE---AR-LPDPTAMCVATVDTN---GQPYQRIVLLKHYDDQ-----G
PDXH_YERE8       PLELFERWLKQACD---AR-LPDPTAMCVATVDAN---GQPYQRIVLLKHYDDQ-----G
PDXH_PHOLL       PIELFERWLNQACN---AK-LSDPTAMSIATVDEN---GQPYQRIVLLKHFDSN-----S
PDXH_VIBVU       PIDQFNFWLEQAIK---AN-LSDPTAMTVATVDKD---GMPFQRIVLLKNVDKD-----G
PDXH_VIBVY       PIDQFNFWLEQAIK---AN-LSDPTAMTVATVDKD---GMPFQRIVLLKNVDKD-----G
PDXH_VIBPA       PIDQFNLWLEQAIK---AG-LTDPTAMTVATVDEN---GMPFQRIVLLKNVDKD-----G
PDXH_VIBCH       PIDQFNLWLQQAID---AN-LSDPTAMTVATVDEH---GQPFQRIVLLKNVDDA-----G
PDXH_ALIF1       PVELFELWLKQAVE---AK-LTDPTAMTVATVDEN---GQPFQRIVLLKHFDKT-----G
PDXH_PHOPR       PLPLFKKWLQQAID---AK-IADPTAMTVATVDES---GQPFQRIVLLKHFDRD-----G
PDXH_SHEDO       PMALFETWMTQAKE---AN-LSDPTAMCVATVDEN---GQPFQRIVLLKRFDDT-----G
PDXH_SHEFN       PMDLFEQWMQQAKD---AQ-LSDPTAMCVATVDED---GQPFQRIVLLKKFDDN-----G
PDXH_SHESA       PMQLFELWMTQARD---AE-LSDPTAMCVATVDEH---GQPYQRIVLLKRFDDT-----G
PDXH_SHESM       PMQLFELWMTQARD---AE-LSDPTAMCVATVDEH---GQPYQRIVLLKRFDDS-----G
PDXH_SHESR       PMQLFELWMTQARD---AE-LSDPTAMCVATVDEH---GQPYQRIVLLKRFDDT-----G
PDXH_SHEON       PMQLFELWMTQARD---AQ-LSDPTAMCVATVDEH---GQPFQRIVLLKRFDDS-----G
PDXH_SHESW       PMDLFALWMTQARD---AE-LSDPTAMCVATVDEQ---GQPFQRIVLLKRFDDT-----G
PDXH_SHEAM       PMALFERWMEQAKA---AE-LTDPTAMCVATVDEL---GQPYQRIVLLKRFDEQ-----G
PDXH_SHELP       PMVLFEKWIEQIRD---SEILPDPTAMSVATVDAE---GQPFQRIVLLKRFDDN-----G
PDXH_PSEA6       PYAQFDKWMADAVE---AG-LPDPTAMTVATVNSQ---GQPSQRIVLLKDVMDG-----C
PDXH_PSET1       PFKQFETWLEHAVA---SN-LPDPTAMVVATVDDT---GQPSQRIVLLKHLDND-----G
PDXH_BLOPB       PIQLFSVWLHQAYF---SK-IPDPTAMCLATVDHT---GQPYQRVVLLKNFTNK-----E
PDXH_BLOFL       PMHLFSKWLYEAY----CQ-IPDPNAMCLSTVDHT---GQPFQRLVLLKYFNDK-----T
PDXH_WIGBR       PLDMFKIWLKEAYK---SK-IPDITAMILGTVDDK---NQSYQRMVLLKYIDSK-----K
PDXH_IDILO       PVKQFEKWMQQAID---SNLLSDPTAMTLATVDAE---HMPSQRIVLLKGYDHT-----G
PDXH_PROM3       PVEQFRRWLQQAIA---AD-LQESTAMVLSTFD-G---KRPSSRTVLLKAFDKR-----G
PDXH_PROMM       PVEQFRRWLQQAIA---AD-LQESTAMVLSTFD-G---KRPSSRTVLLKAFDKR-----G
PDXH_RUTMC       PFEQFKLWFQQAQE---AN-VVEPSAMSLATSD-D---SEISIRVVLLKYFDRH-----G
PDXH_MARN8       PVQQFQTWFEDART---AG-ILEPNAMSLATTGAD---GMPDLRTVLLKYFDSQ-----G
PDXH_PSYIN       PILFFNNWLKKAQD---TG-IILPESMSISTCTPE---GRPSSRMVLLKEVDSK-----G
PDXH_COLP3       PDQIFEQWFADANK---SG-ILLPEAMSVSSCNSD---GQPSSRMVLLKDYDKE-----G
PDXH_LEGPA       PISQFKLWFDDVLL---NE-KNDPTAMVLSTVDEK---GYPDSRVVLLKGLENG-----N
PDXH_LEGPH       PISQFKLWFDDVLL---NE-KNDPTAMVLSTVDEK---GYPDSRVVLLKGLENG-----N
PDXH_LEGPL       PISQFKLWFDDVLL---NE-KNDPTAMVLSTVDEK---GYPDSRVVLLKGLENG-----N
PDXH_COXBU       PLEQFKLWYDEAIR---HE-TLHPDAMVLATADSK---GKPSARNVLYKGISKG-----G
PDXH_STRAW       PMDQFTRWFAQAAQAAAQGVVYEPNAMVVSTADAD---GRPSSRTVLMKQYDEQ-----G
PDXH_STRCO       PVEQFARWFKQA---ATDGGLFEPNAMVVSTADPE---GRPSSRTVLLKHFDEQ-----G
PDXH_FRAAA       WVEQFARWFADA--STAGAGVPEANAAVFATASAD---GRPSARTVLLKGFDHR-----G
PDXH_THEFY       PMDQFHAWFTEA----CEAELSEPNAMVLSTVDPD---GAPSARTVLLKGYDRR-----G
PDXH_ACIC1       PIEQFRRWLADA----IRYNLPEPTAMVVATADAD---GRPSSRHVLLKSVDD------G
PDXH_MYCA1       WVALLRKWIDDA----ERAGVAEPNAMVLATVTPD---GRPASRTVLCKSLDET-----G
PDXH_MYCPA       WVALLRKWIDDA----ERAGVAEPNAMVLATVTPD---GRPASRTVLCKSLDET-----G
PDXH_MYCLE       WLTLFCKWIDDA----ERAGVAEPNAMVLATVAN----GRPVSRSVLCKGADEA-----G
PDXH_MYCSK       WVALLRRWLADA----EAAGIAEPNAIVLGTVDAG---GRPVTRTVLCKSVDDT-----G
PDXH_MYCSS       WVALLRRWLADA----EAAGIAEPNAIVLGTVDAG---GRPVTRTVLCKSVDDT-----G
PDXH_MYCSJ       WVALLRRWLADA----EAAGIAEPNAIVLGTVDAA---GRPVTRTVLCKSVDDT-----G
PDXH_MYCVP       WVTLLHQWMAEA----EQAGAAEPNAMVVATVDDR---GRPVTRTVLCKSVDAS-----G
PDXH_MYCBO       WLTLLRRWLNDA----QRAGVSEPNAMVLATVAD----GKPVTRSVLCKILDES-----G
PDXH_MYCTU       WLTLLRRWLNDA----QRAGVSEPNAMVLATVAD----GKPVTRSVLCKILDES-----G
PDXH_MYCBP       WLTLLRRWLNDA----QRAGVSEPNAMVLATVAD----GKPVTRSVLCKILDES-----G
PDXH_NOCFA       WEPLLRNWIEQA----TAVDIAEPNAMVLATVAVVDGVPRPASRTVLCKGLSPE-----G
PDXH_SACEN       WHEQLALWFEQAV---HDPSIHEANAMVLATADAD---GLPSSRTVLCKGFDAR-----G
PDXH_NOCSJ       PIAMFDRWMGEA----HDAIRHDANAMVLSTVGPD---LAPSSRMLLLKGVAED-----G
PDXH_ACIAC       PLRQFDQWLQEAVA--AQVP--EPNAMTLATVGAD---LRPSTRVVLIKGYDER-----G
PDXH_ACISJ       PLLQFDQWLREAIA--AQVP--EPNAMTVATVGSD---LRPSTRVVLIKGYDAQ-----G
PDXH_VEREI       PLQQFDQWLGQAIA--AQLP--EPNAMTLATVGSD---LRPSTRIVLIKGYDER-----G
PDXH_POLNA       PLNQFDQWLNEAIS--AQVP--EPNAMTLATVASN---LRPSTRVVLIKGFDAQ-----G
PDXH_METPP       PLQQFEQWLDQALK--AKLP--EPNAMTLATVGAD---GRPSTRVVLIKGCDAR-----G
PDXH_BURCH       PFAQFDRWFKEALA--AKLP--EPNTMTLATVGAD---GRPSARIVLIKGVDER-----G
PDXH_BURCM       PFAQFDRWFKEALA--AKLP--EPNTMTLATVGEN---GRPSARIVLIKGVDER-----G
PDXH_BURMA       PFVQFDVWFKEALD--AQLP--EPNTMTLATVDES---GRPSARIVLIKGADER-----G
PDXH_BURPS       PFVQFDVWFKEALD--AQLP--EPNTMTLATVDES---GRPSARIVLIKGADER-----G
PDXH_CUPNH       PMSQFKRWFDEAVT--AKLP--EPNAMTLATVDAD---GQPSARIVLLKGIDDR-----G
PDXH_CUPPJ       PIAQFKRWFDEAVT--AKLP--EPNAMTLATVGAD---GQPSARIVLLKGMDEK-----G
PDXH1_RALSO      PLRQFRRWFDEAIR--AEVA--EVNAMTLATVDPQ---GQPSARIVLLKNLDER-----G
PDXH_BORBR       PFQQFARWFDEAVA--ARVP--EPNAMTLATVNAE---GQPSARIVLIKGYDDA-----G
PDXH_BORPA       PFQQFARWFDEAVA--ARVP--EPNAMTLATVNAE---GQPSARIVLIKGYDDA-----G
PDXH_BORPE       PFQQFARWFDEAVA--ARVP--EPNAMTLATVNAE---GQPSARIVLIKGYDDA-----G
PDXH_THEVB       PIEQFRLWLTDAVN--AELP--EPNAMTLATVGLD---GMPAARLVLLKEVDDR-----G
PDXH_PSEAB       PFSLFRQWFDDAVK--TERLPVEPNAMTLATVDAD---GYPHCRILLLKGLDER-----G
PDXH_PSEAE       PFSLFRQWFDDAVK--TERLPVEPNAMTLATVDAD---GYPHCRILLLKGLDER-----G
PDXH_PSEE4       PFALFHHWFADAVK--TEQLPVEANAMTLATVDAD---GRPHCRVLLLKALDGR-----G
PDXH_PSEPK       PFALFHQWFADAVK--TEQVPVEANAMTLATVDGE---GRPHCRVLLLKGLDEQ-----G
PDXH_PSEF5       PFALFHQWFADAVK--TEQPPVEANAMTVATVDTD---GRPHCRILLLKGLDEQ-----G
PDXH_PSE14       PFALFHTWFDDAVK--TEQPPVEANAMTLATVDEQ---GRPHCRVLLLKGLDTQ-----G
