CLUSTAL format seed alignment for MF_01631

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

GLMU_ECOLI      ------MLNNAMSVVILAAGKGTRMYSDLPKVLHTLAGKAMVQHVIDAANELGAAHVHLV
GLMU_ECO57      ------MLNNAMSVVILAAGKGTRMYSDLPKVLHTLAGKAMVQHVIDAANELGAAHVHLV
GLMU_SHIFL      ------MLNNAMSVVILAAGKGTRMYSDLPKVLHTLAGKAMVQHVIDAANELGAAHVHLV
GLMU_SHIDS      ------MLNNAMSVVILAAGKGTRMYSDLPKVLHTLAGKAMVQHVIDAANELGAAHVHLV
GLMU_SHISS      ------MLNNAMSVVILAAGKGTRMYSDLPKVLHTLAGKAMVQHVIDAANELGAAHVHLV
GLMU_SHIBS      ------MLNNAMSVVILAAGKGTRMYSDLPKVLHTLAGKAMVQHVIDAANELGAAHVHLV
GLMU_ECOL6      ------MLNNAMSVVILAAGKGTRMYSDLPKVLHTLAGKAMVQHVIDAANELGAAHVHLV
GLMU_SALPA      ------MLNSAMSVVILAAGKGTRMYSDIPKVLHTLAGKPMVQHVIDAATKLGAAQVHLV
GLMU_SALTY      ------MLNSAMSVVILAAGKGTRMYSDIPKVLHTLAGKPMVQHVIDAATKLGAAQVHLV
GLMU_SALCH      ------MLNSAMSVVILAAGKGTRMYSDIPKVLHTLAGKPMVQHVIDAATKLGAAQVHLV
GLMU_SALTI      ------MLNSAMSVVILAAGKGTRMYSDIPKVLHTLAGKPMVQHVIDAATKLGAAQVHLV
GLMU_YERPE      ------MSNSSMSVVILAAGKGTRMYSDLPKVLHPLAGKPMVQHVIDAAMKLGAQHVHLV
GLMU_YERPS      ------MSNSSMSVVILAAGKGTRMYSDLPKVLHPLAGKPMVQHVIDAAMKLGAQHVHLV
GLMU_PECAS      ------MLNSAMSVVILAAGKGTRMYSDLPKVLHKLAGKPMVQHVIDAAMTTGAQHVHLV
GLMU_PHOLL      ------MSNSAKSVVILAAGKGTRMYSDLPKVLHLLAGKPMVQHVIDTAMALGAKNVHLV
GLMU_HAEIN      ------MTKKALSAVILAAGKGTRMYSDLPKVLHTIAGKPMVKHVIDTAHQLGSENIHLI
GLMU_HAEI8      ------MTKKALSAVILAAGKGTRMYSDLPKVLHTIAGKPMVKHVIDIAHQLGSENIHLI
GLMU_MANSM      --------MKKLSVVILAAGKGTRMYSDLPKVLHKIAGKPMVKHVIDTAKQLSADQIHLI
GLMU_PASMU      ------MKEKALSIVILAAGKGTRMYSDLPKVLHKIAGKPMVKHVIDTVKSIHAKNIHLV
GLMU_HAEDU      ------MKMTPFSVVILAAGKGTRMYSDLPKVLHPIAGKSMVKHVIDTVKQMDAKQIHLV
GLMU_VIBVU      ---------MKFSAVILAAGKGTRMYSNMPKVLHTLAGKPMVKHVIDTCTGLGAQNIHLV
GLMU_VIBVY      ---------MKFSAVILAAGKGTRMYSNMPKVLHTLAGKPMVKHVIDTCTGLGAQNIHLV
GLMU_VIBPA      ---------MKFSAVILAAGKGTRMHSNMPKVLHTLAGKPMVKHVIDTCTGLGAQNIHLV
GLMU_VIBCH      ---------MKFSTVILAAGKGTRMHSNMPKVLHTLAGKPMVKHVIDTCNNLGAQNIHLV
GLMU_ALIF1      ---------MNFSAVILAAGKGTRMYSNKPKVLHTLAGKPMAKHVIDTCEGLGAQNIHLV