PDXH_PSEU2       PFALFHAWFADAVN--TEQPPVEANAMTLATVDEE---GRPHCRVLLLKGLDTQ-----G
PDXH_PSESM       PFALFHTWFEEAVK--TEQPPVEANAMTLATVDEE---GRPHCRVLLLKGLDAQ-----G
PDXH_SYNY3       PFAQFHIWLQQAIA--AELP--EPNAMTLSTLSEE---GHPVGRMVLLKGLDER-----G
PDXH_NOSS1       PFIQFKKWFEQALA--AQLP--EPNAMTIATSTPD---GQPSARMVLLKDFDEQ-----G
PDXH_ACTP2       PIQQFEQWLEEAIT--AKAN--EPTAMNVATVLD----GKPTSRIVLLKEVNPN-----G
PDXH_HAEDU       PMKQFERWLNEAIM--AKVN--EPTAMNMATVID----GKPTSRIVLLKEVDQQ-----G
PDXH_HAEIN       PISQFEQWQKEAIH--AQVN--EPTAMNIATVDEQ---GRPNSRMVLLKEVNEQ-----G
PDXH_HAEI8       PISQFEQWQKEAIH--AQVN--EPTAMNIATVDEQ---GRPNSRMVLLKEVNEQ-----G
PDXH_NEIMF       PIEQFERWLDEAVR--AQVN--EPTAVNVAAVDGR---GRPNSRMVLLKEVNSE-----G
PDXH_NEIMA       PIEQFERWLDEAVR--AQVN--EPTAVNVAAVDGR---GRPNSRMVLLKEVNSE-----G
PDXH_NEIMB       PIEQFERWLDEAVR--AQVN--EPTAVNVAAVDGR---GRPNSRMVLLKEVNSE-----G
PDXH_NEIG1       PIEQFERWLDEAVR--AEVN--EPTAVNVAAVDGR---GRPNSRMVLLKEVNSE-----G
PDXH_MANSM       PLKQLEKWLNEAIQ--AKVN--EPTAMNVATVGEN---GKPSSRVVLLKEVNER-----G
PDXH_CHRVO       AVAQFEIWLNEAIA--AQVP--EPTAMNLAAIGAD---GRPSSRIVLLKGVEDG-----Q
PDXH_BACFN       PLSLFNRWLHEAID--AQVD--EPTAMLVGTVSPE---GQPSTRTVLLKDLHDG-----K
PDXH_BACFR       PLSLFNRWLHEAID--AQVD--EPTAMLVGTVSPE---GQPSTRTVLLKDLHDG-----K
PDXH_BACTN       PLSLFSRWLQEAID--ANVE--EPTAIIVGTVSPE---GRPSTRTVLLKGLHDG-----K
PDXH_PORGI       PFDLVTRWLQDAVE--AKTY--EPTAVIVGTATPD---GHPSTRTVLLKEFMNN-----E
PDXH_LEPBJ       PISFFQKWFEEAV----LSEVLEVNAMTLATATKD---GKPNARIVLLKEILED-----S
PDXH_LEPBL       PISFFQKWFEEAV----LSEVLEVNAMTLATATKD---GKPNARIVLLKEILED-----S
PDXH_LEPIC       PVLFFQKWFEEAV----QSEVLEVNAMTLATVTQD---GKPDARIVLLKGILKE-----S
PDXH_LEPIN       PVLFFQKWFEEAV----QSEVLEVNAMTLATVTQD---GKPDARIVLLKGILKE-----S
PDXH_RHOBA       PLVQFQSWFEEALE--DVPNWFEPNAMTLSTSDVS---GDITSRIVLLKGVEEK-----K
PDXH_GRAFK       PYILFESWFNLAD---NSKNVEEANAMSISTVGKD---LMPKTRVVLLKSFDPD-----G
PDXH_ACIAD       PHEQFLQWFNHAL----QSNLHEPYAMSLATCNRQ---GRPHVRTVLLRGATAQ-----G
PDXH_DEIRA       PLRQFQGWFEEAQ----QADLTEPYALQLATADAQ---GRPSVRTVLLRGADER-----G
PDXH_PSYA2       PFELLKAWMHEAI----EEQVQEPYAMSLATCGAD---DKPSVRIVLLREITDK-----G
PDXH_ALKEH       ALARFAEVYGRAAEAADV---VDHTACTLATCSAS---GWPQVRTVLLKGYDE-----RG
PDXH_HALHL       ALSRVHQVLERA-RATDL---PEPTAGILATVGRD---GWPAARTVLLKQLDE-----QG
PDXH_XANAC       ALATFAALYAEAQNSAE----LEASAMTVATANVD---GRPSARTVLLKAFDA-----RG
PDXH_XANC5       ALATFAALYAEAQNSAE----PEASAMTVATANVD---GRPSARTVLLKAFDA-----RG
PDXH_XANOR       ALATFAALYAEAQNSAE----LEASAMTLATANVD---GRPSARTVLLKAFDA-----RG
PDXH_XANC8       ALATFATLYAEAQNSAE----IEASAMTVATANLD---GRPSARTVLLKAFDA-----RG
PDXH_XANCP       ALATFATLYAEAQNSAE----IEASAMTVATANLD---GRPSARTVLLKAFDA-----RG
PDXH_XYLFA       ALSTFSLLFEEAKSSSE----IEPDAMMLATASLE---GHPSVRTVLLKKFDA-----RG
PDXH_XYLFT       ALSTFSLLFEEAKSSSE----IEPDAMMLATASLE---GHPSVRTVLLKKFDA-----RG
PDXH_MYXXA       PIQRFAELFERAKQAIA----VDPNAMVVATVGDD---GRPSARVVLLKDFDA-----RG
PDXH_BARHE       PFALFAKWLEEATVSEI----NDPNAMALATVDKT---GFPNVRMVLLKDFSP-----QG
PDXH_BARQU       PFALFAKWLEEATVSEI----NDPNAMALATVDET---GLPNVRMVLLKDFSS-----RG
PDXH_BARBK       PFTLFASWLEEATISEI----NDPNAMALATVDET---GLPNVRIVLLKNFNS-----TG
PDXH_AGRFC       PFALFAEWLKDATASEI----NDPNAVALATVDEN---GLPNVRMVLLKGVDD-----RG
PDXH_RHIME       PFSLFGTWLKEAEKNEV----NDPNAVALATVDPD---GMPNVRMVLLKGFDE-----RG
PDXH_RHILO       PFRLFAAWLDDATKSEI----NDANGVALATVDAE---GMPDVRMVLLKGFDE-----GG
PDXH_BRUME       PFKLFAEWLADAAKSEP----NDPNAVALATVDPD---GLPNVRMVLLKDFDE-----TG
PDXH_BRUSU       PFKLFAEWLADAAKSEP----NDPNAVALATVDPD---GLPNVRMVLLKDFDE-----TG
PDXH_RHOPS       PFALFAEWFADANESEL----NDPNAMALATVDPD---GLPDVRMVLMKGYDT-----DG
PDXH_RHOPA       PFALFAEWLAEANKSEP----NDPNAMALATVDPD---GLPDVRMVLMKGYDE-----HG
PDXH_RHOP5       PFALFAEWFAEAVASEP----NDPNAMALATVDAD---GLPDVRMVLMKDYDA-----TG
PDXH_BRADU       PFALFETWLNEAIKSEP----NDPNAMALATVDPD---GLPDVRMVLMKGFDT-----EG
PDXH_NITWN       PFALFEAWLAEATASEP----NDPDAMALATADAD---GLPDLRMVLMKGFDA-----RG
PDXH_MARMM       PFALFADWLTEAKKKEP----NDANAMALATADAS---GLPDVRMVLLKDVDA-----DG
PDXH2_RALSO      PFAMFGEWLELAHRKEI----NDANAMALATADPD---GLPNVRMVLLKGFDR-----EG
PDXH_CAUVC       PFALFAEWLEEAGKKEP----NDPNAMTVSTVDAD---GMPDSRMVLLKDFDA-----RG
PDXH_CERS1       PFAIAAGWLAEAEPQEP----NDPNAIALATVDAA---GLPNVRMVLLKEIEA-----EA
PDXH_RUEPO       PFAIARDWLAEAERSEP----NDANAIALATVDAS---GLPNVRMVLLKEIEP-----AA
PDXH_JANSC       PFVLARAWLAEAEASEP----NDPNAIALSTVDAD---GLPNARMVLLKEIESHGAGQGG
PDXH_PARDP       PFAIARSWLAEAERTEP----NDANAMALATVDAD---GLPDARMVLLKDIEG-GAADGS
PDXH_HYPNA       PIGLFQDWMAQARASEP----NDSNAMSLATVDAD---GRPDVRIVLLKGVDS-----EG
PDXH_ERYLH       PFALFAEWMEEARASEL----NDPNAMALATATPD---GAPSVRMVLLKDHG-----PQG
PDXH_GLUOX       PFALFAAWVSDAEKSEP----NDPNAMAVATATPD---GRPSVRMLLLKGVD-----ERG
PDXH_GRABC       PFAAFSQWMEDARGAEP----NDPNAMTLATASPS---GVPSARIVLLRSVDAAEHPERG
PDXH_ZYMMO       PHKMFDEWMDEAKKAET----DDPTAMALATASKQ---AFPCVRMMLLKGHT-----KDG
PDXH_PELUB       PIDLFEVWMNEAKKTEL----NDPNALALATSDQN---NFPSIRMVLLKDFNK-----DG
PDXH_EHRRG       PIDLFNIWYQEVLKNYSK----DPTAMVLATCSKD---LKPSARVVLLKQHSD-----EG
PDXH_EHRRW       PIDLFNIWYQEVLKNYSK----DPTAMVLATCSKD---LKPSARVVLLKQHSD-----EG
PDXH_EHRCJ       PIKLFDLWYDEVLAFPFKG-K-DPTAMVLATCNKD---LKPSARVVLLKKHSD-----QG
PDXH_WOLPM       PFDLFSKWYKAVLNSPCE----QPTAMTLATCSKD---CIPSARVVLLKEYSK-----EG
PDXH_ANAMM       PMDVFGLWYSEMLRATGAH-MREPSAMVLATCDVQ---NRPSARVVLLKKYGE-----AG
PDXH_BDEBA       PFEHFDRLMKEAVAKQIP----EANAMSVATVDEK---GVPSVRIVYLKEVSQ-----GG
                                             ..:            * :  :           

PDXH_AERHH       MVFYTNMGSRKAHQLEGNPRISLLFPWHTLDR---QVHVTGRVEKMSTFEVMKYFHSRPK
PDXH_AERS4       MVFYTNMGSRKAHQLEGNPRISLLFPWHTLDR---QVHVTGRVEKMSTFEVMKYFHSRPK
PDXH_ECOK1       MVFYTNLGSRKAHQIENNPRVSLLFPWHTLER---QVMVIGKAERLSTLEVMKYFHSRPR
PDXH_ECOL6       MVFYTNLGSRKAHQIENNPRVSLLFPWHTLER---QVMVIGKAERLSTLEVMKYFHSRPR
PDXH_SHISS       MVFYTNLGSRKAHQIENNPRVSLLFPWHTLER---QVMVIGKAERLSTLEVMKYFHSRPR
PDXH_SHIF8       MVFYTNLGSRKAHQIENNPRVSLLFPWHTLER---QVMVIGKAERLSTLEVMKYFHSRPR
PDXH_SHIBS       MVFYTNLGSRKAHQIENNPRVSLLFPWHTLER---QVMVIGKAERLSTLEVMKYFHSRPR
PDXH_SHIDS       MVFYTNLGSRKAHQIENNPRVSLLFPWHTLER---QVMVIGKAERLSTLEVMKYFHSRPR
PDXH_ECOLI       MVFYTNLGSRKAHQIENNPRVSLLFPWHTLER---QVMVIGKAERLSTLEVMKYFHSRPR
PDXH_SHIFL       MVFYTNLGSRKAHQIENNPRVSLLFPWHTLER---QVMVIGKAERLSTLEVMKYFHSRPR
PDXH_ECO57       MVFYTNLGSRKAHQIENNPRVSLLFPWHTLER---QVMVIGKAERLSTLEVMKYFHSRPR
PDXH_SALCH       LVFYTNLGSRKAHQIEHNPRISLLFPWHMLER---QVMVTGKAERLSTLEVVRYFHSRPR
PDXH_SALPA       LVFYTNLGSRKAHQIEHNPRISLLFPWHMLER---QVMVTGKAERLSTLEVVRYFHSRPR
PDXH_SALTY       LVFYTNLGSRKAHQIEHNPRISLLFPWHMLER---QVMVTGKAERLSTLEVVRYFHSRPR
PDXH_SALTI       LVFYTNLGSRKAHQIEHNPRISLLFPWHMLER---QVMVTGKAERLSTLEVVRYFHSRPR
PDXH_PECAS       MVFYTNMGSRKAHHLENNPRISLLFPWHVLER---QVMVLGRVEKLPALEVLKYFHSRPK
PDXH_YERPE       LVFYTNLGSRKAQQLAENPHISLLFPWHMLDR---QVIFLGKAERLSTLEVLKYFHSRPK
PDXH_YERPS       LVFYTNLGSRKAQQLAENPHISLLFPWHMLDR---QVIFLGKAERLSTLEVLKYFHSRPK
PDXH_YERE8       LVFYTNLGSRKAQQLAQNPHISLLFPWHMLDR---QVIFLGTTERLSTLEVLKYFSSRPK
PDXH_PHOLL       LIFYTNLGSRKAKHLAHNNKISLHFPWYPLER---QVSFLGKAERLSPVEVVKYFHSRPR
PDXH_VIBVU       FVFYTNLGSRKAQHLEHNSKISLHFPWHPLER---QVHITGVAEKLTAMENMKYFTSRPK
PDXH_VIBVY       FVFYTNLGSRKAQHLEHNSKISLHFPWHPLER---QVHITGVAEKLTAMENMKYFTSRPK
PDXH_VIBPA       FVFYTNLGSRKAQHLEHNSNISLHFPWHPLER---QVHITGVAEKLTAMENMKYFTSRPK
PDXH_VIBCH       FVFYTNLGSRKAQHIAHNNKISLHFPWHPLER---QVHITGVAEKLTAMENMKYFMSRPK
PDXH_ALIF1       FVFYTNLGSRKAQQLEQHSKISLHFPWHPLER---QVHITGTAEKLTALENMKYFTSRPK
PDXH_PHOPR       FIFYTNLGSRKALHLSHNSKISLHFPWHAIER---QVHITGEVEKLSSLEVMKYFTSRPK
PDXH_SHEDO       FVFFTNLESRKAKQIAINKQISLLFPWHPLER---QVAVLGEAEPLSMMEVAKYFISRPK
PDXH_SHEFN       FVFFTNLESRKAKQIATNSKISLLFPWHPLER---QVAVLGEAEPLSMLDVAKYFMSRPK
PDXH_SHESA       FVFFTNLGSRKAQQIATNNKVSLHFPWHPIER---QVSILGEAQPLSTAEVLKYFMTRPK
PDXH_SHESM       FVFFTNLGSRKAQQIAANNKVSLHFPWHPIER---QVSILGEAQPLSTAEVLKYFMTRPK
PDXH_SHESR       FVFFTNLGSRKAQQIAANNKVSLHFPWHSIER---QVSILGEAQPLSTAEVLKYFMTRPK
PDXH_SHEON       FVFFTNLGSRKALQIAANNKVSLHFPWHPIER---QVSILGEAQPLSTAEVLKYFMTRPK
PDXH_SHESW       FVFFTNLGSRKAQQIAANNKVSLHFPWHPLER---QVSVLGEAQALSTTEVLKYFMTRPK
PDXH_SHEAM       FVFFTNLGSRKATQLKHNAHISLLFPWHPLER---QVAVTGIAEPLSTAEVLKYFVTRPK
PDXH_SHELP       FVFFTNLASRKAEQIAHNNKVSLLFPWHALER---QVAVTGVAEQLSTTEVLKYFVTRPK
PDXH_PSEA6       FVFYTNLGSRKAQDLLTNSKISLHFPWHILER---QVLVRGSASLLPRQDVQHYFSSRPL
PDXH_PSET1       FVFFTNTGSRKAQELKGNNKISLHFPWHPMER---QVIVYGEAKPLPTSAVAKYFLSRPK
PDXH_BLOPB       MIFYTNLSSRKAMHLANNPKVSLCFLWNVIDR---QVIITGSVDKLPEKEVLKYFYTRPK
PDXH_BLOFL       IVFFTHLNSRKAIHINNNPKISLCFPWNIINR---QIIITGSVYKISKKEAQKYFYTRPK
PDXH_WIGBR       VIFYTNFKSRKANHIKNNSKVSLLFPWNILDR---QVLFLGYAKKIPQDDIKKYFYTRSK
PDXH_IDILO       FRFYTNKNSHKGQDISENPQVALHFAWLPLER---QISIIGSAVPLDDDDNDRYFHSRPK
PDXH_PROM3       FVFFTNYGSRKAQDISAHPNVSLLFPWYDLER---QVAIMGPAERISRAESQAYFSSRPF
PDXH_PROMM       FVFFTNYGSRKAEDISAHPNVSLLFPWYDLER---QVAIMGPAERISRAESQAYFSSRPF
PDXH_RUTMC       FVFFTNYNSKKSKQLQINPNVALLFPWLALER---QIKISGYVKKVNTFESLKYFSSRPK
PDXH_MARN8       FVFYTNYGSRKAQELQENPRAALLFPWIGLNR---QVRIQGAVEKVSKAESLRYFSSRPR
PDXH_PSYIN       FVFFTNYDSRKAHDLEANPFAALLFHWNILQR---QVRIEGRVERISTAQSNAYFQSRGR
PDXH_COLP3       FVFFTNYESRKSHELAENNKVALLFHWNVLQR---QIRIEGTVEKVSIQESADYFHSRDR
PDXH_LEGPA       FIFYTNYQSAKAMQIQKNPYAALNFYWPQMAR---QVRVRGRVKKISSEQSDAYFSSRPL
PDXH_LEGPH       FIFYTNYQSAKAMQIQKNPYAALNFYWPQMAR---QVRVRGRVKKISSEQSDAYFSSRPL
PDXH_LEGPL       FIFYTNYQSAKAMQIQKNPYAALNFYWPQMAR---QVRVRGRVKKISSEQSDAYFSSRPI
PDXH_COXBU       FLIFTNYHSRKAHELDENPQAAWVFYWPKTYK---QVRGEGRVERLTQEESEAYFETRSY
PDXH_STRAW       FVFYTNYDSRKARDLAANPYVSLLFPWHPMAR---QVVVTGLARRTGRDETAAYFRTRPH
PDXH_STRCO       FVFYTNYDSRKARELDANPHVSLLFPWHPMAR---QVVVTGVARRTGRDETAAYFRTRPH
PDXH_FRAAA       FVIYTNYTSRKGRESAENPFGSLVFPWYTLER---QVVAIGAVERVSRTETEQYFASRPR
PDXH_THEFY       LRFFTNYRSRKGVALAREPRACVVFPWHAIRR---QVIVYGFAERLSDEENDAYFAQRPH
PDXH_ACIC1       FVFFTNYRSRKGRDLSENPSASLCFPWFAIGR---QVVVLGTVTKVTREETEEYFASRPR
PDXH_MYCA1       ITFFTNYDSAKADDLAATPYAAVTFPWYQLGR---QVHLRGPVSKVTAQVTEDYWSKRPR
PDXH_MYCPA       ITFFTNYDSAKADDLAATPYAAVTFPWYQLGR---QVHLRGPVSKVTAQVTEDYWSKRPR
PDXH_MYCLE       IIFFTNYDSDKGDDLAATPYASVTFPWYQLGR---QVHIRGPVSTVDPQVSEDYWSKRPR
PDXH_MYCSK       ITFFTNYGSAKGEDLASTPYASATFPWFALGR---QVHVRGPVTKVSAEETADYWSKRPR
PDXH_MYCSS       ITFFTNYGSAKGEDLASTPYASATFPWFALGR---QVHVRGPVTKVSAEETADYWSKRPR
PDXH_MYCSJ       ITFFTNYGSAKGEDLASTPYASATFPWFALGR---QVHVRGPVTKVSAEETADYWSKRPR
PDXH_MYCVP       VSFYTNYDSEKGRQLAAAPYASATFPWYLVGR---QVHVHGAVTKVSAEETADYWSKRPR
PDXH_MYCBO       VAFFTSYTSAKGEQLAVTPYASATFPWYQLGR---QAHVQGPVSKVSTEEIFTYWSMRPR
PDXH_MYCTU       VAFFTSYTSAKGEQLAVTPYASATFPWYQLGR---QAHVQGPVSKVSTEEIFTYWSMRPR
PDXH_MYCBP       VAFFTSYTSAKGEQLAVTPYASATFPWYQLGR---QAHVQGPVSKVSTEEIFTYWSMRPR
PDXH_NOCFA       VTFYTNYDSAKGTQLAAVPYAAATFVWPVLGR---QVHLRGPVERTSAEQTAVYWRSRPR
PDXH_SACEN       VVFFTNYTSAKSHDLKVTRFAAATFPWLAMQR---QVNVRGTVEKVSQEETAEYWAERPR
PDXH_NOCSJ       FVFFTNTASLKGHELAANPRCSLLFPWHPLER---QVRVDGVAAPLPRADVEAYFASRPR
PDXH_ACIAC       IVWYTNYGSRKGRQLAGNPFAALQFHWVELER---VVRIEGRVEKVSDAESDAYFASRPL
PDXH_ACISJ       IVWYTNYDSRKGRQIAGNPYAALQFHWVELER---VVRIEGVVEKVSEAESDAYFHSRPL
PDXH_VEREI       IVWFTNYDSRKGRQIAGNPCAALQFHWVELER---VVRIEGLVQKVSDQESDAYFDSRPL
PDXH_POLNA       IVWYTNYASRKGLELAGNPYAALQFHWVELER---VVRIEGVVEKVSDEESDAYFHSRPL
PDXH_METPP       IVWYTNYESRKGRELAAHPFAALQFHWVDLER---VVRIEGRVEKVSDTESDAYYRSRPL
PDXH_BURCH       FVFFTNYESRKGHDLAVHPQAALLFYWIELER---QVRIEGRIEKTSAEESDRYFASRPL
PDXH_BURCM       FVFFTNYESRKGRDLAAHPYAALLFYWIELER---QVRIEGRIEKTSTDESDRYFASRPL
PDXH_BURMA       FVFFTNYESRKGRELAHNPNAALLFYWIELER---QVRVEGRIEKTSEEESDRYFASRPL