GLMU_PHOPR      ---------MSFSAVILAAGKGTRMYSNVPKVLHTLAGKPMAKHVIDTCSDLGASHIHLV
GLMU_COLP3      ---------MSLSVVILAAGKGTRMRSSLPKVLHSVAEKPMVGHVIDSARQLGASNIYVV
GLMU_PSET1      ---------MSLTTVILAAGKGTRMRSALPKVLHKVAGKTMVQHVIDNAKALGATTTNLV
GLMU_SHEON      ---------MALNVVILAAGKGTRMRSDLPKVLHPIAHKSMVQHVIDTAHSIGSDAIQLV
GLMU_IDILO      ---------MKLRVVILAAGKGTRMRSELPKVLHKVANKPMVEHVIDTARSLKPDAINLI
GLMU_PSESM      ---------MSLDIVILAAGQGTRMRSALPKVLHPVAGNSMLGHVIHSARQLSPVGIHVV
GLMU_PSEU2      ---------MSLDIVILAAGQGTRMRSALPKVLHPVAGNSMLGHVIHSARQLSPSGIHVV
GLMU_PSE14      ---------MSLDIVILAAGQGTRMRSALPKVLHPVAGNSMLGHVIHSARQLSPNGIHVV
GLMU_PSEPK      ---------MSLDIVILAAGQGTRMRSALPKVLHPVAGNSMLGHVIHSARQLQPQGIHVV
GLMU_PSEF5      ---------MSLEIVILAAGQGTRMRSALPKVLHPVAGNSMLGHVIHSARQLDPQRIHVV
GLMU_PSEPF      ---------MSLEIVILAAGQGTRMRSALPKVLHPIAGDSMLGHVIHSARQLDPQRIHVV
GLMU_PSEAE      ---------MSLEIVILAAGQGTRMRSALPKVLHPIAGKPMLGHVIDCARQLQPERIHVV
GLMU_NEIGO      ------MPQNTLNTVILAAGKGTRMYSQMPKVLHCIGGKPMVERVIDTAAALNPQNICVV
GLMU_NEIG1      ------MPQNTLNTVILAAGKGTRMYSQMPKVLHCIGGKPMVERVIDTAAALNPQNICVV
GLMU_NEIMA      ------MPQNTLNIVILAAGKGTRMYSKMPKVLHEIGGETMLGRVIDTAAALNPQNICVV
GLMU_NEIMB      ------MPQNTLNIVILAAGKGTRMYSKMPKVLHRIGGKPMVGRVIDTAAALNPQNICVV
GLMU_CHRVO      --------MDSLSIVILAAGKGKRMYSSLPKVLHPIGGEPMLARVIRTARALNPSRLVVV
GLMU_AROAE      -----------MEVVILAAGQGKRMRSALPKVLQPIAGRPMLEHVIAAAQALEARRICVV
GLMU_DECAR      -----------MNIVILAAGQGKRMHSNLPKVLHPIAGKPLAQHVIDTARQLSPEKLIVV
GLMU_BURMA      -----------MNIVILAAGTGKRMRSALPKVLHPLAGRPLLSHVIDTARALAPSRLVVV
GLMU_BURP1      -----------MNIVILAAGTGKRMRSALPKVLHPLAGRPLLSHVIDTARALAPSRLVVV
GLMU_BURPS      -----------MNIVILAAGTGKRMRSALPKVLHPLAGRPLLSHVIDTARALAPSRLVVV
GLMU_BURL3      -----------MNIVILAAGTGKRMRSALPKVLHPLAGRPLLSHVIDTARTLQPSRLVVV
GLMU_CUPPJ      -----------MNIVILAAGMGKRMHSDLPKVLHPVAGRPMLAHVIDTARTLSPSRLVVV
GLMU_RALSO      -----------MNIVILAAGLGKRMRSALPKVLHPLAGKPLLAHVIETARSLSPTRLVVV
GLMU_THIDA      -------MHPKLDILILAAGKGTRMRSDLPKVLHQLAGRPLLGHVVATAQALGAARTCVV
GLMU_BORBR      ----------MLNVVILAAGLGKRMQSDLPKVLHTLAGRPMLDHVIGSARQLQPARIIVV