PDXH_BURPS       FVFFTNYESRKGRELAHNPNAALLFYWIELER---QVRVEGRIEKTSEEESDRYFASRPL
PDXH_CUPNH       FTFFTNYESRKGLDLAANPRAALLFHWVQLER---QVRVEGRVEKVSDDESDAYFATRPL
PDXH_CUPPJ       FTFFTNYESRKGLDMAANPRAALLFHWVQLER---QVRVEGRVEKVADDESDAYYASRPL
PDXH1_RALSO      FTFFTNYCSHKGEELAANPHAALLFHWIGLER---QVRVQGVVEKVSEAESDAYYHSRPL
PDXH_BORBR       FVFFTNYESRKGLDLDANPRASLLFFWQPLER---QVRIEGVIEKVSAAESDEYFHSRPL
PDXH_BORPA       FVFFTNYESRKGLDLDANPRASLLFFWQPLER---QVRIEGVIEKVSAAESDEYFHSRPL
PDXH_BORPE       FVFFTNYESRKGLDLDANPRASLLFFWQPLER---QVRIEGVIEKVSAAESDEYFHSRPL
PDXH_THEVB       FVFFTNYRSRKGRELAAHPKAALVFWWAELER---QVRIEGNVEQISAAESDAYFQSRPL
PDXH_PSEAB       FTFFTNYESAKGRQLAANPRAAMTFFWPALER---QVRIEGSVEKVTPEESDAYYQVRPL
PDXH_PSEAE       FTFFTNYESAKGRQLAANPRAAMTFFWPALER---QVRIEGSVEKVTPEESDAYYQVRPL
PDXH_PSEE4       FTFFTNYESAKGQHIAANPFAAMTFFWPALER---QVRIEGRVEKVTAKESDDYYQVRPL
PDXH_PSEPK       FTFFTNYDSAKGQQLQANPFAAMTFFWPALER---QVRIEGRVQKVTAQESDAYYQVRPL
PDXH_PSEF5       FTFFTNYESAKGQQLAARPFAAMTFFWPTLER---QVRIEGRVVKVTPQESDAYYQVRPL
PDXH_PSE14       FTFFTNYESAKGQQLAARPFAAMTFFWPTLER---QVRIEGRVEKVSAQESDAYYQVRPL
PDXH_PSEU2       FTFFTNYESAKGQQLAARPFAAMTFFWPTLER---QVRIEGRVEKVSAQESDAYYQVRPL
PDXH_PSESM       FTFFTNYESAKGRQLAAHPFAAMTFFWPALER---QVRIEGRVEKVSAQESDAYYQVRPL
PDXH_SYNY3       FVFYTNYDSAKGQQLTAHPWAGLVFWWAALER---QVRVDGQVEKIDPAESDAYFQSRPR
PDXH_NOSS1       FVFFTNYNSRKGQELAENPQAALVFWWAELER---QVRISGRVEKVSESESDYYFYSRPA
PDXH_ACTP2       FVFFTNYQSRKGQAIEQNPYVALTFFWAELER---SVRIEGRIEKISAEQSDNYFASRPY
PDXH_HAEDU       FIFFTNYQSCKGWAIALNPYVALTFFWPELER---SVRVEGIATKLSEQASDDYFASRPY
PDXH_HAEIN       FVFFTNYLSRKGGCIEHNPYVALTFFWPELER---QVRIEGKAVKIPAEQSDKYFATRPY
PDXH_HAEI8       FVFFTNYLSRKGGCIERNPYVALTFFWPELER---QVRIEGKAVKIPAEQSDKYFATRPY
PDXH_NEIMF       FVFFTNYHSRKGRSLDAHPFAAMTFFWPELER---QVRVEGRVERLAEKLSDEYFESRPY
PDXH_NEIMA       FVFFTNYHSRKGRSLDAHPFAAMTFFWPELER---QVRVEGRVERLAEKLSDEYFESRPY
PDXH_NEIMB       FVFFTNYHSRKGRSLDAHPFAAMTFFWPELER---QVRVEGRVERLAEKLSDEYFESRPY
PDXH_NEIG1       FVFFTNYHSRKGRSLELNPFAAMTFFWPELER---QVRVEGRVGRLAEKLSDEYFESRPY
PDXH_MANSM       LVFFTNYHSHKGRDLAVNPFAAVNLFWAELQR---QVRVEGRVERISPQASDEYFASRPY
PDXH_CHRVO       LLFYTNYQSRKGQALEANPYVALNFFWPELER---QVRIEGKAARVAPEVSDAYFASRPY
PDXH_BACFN       FIFYTNYESRKGTHLAKNPYISLSFVWHALER---QVHIEGIASKVPAGESDTYFRQRPY
PDXH_BACFR       FIFYTNYESRKGTHLAKNPYISLSFVWHALER---QVHIEGIASKVPAGESDTYFRQRPY
PDXH_BACTN       FIFYTNYESRKGRQLAQNPYISLSFVWHELER---QVHIEGTAAKVSPEESDEYFRKRPY
PDXH_PORGI       FIFYSNYESRKGQQMAANPHVCLTFLWHELER---QIHVEGDVRILEPELSDAYFATRPY
PDXH_LEPBJ       FVFYTNYESKKGRELEENPRACLVFFWSELER---QVRIEGGVKKVSREESNVYFHSRPR
PDXH_LEPBL       FVFYTNYESKKGRELEENPRACLVFFWSELER---QVRIEGGVKKVSREESNVYFHSRPR
PDXH_LEPIC       FLFYTNYESRKGTELETNPNVCLVFFWPELER---QVRIEGNVTKVSREVSKEYFHSRPR
PDXH_LEPIN       FLFYTNYESRKGTELETNPNVCLVFFWPELER---QVRIEGNVTKVSREVSKEYFHSRPR
PDXH_RHOBA       FLFYTNYDSTKGSQMRANPRVSLCLFWPHCQR---QVRIQGTVDKVSREMSETYFHSRPR
PDXH_GRAFK       LYFYTNYDSVKGRDLDENPKCCISFFWPSLEK---QIIIQGEVVKVSSKKSEEYFHSRPR
PDXH_ACIAD       YDFYTNYDSQKGIDLAENPYAELLFYWPSLER---QVRIGGIVNKISEHESTDYYHKRPR
PDXH_DEIRA       LTFYTNYESHKGHDLAANPQAEVLFYWAELER---QVRAFGTVSRVPEAESNDYFHKRPR
PDXH_PSYA2       IVFYTNYESAKGQDIAENPNAEALFFWHKLER---QIRISGSIAKIDADKSAAYFQKRPH
PDXH_ALKEH       FAFYTNRHSRKGQALAENPRAAVCFHWAPLAE---QVVIEGVVTPVAEAEADAYWAGRPR
PDXH_HALHL       AVFYTNRASRKGQQLADNPRAALCLHFQPLYE---QVEIRGVVAAVSASEADRYWAQRER
PDXH_XANAC       FVFYTHLDSAKGRDLQTHPQAALLFLWRSLREAGIQVRIEGGVQLVSADESDAYFASRPR
PDXH_XANC5       FVFYTHLDSAKGRDLQTHPQAALLFLWRSLREAGIQVRIEGGVQLVSADESDAYFASRPR
PDXH_XANOR       FVFYSHLDSAKGRDLQTHPQAALLFLWRSLREAGIQVRIEGGVQLVSADESDAYFASRPR
PDXH_XANC8       FVFYTHLDSAKGRDLQTHPQAALLFLWRSLREAGIQVRIEGGVQLVSADESDAYFASRPR
PDXH_XANCP       FVFYTHLDSAKGRDLQTHPQAALLFLWRSLREAGIQVRIEGGVQLVSADESDAYFASRPR
PDXH_XYLFA       FVFYSHIDSPKGRDLQANPQAALLFLWRSLREAGVQVRIEGRVQQVLAEEADAYFASRPR
PDXH_XYLFT       FVFYSHLDSPKGRDLQANPQAALLFLWRSLREAGVQVRIEGRVQQVLAEEADAYFASRPR
PDXH_MYXXA       FVFYTNHESRKGREARAHPYAALCFYWQPLNE---QVRVEGRVERVTDAEADAYFQSRAR
PDXH_BARHE       FVFYTNYESPKGQEILKSMKASLVFHWKSLRR---QVRIRGIVEKVTPQEADAYFQSRPR
PDXH_BARQU       FVFYTNYESCKGQEILKSMKASLVFHWKSLRR---QIRIRGIVEKVSTQEADVYFQSRPR
PDXH_BARBK       FVFYTNYESCKGQEILKSMKASLVFHWKSLRR---QIRIRGLVEQVSPEEADAYFQSRPY
PDXH_AGRFC       FVFYTNFESQKGQEILGQKKAAMCFHWKSLRR---QVRLRGEVEIVSDEEADAYYASRPR
PDXH_RHIME       FVLYTNFESQKGREMLATRKAALCFHWKSLRR---QVRLRGPVEIVSDEEADEYFMSRPR
PDXH_RHILO       FVFYTNFESAKGQEILGSMKAAMCFHWKSLRR---QVRIRGPVEIVSDAEADAYYATRPR
PDXH_BRUME       FVFYTNYESKKGQEILSAEKAAMCFHWKSLRR---QVRVRGPVEKVSDAEADAYYASRPR
PDXH_BRUSU       FVFYTNYESKKGQEILSAEKAAMCFHWKSLRR---QVRVRGPVEKVSDAEADAYYASRPR
PDXH_RHOPS       FVFYSHIASQKGRELAANPKAALLFHWKSLRR---QVRIRGAVSAVTETEADDYFATRPK
PDXH_RHOPA       FVFYSHIASQKGRELAANPKAALLFHWKSLRR---QIRIRGTVTPVTDTEADAYFATRPK
PDXH_RHOP5       FVFYSHLASQKGQELAANPKAALLFHWKSLRR---QVRVRGLVAPVTDAEADAYFATRPK
PDXH_BRADU       FVFYSHIASQKGRELAANPKAALLFHWKSLRR---QVRIRGNVTPVTDAEADAYFATRPK
PDXH_NITWN       FVFYSHIASAKGRELAANPKAALLFHWKSLRR---QVRVRGPVTPVTDAEADAYFATRPR
PDXH_MARMM       FVFYTNLESGKGGQLADNPQAALCFHWKSLRR---QVRVRGAVEPVSAGEADAYFASRAR
PDXH2_RALSO      FVFYTNTESQKGVELAENMQAAAVLHWKSLRR---QVRFRGTVNRVSAEEADAYFVSRAR
PDXH_CAUVC       FVFYTNTQSAKGQELNAHPKAALLFHWKSLRR---QVRIRGTVEPVTEAEADAYFASRAR
PDXH_CERS1       FVFYTNYGSQKAVEIETSGKAAFVLHWKSLRR---QIRVRGLVEREEGVQADAYYASRSL
PDXH_RUEPO       FVFYTNYESAKAIELEQAGKAAFVMHWKSLRR---QLRVRGTITREEGPQADDYYASRSL
PDXH_JANSC       FVFYTNYGSAKGQEIAQAGKAAFVCHWKSLHR---QIRVRGLTETEDGPQADAYYASRSL
PDXH_PARDP       FVFYTNYESAKGVEIEATGVAAFVMHWKSLRR---QIRVRGHVTRVEPELADAYYASRPL
PDXH_HYPNA       FTFFTNLESVKGVQLAANPVAALCFHWKSQRR---QVRVRGGVAPVSAAEADAYFASRAA
PDXH_ERYLH       FTFYTNAESRKGEEIRANAQTALLFHWKSLRR---QIRVEGPVREVAPEVADAYFHSRAR
PDXH_GLUOX       FVFYTNLESRKGRELLANPHVALLFHWKSLRR---QIRIEGPVEAVSAAEADAYFASRSR
PDXH_GRABC       FVFFTNTESRKGVEIAANPQVALLFHWKSLGR---QIRIEGKAIPVAVEEAESYFHTRPR
PDXH_ZYMMO       FVFFTNLGSRKGHELLENPVATLLFHWKKLRR---QVRIEGAATLISDEEADAYFATRAR
PDXH_PELUB       FVFYTNLNSQKGNELKNNPKASMCFHWKSLLR---QVRINGMVQKVSNKVADEYYSSRGY
PDXH_EHRRG       FVFFTNMNSRKGKEISENPFVSLVFDWRQISK---QVRIEGKIETLSPEDSDRYYATRSR
PDXH_EHRRW       FVFFTNMNSRKGKEISENPFVSLVFDWRQISK---QVRIEGKIETLSPEDSDRYYATRSR
PDXH_EHRCJ       FIFFTNINSRKGKEITDNPFAALVFDWSYIAK---QVRIEGKVKILPCQDADEYYASRPV
PDXH_WOLPM       FVFFTNVNSKKGKELTENPKAALVFHWIEFAR---QVRIEGEVKLLNDERTDKYFSSRAL
PDXH_ANAMM       FEFVTNFNSRKGREIADNPQVALVFDWRHIGR---QVRVEGLATLMDASESDAYHASRSR
PDXH_BDEBA       FVFYGNYNSHKGKDIETNPIVCLNFHWPAIWQ---QIRITGKAEKISAAESDAYFATRAR
                         * *.              :    .        *            *   *  

PDXH_AERHH       DSQIAAWVS-QQSTRISARGVLEAKFLELKQKFANGE-VPLPSFWGGFRVRIDTVEFWQG
PDXH_AERS4       DSQIAAWVS-KQSTRISARGVLEAKFLELKQKFANGE-VPLPSFWGGYRVVIDTVEFWQG
PDXH_ECOK1       DSQIGAWVS-KQSSRISARGILESKFLELKQKFQQGE-VPLPSFWGGFRVSLEQIEFWQG
PDXH_ECOL6       DSQIGAWVS-KQSSRISARGILESKFLELKQKFQQGE-VPLPSFWGGFRVSLEQIEFWQG
PDXH_SHISS       DSQIGAWVS-KQSSRISARGILESKFLELKQKFQQGE-VPLPSFWGGFRVSLEQIEFWQG
PDXH_SHIF8       DSQIGAWVS-KQSSRISARGILESKFLELKQKFQQGE-VPLPSFWGGFRVSLEQIEFWQG
PDXH_SHIBS       DSQIGAWVS-KQSSRISARGILESKFLELKQKFQQGE-VPLPSFWGGFRVSLEQIEFWQG
PDXH_SHIDS       DSQIGAWVS-KQSSRISARGILESKFLELKQKFQQGE-VPLPSFWGGFRVSLEQIEFWQG
PDXH_ECOLI       DSQIGAWVS-KQSSRISARGILESKFLELKQKFQQGE-VPLPSFWGGFRVSLEQIEFWQG
PDXH_SHIFL       DSQIGAWVS-KQSSRISARGILESKFLELKQKFQQGE-VPLPSFWGGFRVSLEQIEFWQG
PDXH_ECO57       DSQIGSWVS-KQSSRISARGILESKFLELKQKFQQGE-VPLPSFWGGFRVSLEQIEFWQG
PDXH_SALCH       DSQIGAWVS-KQSSRISARGILESKFLELKQKFQQGE-VPLPSFWGGFRVSIEQMEFWQG
PDXH_SALPA       DSQIGAWVS-KQSSRISARGILESKFLELKQKFQQGE-VPLPSFWGGFRVSIEQMEFWQG
PDXH_SALTY       DSQIGAWVS-KQSSRISARGILESKFLELKQKFQQGE-VPLPSFWGGFRVSIEQMEFWQG
PDXH_SALTI       DSQIGAWVS-KQSSRISARGILESKFLELKQKFQQGE-VPLPSFWGGFRVSIEQMEFWQG
PDXH_PECAS       DSQIGAWVS-KQSSRISARGVLESKFLELKQKFQNGE-VPLPSFWGGFRVVIDSVEFWQG
PDXH_YERPE       DSQIGAWVS-QQSSRISARGVLESKFLELKQKFQQGD-VPLPSFWGGFRVKFDSVEFWQG
PDXH_YERPS       DSQIGAWVS-QQSSRISARGVLESKFLELKQKFQQGD-VPLPSFWGGFRVKFDSVEFWQG
PDXH_YERE8       DSQIGAWVS-QQSSRISARGVLESKFLELKQKFQQGE-VPLPSFWGGFRVKFDSVEFWQG
PDXH_PHOLL       DSQIAAWAS-QQSSRISARGVLEGKFLELKQKFLNGE-VPLPSFWGGFKVTFDSVEFWQG
PDXH_VIBVU       ESQLAAMAS-RQSSRISARGVLEGKFLELKQKFANGE-IPVPSFWGGFRVKPQSIEFWQG
PDXH_VIBVY       ESQLAAMAS-RQSSRISARGVLEGKFLELKQKFANGE-IPVPSFWGGFRVKPQSIEFWQG
PDXH_VIBPA       DSQLAAIAS-KQSSRISARGVLEGKFLELKQKFAKGE-IPMPTFWGGFRVKPQSIEFWQG
PDXH_VIBCH       ESQIAAIAS-HQSSRISARGVLEGKYLELKQKFANGE-IPVPSFWGGYRIRPESLEFWQG
PDXH_ALIF1       ESQIAAWAS-KQSSRLTARAALEGKYLELKQKFAKGE-IPVPKFWGGFRIKIDSIEFWQG
PDXH_PHOPR       ESQIAAWAS-KQSNRISARQALEGKYLELKQKFAQGK-VPVPTFWGGYRVKINSIEFWQG
PDXH_SHEDO       DSQIAAWVS-KQSSKITARQALEGKFNEMKAKFAQGE-VPIPKFWGGFLVRPKSIEFWQG
PDXH_SHEFN       DSQIAAWVS-KQSSKISARQALEGKFAEMKAKFAQGE-VPLPKFWGGYLVRPASIEFWQG
PDXH_SHESA       DSQIAAWVS-QQSSKLSARQVLEGKFFEMKAKFAKGD-VPLPSFWGGYLVKPSSIEFWQG
PDXH_SHESM       DSQIAAWVS-QQSSKLSARQVLEGKFFEMKAKFAKGD-VPLPSFWGGYLVKPSSIEFWQG
PDXH_SHESR       DSQIAAWVS-QQSSKLSARQVLEGKFFEMKAKFAKGD-VPLPSFWGGYLVKPSSIEFWQG
PDXH_SHEON       ESQIAAWVS-QQSSKLSARQVLEGKFFEMKAKFAKGD-VPLPSFWGGYLVKPSSIEFWQG
PDXH_SHESW       DSQIAAWVS-QQSSKLSARQVLEGKFFEMKAKFAKGD-VPLPSFWGGYLVRPKSIEFWQG
PDXH_SHEAM       DSQIAAWVS-AQSSKLSARQVLEAKFMEMKQKFSAGE-VPLPSFWGGYLVRPASIEFWQG
PDXH_SHELP       ESQIAAWVS-KQSSKISARQALESKFAEMKAKFSQGE-VPLPKFWGGYRVRPSSIEFWQG
PDXH_PSEA6       SSQLAAWTS-KQSQPIESRDALLSRFEDTKIKFSDKD-IPAPEFWGGFKIIPQEIEFWQG
PDXH_PSET1       ESQLAAWAS-AQSRPVSSRKVLMETFANMKNKFAKGE-IPLPDFWGGYCVVPQKIEFWQG
PDXH_BLOPB       NNQISTWVS-NQSKVISSKDLLENKFLEFKKNHLHKK-VPFPEFWGGYKININSMEFWQG
PDXH_BLOFL       NNQISTWAS-KQSTIISSKKVLKNKFLKLKKKYFQKS-VPFPHFWVGYKININSMEFWQG
PDXH_WIGBR       NSQISVWAS-KQSQIIKKRSILDDKFLKLKHEFQKKV-VPFPKFWGGYKINISSAEFWQG
PDXH_IDILO       ESQVAALAS-QQSRPVESRDVLESHYQSLLKDYENTE-VPRPQSWGGYCVHPKQFEFWQG
PDXH_PROM3       GSRLGVWVS-QQSQVISSRQILKMKWQEMNRRFANGE-VPLPEFWGGFRVVPTEFEFWQG
PDXH_PROMM       GSRLGVWVS-QQSQVISSRQILEMKWQEMNRRFANGE-VPLPEFWGGFRVAPTEFEFWQG
PDXH_RUTMC       ASQLGAWAS-QQSSNLSSRQILLSQFESMKVKFSKGE-VPLPDFWGGYRVIPSKIEFWQG
PDXH_MARN8       GSQIGAWVS-EQSQVITSRGLLEQKVAEMKRKFSSGE-IPLPSFWGGYRVVPERIEFWQG
PDXH_PSYIN       GSRIGAWAS-HQSQELNDRQTLVERVKYFEEKFAGKE-IPLPEFWGGYRVIPESIEFWQG
PDXH_COLP3       GSQVGAWAS-KQSQKLKYDDELKERMSHYQDKFSEGE-VPHPEFWGGWRVKPHAIEFWQG
PDXH_LEGPA       KSQFSAIVS-PQSQEILDRISLEDALNQLIEEYGQKP-VVRPENWGGYMIIPDEIEFWQG
PDXH_LEGPH       KSQFSAIVS-PQSQEILDRISLEDALNQLIEEYGQKP-VVRPENWGGYMIIPDEIEFWQG
PDXH_LEGPL       KSQFSAIVS-PQSQEILDRISLEDALNQLIEEYGQKP-VVRPENWGGYMIIPDEIEFWQG
PDXH_COXBU       ESQIAAWVS-EQSQEIPDREYLITRYKKYREKF-QDD-VRCPEFWGGFRLIPDRMEFWVG
PDXH_STRAW       GSQLGAWAS-AQSSVIFSRAELDAAYEQLGVRYPEGEQVPVPPNWGGFRIAPQTVEFWQG
PDXH_STRCO       GSQLGAWAS-VQSSVVADRRALDGAYAELAARYPEGEQVPVPPHWGGFRVVPDAVEFWQG
PDXH_FRAAA       GSQLGAWAS-HQSQIIESRDVLDARAAELAARWPAGTPVPTPPFWGGLRLVPDTVEFWQG
PDXH_THEFY       GSQLGAWASEYQSAPVADRAELDRAYARCAEQWPPGTPVPRPEYWGGFLLVPQEVEFWQG
PDXH_ACIC1       DSQCGAWSSENQSSVVPSRAWLDERYAEVAQRFAGVEHIPPPPFWGGFRVIPETVEFWQA
PDXH_MYCA1       GSQLGAWAS-QQSRPIASRAALLEQLAQVTARFADHERVPVPPGWGGYLIAADVVEFWQG
PDXH_MYCPA       GSQLGAWAS-QQSRPIASRAALLEQLAQVTARFADHERVPVPPGWGGYLIAADVVEFWQG
PDXH_MYCLE       GSQLGAWAS-HQSRPIASRTALLDQLLEVTVRFADSELIPLPPNWGGYLIVPEVVEFWQG
PDXH_MYCSK       GSQLGAWAS-QQSRPIASRAELLDQLAEVTERFADHDTVPVPPDWGGYRITAEVVEFWQG
PDXH_MYCSS       GSQLGAWAS-QQSRPIASRAELLDQLAEVTERFADHDTVPVPPDWGGYRITAEVVEFWQG
PDXH_MYCSJ       GSQLGAWAS-QQSRPIASRAELLDQLAEVTERFADHDTVPVPPDWGGYRITAEVVEFWQG
PDXH_MYCVP       GSQLGAWAS-QQSLPIASRAALMQQLTEVTERFADVEEIPVPPHWGGYLIAAEVVEFWQG
PDXH_MYCBO       GAQLGAWAS-QQSRPVGSRAQLDNQLAEVTRRFADQDQIPVPPGWGGYRIAPEIVEFWQG