GLMU_BORPA      ----------MLNVVILAAGLGKRMQSDLPKVLHTLAGRPMLDHVIGSARQLQPARIIVV
GLMU_BORPE      ----------MLNVVILAAGLGKRMQSDLPKVLHTLAGRPMLDHVIGSARQLQPARIIVV
GLMU_NITEU      --------MLQVDVVILAAGMGKRMCSSLPKVLHPLAGKPILSHVLDIARTLSPERICVV
GLMU_LEGPA      ---------MNLQIIILAAGQGKRMYSDTPKVLHHLAGKPLLTHVVETAQQLNPDAIHVI
GLMU_LEGPH      ---------MNLQIIILAAGQGKRMYSDTPKVLHHLAGKPLLTHVVETAQQLNPNAIHVI
GLMU_LEGPL      ---------MNLQIIILAAGQGKRMYSDTPKVLHHLAGKPLLTHVVETAQQLNPDAIHVI
GLMU_COXBU      ---------MGLSVIILAAGQGKRMASSTPKILHPLGGIPLLERVVNTARLLNPHTIHVV
GLMU_METCA      ---------MEVIALILAAGQGTRMRSGLPKVLHRIGGLCLLEHVYRLAAALEVRETVIV
GLMU_NITOC      ---------MAVSVIILAAGQGTRMHSTLPKVLHQLAGRPLLSHVIATARQLNPAQIIVV
GLMU_XANAC      -------MTLPLHVLILAAGEGKRMRSSLPKVLQPLAGQPMLAHVIATARQLQPAAIHIV
GLMU_XANC5      -------MTLPLHVVILAAGEGKRMRSSLPKVLQPLAGQPMLAHVIATARQLQPAAIHIV
GLMU_XANOR      -------MTLPLHVVILAAGEGKRMRSSLPKVLQPLAGQPMLAHVIATARQLQPAAIHIV
GLMU_XANC8      -------MTLPLHVVILAAGEGKRMRSALPKVLQPLAGQPMLAHVIATARELQPAAIHVV
GLMU_XANCP      -------MTLPLHVVILAAGEGKRMRSALPKVLQPLAGQPMLAHVIATARELQPAAIHVV
GLMU_XYLFA      -----MPLSLPLHIVILAAGEGKRMKSALPKVLHPIAGKPMLAHVITAAQALTPDAIHVV
GLMU_XYLFT      -----MPLSLPLHIVILAAGEGKRMKSALPKVLHPIAGKPMLAHVITTARALTPDAIHVV
GLMU_ACIAD      ---------MTTTVIILAAGKGTRMRSHLPKVLQPLAGRPLLGHVIQTAKQLNANNIITI
GLMU_PSYA2      -------MISPLSVIILAAGKGTRMQSAKPKVLQTLAGKSLLGHVLDTCHQLTVDDTIIV
GLMU_FRATT      ---------MGLSVVILAAGKGSRMNSNKPKVLQTLAAKTLIEHVVSSVEKLNPDNIVVV
GLMU_BUCAI      ------MLTQEIIIVILAAGKGTRMKSNHPKVLHFLGGKTILEHVIETAQSIKPKKIILV
GLMU_BUCAP      ------MLKKEINVVILAAGKGTRMQSSYPKVLHKLGGKTILEHVINIAKSVKPKKIILV
GLMU_BUCBP      ------MNNHTLNIIILAAGKGTRMQFDHPKLLHLLGGKPILEHVINLAQSLCPKTITVI
GLMU_WIGBR      ----MNVLLQELFIIILSAGKGKRMFTSIPKVLHKLAGKPILQHIIDKVLYLKAKKINIV
GLMU_BLOFL      ------MLRKKYSVIILAAGQGKRMLSSIPKVMHKIAGRSMLQHLIDSVSKINIQSIYIV
GLMU_BLOPB      ------MSYINFSAIILAAGRGNRMLSDTPKVLYQIGGKFMLQHLIDSVMQVGVSSIYVV
GLMU_CAMJE      ---------MKTSILILAAGLGTRIKSQKPKVLQELCQKSMILHILKKAFALSDDVSVVL
GLMU_CAMJR      ---------MKTSILILAAGLGTRMKSQKPKVLQELCQKSMILHILKKAFALSDDVSVVL