PDXH_MYCTU       GAQLGAWAS-QQSRPVGSRAQLDNQLAEVTRRFADQDQIPVPPGWGGYRIAPEIVEFWQG
PDXH_MYCBP       GAQLGAWAS-QQSRPVGSRAQLDNQLAEVTRRFADQDQIPVPPGWGGYRIAPEIVEFWQG
PDXH_NOCFA       DSQLGAWAS-QQSRPIDSRAALDRALAEVTARFAGVDEIPVPPHWGGYLLRPEQVEFWQG
PDXH_SACEN       GSQLGAWAS-PQSRVVSGRSALESTLNGIERRFADAEKVPVPPHWGGWRIVPESVEFWQG
PDXH_NOCSJ       ASQLGAWAS-HQSEVVSGRAELEAAYAAAEVRYP--DQVPTPEEWGGYVVRPEVVEFWQG
PDXH_ACIAC       DSRIGAWAS-PQSEVISGRGVLVANAAKYGAQFLLQ--PLRPPHWGGFRLKPDRWEFWQG
PDXH_ACISJ       DSRIGAWAS-PQSQVIPSRGMLVANAAKYGAQFLLK--PPRPPHWGGFRLRPDQWEFWQG
PDXH_VEREI       DSRIGAWAS-PQSQVIAGRGVLLANAARYGAQFMLK--PPRPQHWGGYRLEPDLWEFWQG
PDXH_POLNA       DSRIGAWAS-PQSEVISGRGVLLANAAKFGAKFMLQ--PPRPAHWGGYRLKPDNWQFWQG
PDXH_METPP       DSRLGAWAS-PQSQVIASRAVLVANAAKVGAQFLLN--PPRPPHWGGFRLRPDRWEFWQG
PDXH_BURCH       GSRIGAWAS-EQSAVIDSRATLEAREKAVSERYGDN--PPRPPHWGGYRLVPDSIEFWQG
PDXH_BURCM       GSRIGAWAS-EQSAVIDSRATLEAREKAVAERYGEN--PPRPPQWGGYRVVPDAIEFWQG
PDXH_BURMA       GSRIGAWAS-EQSAVIESRALLEAREKEIGARFGEN--PPRPPHWGGYRLVPSSIEFWQG
PDXH_BURPS       GSRIGAWAS-EQSAVIESRALLEAREKEIGARFGEN--PPRPPHWGGYRLVPSSIEFWQG
PDXH_CUPNH       GSRVGAWAS-AQSREVPGRDVLEQREQEYRSKFGEN--PPRPPHWGGYRLVPTALEFWQG
PDXH_CUPPJ       GSRLGAWAS-EQSREVPGRDVLEQRESEYRAKFGEN--PPRPAHWGGYRLVPTALEFWQG
PDXH1_RALSO      GSRLGAWAS-EQSSEVPDRAVLEAREAEYRERFGDA--PPRPPHWGGYRLLPERIEFWQG
PDXH_BORBR       GSRLGAWAS-RQSQPI-TRDELEAREREFRDRYGEH--PPRPPHWGGYRLKPNRFEFWQG
PDXH_BORPA       GSRLGAWAS-RQSQPI-TRDELEAREREFRDRYGEH--PPRPPHWGGYRLKPNRFEFWQG
PDXH_BORPE       GSRLGAWAS-RQSQPI-TRDELEAREREFRDRYGEH--PPRPPHWGGYRLKPNRFEFWQG
PDXH_THEVB       GSRWGAWAS-QQSEVLASYAELEARLAAVEAHYGEN--VPRPEHWGGYRVLPTLIEFWQG
PDXH_PSEAB       GSRLGAWAS-PQSRVIADRAELERLLADTERRFADQP-PSCPEHWGGYRLLPQRIEFWQG
PDXH_PSEAE       GSRLGAWAS-PQSRVIADRAELERLLADTERRFADQP-PSCPEHWGGYRLLPQRIEFWQG
PDXH_PSEE4       GSRLGAWAS-PQSRVIADREELEGLVKATEARFSDTQ-PHCPEHWGGYRLLPERIEFWQG
PDXH_PSEPK       GSRLGAWAS-PQSRVIAGREELEGLVKATEARFSDTQ-PHCPEHWGGYRLLPERIEFWQG
PDXH_PSEF5       GSRLGAWAS-PQSRVIADRDELQELLKATEARFSDSQ-PDCPEHWGGYRLLPERIEFWQG
PDXH_PSE14       GSRLGAWAS-PQSRVIADRDELEGLIRQTEQRFADTQ-PHCPEHWGGYRLLPERIEFWQG
PDXH_PSEU2       GSRLGAWAS-PQSRVIADRDELEGLIRQTEQRFADTR-PHCPEHWGGYRLLPERIEFWQG
PDXH_PSESM       GSRLGAWAS-PQSRVIADRDELEGLIRQTEQRFADTQ-PHCPEHWGGYRLLPERIEFWQG
PDXH_SYNY3       GSQLGAWAS-PQSRIVGDRQELEDNLARWEKQYENQS-IPRPPHWGGFRVIPHRIEFWQG
PDXH_NOSS1       NSRLGAWVS-NQSEIIASREVLEQRMQEFQHKYENQE-IPRPAHWGGLRVIPSEIEFWQG
PDXH_ACTP2       TSRVGAWAS-NQSQVLSSKSELVAKAALIAAKHP-LH-VPRPPHWGGYIVLPERIEFWQG
PDXH_HAEDU       ASRIGAWAS-DQSQVLSSKRTLVAKVALLSAKYP-LF-VPRPAHWGGYLVQPTKIEFWQG
PDXH_HAEIN       TSRIGAWAS-EQSAVISNYKSLLAKAALVAAKHP-LN-VPRPDYWGGYLVVPETVEFWQG
PDXH_HAEI8       TSRIGAWAS-EQSAVISNYKSLLAKAALVAAKHP-LN-VPRPDYWGGYLVVPETVEFWQG
PDXH_NEIMF       QSRLGAWAS-AQSEVIPNKAVLVAKAAAVGLKHP-LH-VPRPPHWGGYIVIPDLIEFWQG
PDXH_NEIMA       QSRLGAWAS-AQSEVIPNKAVLVAKAAAVGLKHP-LH-VPRPPHWGGYIVIPDLIEFWQG
PDXH_NEIMB       QSRLGAWAS-AQSEVIPNKAVLVAKAAAVGLKHP-LH-VPRPPHWGGYIVIPDLLEFWQG
PDXH_NEIG1       QSRLGAWAS-AQSEVIPNKAVLVAKAAAVGLKHP-LH-VPRPPHWGGYIVIPDLIEFWQG
PDXH_MANSM       TSRIGAWAS-EQSAVISGKNSLLTKAALIAAKHP-LQ-VPRPPHWGGYIVIPELIEFWQG
PDXH_CHRVO       TSRLGAWAS-EQSREIASKATLVTRAAMFGARYP-IN-VPRPPHWGGFAVVPDRVEFWQG
PDXH_BACFN       KSRIGARIS-PQSRPLKSRMQLIRNFVAEAARWVGRE-VERPAHWGGYAVTPHRIEFWQG
PDXH_BACFR       KSRIGARIS-PQSRPLKSRMQLIRNFVAEAARWVGRE-VERPAHWGGYAVTPHRIEFWQG
PDXH_BACTN       KSRIGARIS-PQSQPIASRMQLIRAFVKEAARWLGKE-VERPDNWGGYAVTPTRMEFWQG
PDXH_PORGI       KSRVGARIS-PQSRPIPGRSFIVQEFMKESLKYAGRT-VPRPDTWGGFAVKPVRIEFWQG
PDXH_LEPBJ       GSQIGAVVS-PQSYEIPNRKFLEERFEEFSKLY-EGKEVDLPNHWGGYAVHPNRIEFWQG
PDXH_LEPBL       GSQIGAVVS-PQSYEIPNRKFLEERFEEFSKLY-EGKEVDLPNHWGGYAVHPNRIEFWQG
PDXH_LEPIC       ESQIGALAS-PQSQKIPDRKFLEGRFQKFTNQY-QNKEVDLPNHWGGYAVYPCRIEFWQG
PDXH_LEPIN       ESQIGALAS-PQSQKIPDRKFLEGRFQKFTNQY-QNKEVDLPNHWGGYAVYPCRIEFWQG
PDXH_RHOBA       DSQLGAHVS-QQSSVIDSREAMESSLAQLKARYPEGTQIPLPENWGGYAVTPMSFEFWQG
PDXH_GRAFK       GSQLGAHAS-NQSSVIPSREYLEERLTKLEQKY-LKKEIPKPKEWGGFLFKPVAFEFWQG
PDXH_ACIAD       DSQIAAHISTPQSGIIANREELQQRFNRLYEQVGQQTVLSKPEFWGGYRLQADYYEFWQG
PDXH_DEIRA       ESQLAAHASTPQSAPVENRAALEAKFAALHEQFPEGTTIPRPAFWGGYRVQVQEWEFWQG
PDXH_PSYA2       DSQVGTWVSQPQSGEVASRDVMEQTFEQLQTDYPDGAAVPTPGFWGGYEITVSEIEFWQG
PDXH_ALKEH       ESQIGGWAS-HQSRGLESREVLEQRVAEYAARFPDGEAVPRPPHWSGYRLAPVRIEFWRA
PDXH_HALHL       LSQLGAWAS-HQSEPLASRHELEARLEEVESRFP--ERVPRPPHWSGYRIIPVSIELWSA
PDXH_XANAC       MSQIGAWAS-RQSQALGSREEFDAAIAKVEATFA-GREVPRPDGWGGFRVVPQAFEFWYG
PDXH_XANC5       MSQIGAWAS-RQSQTLGSREEFDAAIAKVEATFE-GREVPRPDGWGGFRVVPQAFEFWYG
PDXH_XANOR       MSQIGAWAS-LQSQTLGSRAEFDAAIAKVEATFE-GREVPRPEGWGGFRVVPQAFEFWYG
PDXH_XANC8       MSQIGAWAS-LQSQTLGSREEFEAAIAKVEATFD-GRDVPRPDGWGGFRVVPQAFEFWYG
PDXH_XANCP       MSQIGAWAS-LQSQTLGSREEFEAAIAKVEATFD-GRDVPRPDGWGGFRVVPQAFEFWYG
PDXH_XYLFA       QSQIGAWAS-MQSCPLGSPEEFQARLAEVKATFE-GRDVPRPEGWVGFRVAPRVLEFWYG
PDXH_XYLFT       QSQIGAWAS-MQSCPLGSPEEFQARLAEVKAMFE-GRDVPRPEEWVGFRVVPQVFEFWYG
PDXH_MYXXA       GSQVGAWAS-LQSQPLATREELEARVAEVEQKYA-GQPVPRPPHWSGFRVVPDRIEFWHA
PDXH_BARHE       DSRIGAWAS-KQSQPLESRFVLEKAIARYTTRYA-VGNIPRPPYWSGFRVKPLSIEFWCD
PDXH_BARQU       GSRIGAWAS-KQSQPLENRFVLEKAIAQYTARYA-VGNIPRPPYWSGFRVKPLSIEFWCD
PDXH_BARBK       GSQIGAWAS-KQSQLLEDRFVLEKEVSRYTADYA-IGNVPRPPYWSGFRIKPLFIEFWRD
PDXH_AGRFC       GSRIGAWAS-KQSRPLEGRFALEKAVAEYTARYA-IGEIPRPSHWSGFRIRPVSIEFWHD
PDXH_RHIME       GSRIGAWAS-KQSRPLESRFALEKAVAEYTARHA-IGEIPRPDYWSGFRIRPLSIEFWHD
PDXH_RHILO       GSRIGAWAS-KQSRPLESRFALEKAVAEYTARYA-IGEIPRPKHWSGFRIVPKTIEFWHD
PDXH_BRUME       GSRIGAWAS-KQSRPLESRFALEKAVAEYTAKYA-IGDIPRPPYWSGFRIRPVSIEFWHD
PDXH_BRUSU       GSRIGAWAS-KQSRPLESRFALEKAVAEYTAKYA-IGDIPRPPYWSGFRIRPVSIEFWHD
PDXH_RHOPS       QAQIGAWAS-KQSQPLESRFAFEQAIAKVAARYL-VGEVPRPPGWSGWRITPLRFEFWHD
PDXH_RHOPA       QAQIGAWAS-KQSQPLESRFAFEQAIAKVTARHL-IGDVPRPPGWSGWRITPSRIEFWHD
PDXH_RHOP5       QAQIGAWAS-KQSQPLESRFAFEQAIAKVAAKHL-LGEVPRPPGWSGWRVTPSHIEFWHD
PDXH_BRADU       QAQIGAWAS-KQSEALESRFAFEQAIAKVAAKYI-IGEVPRPPGWSGWRITPVRIEFWHD
PDXH_NITWN       QAQIGAWAS-RQSRPLESRLAFEQAIAKEAAKYA-IGAVPRPPGWSGWRITPLQFEFWHD
PDXH_MARMM       DSRIGAWAS-KQSRPLESRFALEKSVAREAARFG-LGEVPRPPHWSGFRIRPLSLEFWRD
PDXH2_RALSO      ASRIGAWAS-KQSRPLENRTALAKSVATEAARFG-ISDIPRPAFWTGFRIVPNCIEFWMD
PDXH_CAUVC       HSQIGAWAS-DQSQPLPDRHALEKRVAEMGLKFG-LGKVPRPPHWSGYRITPVTIEFWRD
PDXH_CERS1       KSRLGAWAS-EQSRPLASRTSLLAEVARVTARFG-TNP-PRPAFWGGFRIRPLEIEFWAD
PDXH_RUEPO       KSRLGAWAS-RQSRPLSSRAALMAEVAKITAAKG-PNP-PRPPFWGGFRLTPVEIEFWAD
PDXH_JANSC       KSRLGAWAS-DQSKPLSSRGALMADVARVTAEQG-TNP-KRPPFWGGVRITPLEIEFWAD
PDXH_PARDP       QSRIGAWAS-RQSRPLASRGALMAEVARLGISLG-LNP-SRPPHWGGYRIHPVQIEFWAD
PDXH_HYPNA       QSRISAIAS-DQSRPLADRAIFEQRVAEISSVYGDDNDIPRPPHWGGFRLVPTEIEFWQD
PDXH_ERYLH       ESQLGAVAS-DQSRPLEDRRVFVDRFRAAQERFD-EGEVERPAYWTGFTVTPQRIEFWCD
PDXH_GLUOX       MSRLGAIAS-DQSRPLDDRSTFEERLKAVDEKYG-DGPIPRPANWSGFRVLPEAIEFWQD
PDXH_GRABC       ISRLGARAS-DQSRPLPDRKTLQKRVEEEEARYP-GDDIPRPAYWSGYRVTPTVIEFWQQ
PDXH_ZYMMO       KSQLGAWAS-EQSRPLPARDVFEKRIADIEARYE-GKDVPRPPYWTGFRVSPIRMEFWND
PDXH_PELUB       ESRIGAWAS-KQSTVINNRDELLNSIEEYKKKYSNKNDVPRPEHWSGWNLIPTSIEFWLD
PDXH_EHRRG       GSQISACCS-KQSNILEDKQEFITNVQKMTKEFM-GKPVPRPSYWMGLRVVPMLIEFWQE
PDXH_EHRRW       GSQISACCS-KQSNILEDKQEFITNVQKMTKEFM-GKPVPRPSYWMGLRVVPMLIEFWQE
PDXH_EHRCJ       GSKIGAWCS-KQSSVLEDRMSFLKSIEKMTAEFH-GKSIPRPDYWVGVVVVPMLMEFWQE
PDXH_WOLPM       GSQISAWCS-KQSSILKDWQDFEQAIKLKEKEFH-NTQVSRPDFWVGFCVIPKVIEFWQE
PDXH_ANAMM       ESKISAWCS-QQSAVLESRKLLLEQFERERQRFD-GQEIPRPGHWGGVRVVPHVVEFWED
PDXH_BDEBA       LSQIGAWAS-HQSETIPALDWLSRRVQEYEKQFD-GQVVPRPPHWGGWRVIPTEIEFWFG
                   : .   *  **  :     :                   *  * *  .     ::*  

PDXH_AERHH       GEHRLHDRFYYTREGE-----------------GWHIERLAP
PDXH_AERS4       GEHRLHDRFYYTREGD-----------------GWHIERLAP
PDXH_ECOK1       GEHRLHDRFLYQREND-----------------AWKIDRLAP
PDXH_ECOL6       GEHRLHDRFLYQREND-----------------AWKIDRLAP
PDXH_SHISS       GEHRLHDRFLYQREND-----------------AWKIDRLAP
PDXH_SHIF8       GEHRLHDRFLYQREND-----------------AWKIDRLAP
PDXH_SHIBS       GEHRLHDRFLYQREND-----------------AWKIDRLAP
PDXH_SHIDS       GEHRLHDRFLYQREND-----------------AWKIDRLAP
PDXH_ECOLI       GEHRLHDRFLYQREND-----------------AWKIDRLAP
PDXH_SHIFL       GEHRLHDRFLYQREND-----------------AWKIDRLAP
PDXH_ECO57       GEHRLHDRFLYQREND-----------------AWKIDRLAP
PDXH_SALCH       GEHRLHDRFLYQRDDG-----------------AWKIDRLAP
PDXH_SALPA       GEHRLHDRFLYQRDDG-----------------AWKIDRLAP
PDXH_SALTY       GEHRLHDRFLYQRDDG-----------------AWKIDRLAP
PDXH_SALTI       GEHRLHDRFLYQRDDG-----------------AWKIDRLAP
PDXH_PECAS       GEHRLHDRFFYQRQEE-----------------NWQIDRLAP
PDXH_YERPE       GEHRLHDRFIYQREAD-----------------AWKIDRLAP
PDXH_YERPS       GEHRLHDRFIYQREAD-----------------AWKIDRLAP
PDXH_YERE8       GEHRLHDRFIYQRNAD-----------------TWKIDRLAP
PDXH_PHOLL       GANRLHDRFIYQRQGD-----------------SWHVDRLAP
PDXH_VIBVU       GEHRLHDRFLYSQEQG-----------------EWHIDRLAP
PDXH_VIBVY       GEHRLHDRFLYSQEQG-----------------EWHIDRLAP
PDXH_VIBPA       GEHRLHDRFLFSQHDG-----------------EWDIDRLAP
PDXH_VIBCH       GEHRLHDRFLYSRQDD-----------------NWTVDRLAP
PDXH_ALIF1       GDHRLHDRFLYSKDQN-----------------DWQIDRLAP
PDXH_PHOPR       GENRLHDRFIYSHESS-----------------HWNIDRLAP
PDXH_SHEDO       GEHRLHDRFIYTKAAS-----------------EWQIDRLAP
PDXH_SHEFN       GEHRLHDRFIYTKTDA-----------------DWNIDRLAP
PDXH_SHESA       GEHRLHDRFLYTRQAD-----------------EWVIDRLAP
PDXH_SHESM       GEHRLHDRFLYTRQAD-----------------EWVIDRLAP
PDXH_SHESR       GEHRLHDRFLYTRQAD-----------------EWVIDRLAP
PDXH_SHEON       GEHRLHDRFLYTREAQ-----------------AWQIDRLAP
PDXH_SHESW       GEHRLHDRFIYTRDNT-----------------QWIIDRLAP
PDXH_SHEAM       GEHRLHDRFIYEKTAA-----------------GWDIERLAP
PDXH_SHELP       GEYRLHDRFLYSRKDSSLK------------EGGWDIDRLAP
PDXH_PSEA6       GEHRLHDRFLFSRENSS----------------NWSIQRLMP
PDXH_PSET1       GAHRLHDRFMYQRQADN----------------SWQITRLNP
PDXH_BLOPB       GTHRLHDRFIYQRYKH-----------------TWRIYRLSP
PDXH_BLOFL       GIYRLHDRFLYKKNKK-----------------KWYINRLSP
PDXH_WIGBR       RKNRLHDRFIYKKIHS-----------------KWNIYRLSP
PDXH_IDILO       GQHRLHDRYQYSKDRE-----------------NWRITRLQP
PDXH_PROM3       RENRLNDRFRYRPQQDSHH------------AQTWRIERLAP
PDXH_PROMM       RENRLNDRFRYRPQQDSNH------------AQTWRIERLAP
PDXH_RUTMC       RENRLHDRFIYQLSED-----------------KWRIERLAP
PDXH_MARN8       RPSRLHDRFEYVREGD-----------------GWTIQRLQP
PDXH_PSYIN       KADRLHDRFVYQPTEK-----------------NWTVKRLNP
PDXH_COLP3       RANRLHDRLCFEKDGE-----------------TWLNHKLNP
PDXH_LEGPA       RDNRLHDRIHYYRHGH-----------------EWTHRRLAP
PDXH_LEGPH       RDNRLHDRIHYYRHGH-----------------EWTHRRLAP
PDXH_LEGPL       RDNRLHDRIHYYRHGH-----------------EWTHRRLAP
PDXH_COXBU       QEHRLHDRFCYLKENQ-----------------EWKIIRLAP
PDXH_STRAW       RWNRLHDRLRYVAE----P------------DGSWRVERLSP
PDXH_STRCO       RENRLHDRLRYVAE----G------------GGGWRVERLSP
PDXH_FRAAA       RTNRLHDRLRYRRVC---T------------ADRWAVERLSP
PDXH_THEFY       RSDRMHDRFRYRLVSGTPS------------EGAWQIDRLSP
PDXH_ACIC1       RPARMHDRLRYRRTAD--G------------ERPWIIERLSP
PDXH_MYCA1       RENRLHNR--IRVT-----------------GNR--VERLQP
PDXH_MYCPA       RENRLHNR--IRVT-----------------GDR--VERLQP
PDXH_MYCLE       RENRVHNR--IRVT-----------------GGC--IERLQP
PDXH_MYCSK       RESRVHNR--IRVH-----------------DGR--IERLQP
PDXH_MYCSS       RESRVHNR--IRVH-----------------DGR--IERLQP
PDXH_MYCSJ       RESRVHNR--IRVH-----------------DGR--IERLQP
PDXH_MYCVP       RENRVHNR--IRVC-----------------GGQ--VERLQP
PDXH_MYCBO       RENRMHNR--IRVA-----------------NGR--LERLQP
PDXH_MYCTU       RENRMHNR--IRVA-----------------NGR--LERLQP