GLMU_HELHP      ---------MNVSVVILAAGAGTRMKSHIPKVLHKICGKEMLFYSIDEALKISDDVHIVL
GLMU_WOLSU      ---------MNLSIVILAAGAGTRMKSKTPKVLHTLCGREMLYYVIKEAKKLSDDVSVVL
GLMU_HELPJ      ----------MLSVIILAAGKGTRMHSSLPKTLHTICGEPMLFYILEVAFSISNDVHLVL
GLMU_HELPY      ----------MLSVIILAAGKGTRMRSSLPKTLHTICGEPMLFYILETAFSISDDVHLIL
GLMU_GEOSL      --------MDNLAAIILAAGKGTRMKSGIVKVMHPLAGAPMVAWPVAVARQAGAGRIVAV
GLMU_PELCD      ------MKHDELAAVILAAGKGTRMKSEQPKVLHPIAGKPMVTFPVAGALKHGCQPTVLV
GLMU_BACSU      --------MDKRFAVVLAAGQGTRMKSKLYKVLHPVCGKPMVEHVVDEALKLSLSKLVTI
GLMU_BACLD      --------MDKRFAVVLAAGQGTRMKSKLYKVLHPVCGKPMVEHVVDEARKLSLEKLVTI
GLMU_BACAN      --------MSNRFAVILAAGKGTRMKSKLYKVLHPVCGKPMVQHVVDQVSQLGLQKLVTV
GLMU_BACC1      --------MSNRFAVILAAGKGTRMKSKLYKVLHPVCGKPMVQHVVDQVSQLGLQKLVTV
GLMU_BACHK      --------MSNRFAVILAAGKGTRMKSKLYKVLHPVCGKPMVQHVVDQVSQLGLQKLVTV
GLMU_BACCZ      --------MSNRFAVILAAGKGTRMKSKLYKVLHPVCGKPMVQHVVDQVSQLGLQKLVTV
GLMU_BACCR      --------MSNRFAVILAAGKGTRMKSKLYKVLHPVCGKPMVQHVVDQVSQLGLQKLVTV
GLMU_GEOKA      ---------MKRYAVILAAGQGTRMKSKRYKVLHPICGKPMVQHVIDQVSKLGVEKAIAV
GLMU_ALKHC      --------MSNRFAVILAAGQGTRMKSKLYKVLHSVCGKPMVQHVVDQVSALGFDEIVTI
GLMU_OCEIH      --------MANRFAVILAAGQGTRMKSKLHKMLHPVAGRPMVQHVVDQLQQVNLNKIVTI
GLMU_LISMF      --------MSKRYAVVLAAGQGTRMKSKLYKVLHPVCGKPMVEHVVDQISTLNVDKVVTI
GLMU_LISMO      --------MSKRYAVVLAAGQGTRMKSKLYKVLHPVCGKPMVEHVVDQISTLNVDKVVTI
GLMU_LISIN      --------MSKRYAVVLAAGQGTRMKSKLYKVLHPVCGKPMVEHVVDQISTLDVDKVVTI
GLMU_BACSK      --------MSGRFAVILAAGQGTRMKSKLYKVLHPVCGKPMVEHVVDQVSKLEFDKTAVI
GLMU_LACPL      --------MTTKNAIIMAAGKGTRMKSKLVKVLHQVCGKSMVDHVLTQVEATHMANIVTI
GLMU_LACSS      --------MVNKNAIILAAGKGTRMKSKLYKVLHEVCGRPMVDHVLTEVEKTEPATVVTI
GLMU_ENTFA      --------MENRYAIILAAGKGTRMKSKLYKVLHPVAGKPMVEHILDQVEQTEPTEIVTI
GLMU_LACAC      ---------MEKYVVVLAAGKGTRMKSKLYKVLHKVCGKTMVEHVVDAASGVEPTEIVTV
GLMU_LACJO      ---------MNKYVVILAAGKGTRMKSKLYKVLHKVCGKTMVEHVVEAAKGTNPDKIITV
GLMU_STAAC      ---------MRRHAIILAAGKGTRMKSKKYKVLHEVAGKPMVEHVLESVKGSGVDQVVTI
GLMU_STAAS      ---------MRRHAIILAAGKGTRMKSKKYKVLHEVAGKPMVEHVLESVKGSGVDQVVTI
GLMU_STAAW      ---------MRRHAIILAAGKGTRMKSKKYKVLHEVAGKPMVEHVLESVKGSGVDQVVTI
GLMU_STAAR      ---------MRRHAIILAAGKGTRMKSKKYKVLHEVAGKPMVEHVLESVKGSGVDQVVTI
GLMU_STAAM      ---------MRRHAIILAAGKGTRMKSKKYKVLHEVAGKPMVEHVLESVKGSGVDQVVTI
GLMU_STAAN      ---------MRRHAIILAAGKGTRMKSKKYKVLHEVAGKPMVEHVLESVKGSGVDQVVTI
GLMU_STAEQ      ---------MQRHAIILAAGKGTRMKSKKYKVLHEVAGKPMVEHVLNNVKQAGVDQIVTI
GLMU_STAES      ---------MQRHAIILAAGKGTRMKSKKYKVLHEVAGKPMVEHVLNNVKQAGVDQIVTI
GLMU_STAEP      ---------MQRHAIILAAGKGTRMKSKKYKVLHEVAGKPMVEHVLNNVKQAGVDQIVTI
GLMU_STAHJ      ---------MQRNAVILAAGKGTRMKSNKYKVLHKVAGKSMVEHVLTNVKNAGVNQIVTI
GLMU_STAS1      ---------MQRHAIVLAAGKGTRMKSKKYKVLHDVAGKTMIEHVADNVKQSGIDQLVTI
GLMU_STRA1      ---------MSNYAIILAAGKGTRMKSDLPKVMHKVSGITMLEHVFRSVQAIEPSKIVTV
GLMU_STRA5      ---------MSNYAIILAAGKGTRMKSDLPKVMHKVSGITMLEHVFRSVQAIEPSKIVTV
GLMU_STRA3      ---------MSNYAIILAAGKGTRMKSDLPKVMHKVSGITMLEHVFRSVQAIEPSKIVTV
GLMU_STRT1      ---------MSHYAIILAAGKGTRMKSDLPKVLHKVSGITMLEHVFRAVSVIEPAKNVTV
GLMU_STRT2      ---------MSHYAIILAAGKGTRMKSDLPKVLHKVSGITMLEHVFRAVSVIEPAKNVTV
GLMU_STRPN      ---------MSNFAIILAAGKGTRMKSDLPKVLHKVAGISMLEHVFRSVGAIQPEKTVTV
GLMU_STRR6      ---------MSNFAIILAAGKGTRMKSDLPKVLHKVAGISMLEHVFRSVGAIQPEKTVTV
GLMU_STRMU      ---------MTNYAIILAAGKGTRMKSDLPKVLHQVAGLTMLEHVKRAVDTMNPAKTVTV
GLMU_STRP1      ---------MTNYAIILAAGKGTRMTSDLPKVLHKVSGLTMLEHVFRSVKAISPEKSVTV
GLMU_STRPM      ---------MTNYAIILAAGKGTRMTSDLPKVLHKVSGLTMLEHVFRSVKAISPEKSVTV
GLMU_STRP6      ---------MTNYAIILAAGKGTRMTSDLPKVLHKVSGLTMLEHVFRSVKAISPEKAVTV
GLMU_STRP3      ---------MTNYAIILAAGKGTRMTSDLPKVLHKVSGLTMLEHVFRSVKAINPEKAVTV
GLMU_STRP8      ---------MTNYAIILAAGKGTRMTSDLPKVLHKVSGLTMLEHVFRSVKAISPEKSVTV
GLMU_STREC      ---------MKNYAIILAAGKGTRMNSGLPKVLHKVSGLSMLEHVLKSVSALAPQKQLTV
GLMU_LACLA      ---------MNKFAIVLAAGKGTRMKSALPKVLHQVAGKSMLAHVLTSVSEVEIAKNVVI
GLMU_CLOPE      ---------MNKCAIILAAGQGTRIKSKLPKVLHKACGKEMVNHVIDAMRNAEIEDVNVI
GLMU_CLOTE      ---------MYNCAILLAAGEGKRMKSATPKVLHKVCGKEMVNHVIDALREANIEDVNVI
GLMU_CLOAB      ---------MYKCALILAAGKGKRMKSDLPKVLHKVCDKEMVNHVIDTMRKSELQDVNVV