PDXH_MYCBP       RENRMHNR--IRVA-----------------NGR--LERLQP
PDXH_NOCFA       RRGRLHNRLLVRVA-----------------GERMTVERLQP
PDXH_SACEN       RPDRLHDRLRFRNN-----------------DGAWVVERLAP
PDXH_NOCSJ       RTGRLHDRLRYRRT-----------------PGGWVTERLAP
PDXH_ACIAC       RKSRLHDRLCYR--E--ET------------PGAWVRERLAP
PDXH_ACISJ       RKSRLHDRLRYR--L--ED-------------GTWERERLAP
PDXH_VEREI       RKSRLHDRLRYR--M--AG-------------GQWVRERLAP
PDXH_POLNA       RKSRLHDRLRYT--L--QG------------DAGWLRERLAP
PDXH_METPP       RKSRLHDRLRYT--Q--QP------------TGGWLRERLAP
PDXH_BURCH       RPSRLHDRLLYTRDA--AA------------ASGWTISRLSP
PDXH_BURCM       RPSRLHDRLLYTRDA--AA------------APDWTISRLSP
PDXH_BURMA       RPSRLHDRLLYTRDA--AS------------ASGWKITRLAP
PDXH_BURPS       RPSRLHDRLLYTRDA--AS------------ASGWKIARLAP
PDXH_CUPNH       RPSRLHDRIAFRLQP--GG--------------DWQIVRLSP
PDXH_CUPPJ       RPSRLHDRIAYRVEA--DG--------------SWKIVRLSP
PDXH1_RALSO      RPSRLHDRLEYRRQP--DG--------------GWHIVRLAP
PDXH_BORBR       RPSRLHDRLRYE--P--DG------------KQGWTIDRLSP
PDXH_BORPA       RPSRLHDRLRYE--P--DG------------KQGWTIDRLSP
PDXH_BORPE       RPSRLHDRLRYE--P--DG------------KQGWTIDRLSP
PDXH_THEVB       RPNRLHDRLCYR-----RQ------------GDHWQRVRLYP
PDXH_PSEAB       RPSRLHDRLDYR-----RQ------------DGGWSRERLAP
PDXH_PSEAE       RPSRLHDRLDYR-----RQ------------DGGWLRERLAP
PDXH_PSEE4       RASRLHDRLNYR-----LV------------DGQWQRERLAP
PDXH_PSEPK       RASRLHDRLNYR-----LV------------DGQWLRERLAP
PDXH_PSEF5       RPSRLHDRLNYR-----LQ------------GQEWVRERLAP
PDXH_PSE14       RSSRLHDRLNYR-----SV------------DGRWTRERLAP
PDXH_PSEU2       RSSRLHDRLNYR-----LI------------DDRWTRERLAP
PDXH_PSESM       RSSRLHDRLNYR-----LI------------NAKWARERLAP
PDXH_SYNY3       RPSRLHDRLQFN-----LL------------DGQWHRQRLAP
PDXH_NOSS1       RSSRLHDRLLYT--L--LN------------DHSWEIHRLSP
PDXH_ACTP2       RPSRLHDRICYRLV-----------------EGAWHKERLSP
PDXH_HAEDU       RPSWLHDRICYWLV-----------------ENEWLKERLSP
PDXH_HAEIN       RPSRLHDRIRYRKE-----------------SDNWIRERLSP
PDXH_HAEI8       RPSRLHDRIRYRKE-----------------SDNWIRERLSP
PDXH_NEIMF       RPSRLHDRIQYRLL-----------------DGGWIRERLSP
PDXH_NEIMA       RPSRLHDRIQYRLL-----------------DGGWIRERLSP
PDXH_NEIMB       RPSRLHDRIQYRLL-----------------DGGWIRERLSP
PDXH_NEIG1       RPSRLHDRIQYRLL-----------------DGGWIRERLSP
PDXH_MANSM       RPSRLHDRIRYRLE-----------------KGEWVRERLSP
PDXH_CHRVO       RPSRLHDRVLYTLQP----------------DGGWSRSRLAP
PDXH_BACFN       RANRLHDRFLYSLQP----------------DGSWQKERLAP
PDXH_BACFR       RANRLHDRFLYSLQP----------------DGSWQKERLAP
PDXH_BACTN       RPNRLHDRFLYTLKT----------------DGKWEINRLSP
PDXH_PORGI       RESRLHDRFLYELRP----------------DASWSVHRLAP
PDXH_LEPBJ       RSSRLHDRIVFEKDT--DS------------S--WKKFRVAP
PDXH_LEPBL       RSSRLHDRIVFEKDT--DS------------S--WKKFRVAP
PDXH_LEPIC       RSSRLHDRIVFERDT--SS------------S--WEKFRIAP
PDXH_LEPIN       RSSRLHDRIVFERDT--SS------------S--WEKFRIAP
PDXH_RHOBA       RPSRLHDRLVYKRDD--AD------------SNDWVMQRLSP
PDXH_GRAFK       RASRLHDRILFTK-K--DD------------N--WKIERLAP
PDXH_ACIAD       RPNRLHDRLSYQNT---DG------------T--WVVQRLMP
PDXH_DEIRA       RPNRMHDRFRYARD---GD------------G--WRLDRLMP
PDXH_PSYA2       RANRMHDRIVYHKEV--DG------------S--FSTKRLLP
PDXH_ALKEH       RPGRLHERDVYEHTAEG-----------------WCHRLLNP
PDXH_HALHL       GDGRLHQRERYEHRTDG-----------------WSHFLLNP
PDXH_XANAC       AKFRLHERWRYEADAASH----------------WSKRMLYP
PDXH_XANC5       AKFRLHERWRYEADAASH----------------WSKRMLYP
PDXH_XANOR       AKFRLHERWRYEADAASH----------------WSKRMLYP
PDXH_XANC8       AKFRLHERWRYEADAASH----------------WSKRMLYP
PDXH_XANCP       AKFRLHERWRYEADAASH----------------WSKRMLYP
PDXH_XYLFA       ARFRLHERWRYEVDAAGY----------------WRKFLLYP
PDXH_XYLFT       ASFRLHERWRYQADAAGY----------------WRKSLLYP
PDXH_MYXXA       QESRLHDRHVYLREDGG-----------------WRTQMLYP
PDXH_BARHE       RPFRLHDRLLFTRDSVEHV--------------DWKRQKLYP
PDXH_BARQU       RPFRLHDRLLFTRDSVEQV--------------DWQRQKLYP
PDXH_BARBK       RPSRLHDRLLFTRDFLEQN--------------NWKKQRLYP
PDXH_AGRFC       RKFRLHDRIEFRRETP-DG--------------AWSKVRMYP
PDXH_RHIME       RPFRLHDRVEFRRETP-DG--------------GWTKVRMYP
PDXH_RHILO       RPFRLHDRVVFSRNA--KG--------------DWDKARLYP
PDXH_BRUME       RPFRLHDRVLFTRPTP-EG--------------DWNKDRLYP
PDXH_BRUSU       RPFRLHDRVLFTRPTP-EG--------------DWNKDRLYP
PDXH_RHOPS       RPFRLHDRIEFSRDTP-AQ--------------PWIKTRLYP
PDXH_RHOPA       RPFRLHDRIEFRRDTP-DH--------------PWTKTRLYP
PDXH_RHOP5       RPFRLHDRIEFRRDDP-AH--------------PWSKTRLYP
PDXH_BRADU       RPFRLHDRIEFRRDAA-GQ--------------KWSKTRMYP
PDXH_NITWN       RPFRLHDRIEFRRSAL-DV--------------PWTKTRLYP
PDXH_MARMM       RPFRLHDRMFFDRPDL-GS--------------TWTVTRLYP
PDXH2_RALSO      KPFRLHDRLVFKRSHS-GE--------------PWSALKLYP
PDXH_CAUVC       RPFRLHERLVFDRADG-----------------GWTTKRLFP
PDXH_CERS1       GAFRLHDRFRWRRNSLSDG---------------WSIERLNP
PDXH_RUEPO       GAFRLHDRFVWRRNSAGES---------------WVIQRLNP
PDXH_JANSC       GAFRLHDRFQWRRGSVDDP---------------WEVQRLNP
PDXH_PARDP       GAFRLHDRFRWTKSSYQGENSALRDEGQEVPQSLWQVCRLSP
PDXH_HYPNA       QAFRMHDRLRFYRKAD----------------GGWATVRLYP
PDXH_ERYLH       RPNRLHDRRLFTLSGAGDA-------------LSWTSTLLYP
PDXH_GLUOX       RPYRLHDRAVWTRDGNG-----------------WNVTRLYP
PDXH_GRABC       MPFRLHDRLVFRRQGKN-----------------WGQEKLYP
PDXH_ZYMMO       REFRLHERELFTLNDGR-----------------WQSEFLYP
PDXH_PELUB       GESRIHERLKYTKDTE----------------GNWVKSLLSP
PDXH_EHRRG       GVDRIHTRYQYTRTDKHG----------------WSIVELYP
PDXH_EHRRW       GVDRIHTRYQYTRTDKHG----------------WSIVELYP
PDXH_EHRCJ       GLNRIHTRYQYTRSNNMDV---------------WNVVELYP
PDXH_WOLPM       GEYRKHIRFRYTLVEGSD----------------WKVEQLYP
PDXH_ANAMM       GAHRLHSRKQYSRGDSGS----------------WSCVDLYP
PDXH_BDEBA       LGGRLHERHIYQRTEDGG----------------WKTFLRSP
                      : *                                 *