GLMU_CALS4      --------MEELVSVILAAGLGKRMKSKYPKVVHKVCGKPMVKWVVEAAQEAGSKEVIVV
GLMU_CARHZ      -----------MEGIILAAGKGTRMKSDLPKVVHEVAEKPMVLRVYEALVGAGVKRVVAV
GLMU_SYMTH      --------MSDITAVLLAAGHGTRMKSDLIKVMHPLAGKPMIGHIVDNVRRAGLEDIVVV
GLMU_NOSS1      ----------MVVVAILAAGRGTRMKSDLPKVLHSLGGRSLVERVIDSVEPLSPSRRLVI
GLMU_THEEB      ----------MVIVAVLAAGRGTRMKSSLPKVLHPLGGRSLVGWVLHQVQSLQPQRQFVI
GLMU_SYNP6      ----------MVAVAILAAGKGTRMKSQLPKVLHRLGSQTLLDRVLASLTPLNVDRCFVI
GLMU_SYNY3      ----------MVAVAVLAAGKGTRMKSDLPKVLHQLGGYSLVERVLQSCRPLAPERQILI
GLMU_GLOVI      -------MSARLAAIVLAAGKGTRMRSTLPKVLHPLAGSTILERVLAALGELALAECFIV
GLMU_PROMA      ----------MLAIAILAAGKGTRMQSTLPKVLQELSGLTLLERVLTSCKDLTPDRSLII
GLMU_PROMT      ----------MLAIAILAAGKGTRMKSKLPKVLHPLAGKSLIDRVLSCTHGLKPNRRLIV
GLMU_PROMM      ----------MLAVAILAAGKGTRMKSCLPKVLQPLAGSTLVERVLTSCSGLQPQRRLLI
GLMU_SYNPX      ----------MLAVAVLAAGKGTRMKSALPKVLQPLAGATLVERVLASAANLQPDRRMLI
GLMU_PROMP      ----------MLTVAILAAGKGTRMTSLLPKVLHKLSGKTLLQRVINSCNELKPDKIFII
GLMU_COREF      ----MSASDSSSAVVVLAAGAGTRMKSDLQKTLHSIGGRSLISHSLHAAAGLNPTHIVAV
GLMU_CORGL      ----MSASDFSSAVVVLAAGAGTRMKSDLQKTLHSIGGRSLISHSLHAAAGLNPEHIVAV
GLMU_CORDI      -----MSNPHSSAVIVLAAGAGTRMKSAKQKTLHSIGGRSLLAHSLHAAAGLSPQRIVAV
GLMU_CORJK      -----------MAVIVLAAGAGTRMKSTTQKTLHSIGGRTLLSHSLHAAAGIDPARIVAV
GLMU_MYCBO      -----MTFPGDTAVLVLAAGPGTRMRSDTPKVLHTLAGRSMLSHVLHAIAKLAPQRLIVV
GLMU_MYCTU      -----MTFPGDTAVLVLAAGPGTRMRSDTPKVLHTLAGRSMLSHVLHAIAKLAPQRLIVV
GLMU_MYCPA      -----MSSPGDTAVLVLAAGPGTRMRSDTPKVLHPLGGRSMLSHLLHAIAKVAPQHLAVV
GLMU_MYCLE      -----MTFRGDTAVLVLAAGPGSRMRSDTPKVLHTIAGRSMLSHSLHAITKLAPQHLVVV
GLMU_NOCFA      -------MPQQTAVVVLAAGAGTRMRSKTPKVLHSLAGRSMLAHALHAANEIDPTHLITV
GLMU_STRAW      -----MSAIRPAAVVVLAAGEGTRMKSATPKVLHDICGRSLVGHVLAAARELEPENLVVV
GLMU_STRCO      -----MSAIRPAAVVVLAAGEGTRMKSATPKVLHELCGRSLVGHVLAAAGELDPENLVAV
GLMU_THEFY      -----MSASRPAAVMVLAAGEGTRMKSRRPKVLHEICGRSLLGHVLAAVAELEPQRTVVV
GLMU_LEIXX      ------MTDQNLAIVVLAAGQGTRMKSATPKLLHPLGGIPVIAHVLETARALEAAEVVAV
GLMU_BIFLO      --------MALSAAIVLAAGEGTRMRSNKPKVLHAFAGKTFLNRVMDSVAALNPDTLAVV
GLMU_BDEBA      -----------MTVIALAAGKGTRMKSPLPKVLHPVAGRPMIEKVIQASKQAGAAEVRVI
GLMU_FUSNN      -----------MKSIIMAAGKGTRMKSDLPKVVHLAHGKPMIVRIIDALNTLDVEENILI
GLMU_THEMA      -----------MRALVLAAGKGTRMKSKIPKVLHPLSGRPMIEWVIETAGKV-AQKVGVV
GLMU_THET2      ----------MHAHVILAAGQGTRMRSRLPKVLHPLLGKPMLLYALEAALALKPERLVVV
GLMU_THET8      ----------MHAHVILAAGQGTRMRSRLPKVLHPLLGKPMLLYALEAALALKPERLVVV
GLMU_DEIRA      ----MTEQTRPLDVVILAAGQGTRMNSALPKVLHPVAGRPMVAWAVKAARDLGARKIVVV
GLMU_AQUAE      -----------MRAVILAAGLGTRFKSEKPKVLHEILGKPMLWYVITNVRNGRIDDIAVV
GLMU_DESAG      ----MSSNQYTAGAVILAAGKGTRMYSDKPKVLQPLLGEPMLRFVYRALDPLFSKAVWTV
GLMU_DESVH      ----MAS---TTGALILAAGKGTRMHSDKPKVLQTILGEPMLRFVMDALAPVFGDRVWTV
GLMU_AGRFC      -------MERSSLAVILAAGDSTRMKSSKSKVLHPVAGRPMIGHVVEAVAGAGVGAVALV
GLMU_RHIME      -------MERTCLAIILAAGESTRMKSAMSKVLHPVAGRPMIAHVVDALASASISDVALV
GLMU_BRUAB      ------MTDRTCLSIVLAAGEGTRMKSNLPKVLHRVAGLPLVCHVVNAVRGTGKSDVALV
GLMU_BRUME      ------MTDRTCLSIVLAAGEGTRMKSNLPKVLHRVAGLPLVCHVVNAVRGTGKSDVALV
GLMU_BRUSU      ------MTDRTCLSIVLAAGEGTRMKSNLPKVLHRVAGLPLVCHVVNAVRGTGKSDVALV
GLMU_RHILO      ------MSQRSCLSVILAAGEGTRMKSALPKVLHQIAGLPMVAHVVKAADAAGASSDAIV
GLMU_BARHE      --------MRSCLSIVLAAGEGTRMKSSLPKVLHKIAGLPLICHVIKQIELAGVSQLAVV
GLMU_BARQU      --------MRSCLSIVLAAGEGTRMKSSLPKVLHKIAGLPLVCHVIKQIELAGASQLAVV
GLMU_BRADU      ------MTARSSLTIVLAAGEGTRMRSHLPKVLHPVAHQTLLAHVLTAAPKGTGTSLAVV
GLMU_NITWN      ------MSGRNCLTIVLAAGEGTRMRSSLPKVLHPVGGQTLLSHVLAAAPGGPGTSLTVV
GLMU_RHOPA      ------MTARNSLTIVLAAGEGTRMRSSLPKVLNPVAGRSLLAHVLSAAPHGERDRLAVV
GLMU_CAUVC      MTESVSKPVRPRAAVILAAGQGTRMKSPTPKVLHRLAGRTLLDHAIDAAEGLGCERIIVV
GLMU_CERS4      ------MDRATVSLIVLAAGQGTRMNSDLPKVLHPLGAAPMLHHALRAGQSLEPERVVVV
GLMU_RUEPO      ---------MSTALVILAAGKGTRMKSDLPKVLHPIAHAPMLVHAMRAGAVLEPARTVIV
GLMU_GLUOX      ----MTDSTHRTTAIILAAGLGTRMKSRLPKALHRLGNQPMINHLITTARQV-FDDVVVV
GLMU_ZYMMO      -----MTAHKPFSAVILAAGKGTRMRSDTHKILHALAGRPLLGWVLDSLAPLSPDHTVVV
GLMU_WOLPM      ------MISKTHTFVILASGHGRRMNSDLPKVLHKIGSFSMLQHVIYNAKQLNPENIAVV
GLMU_WOLTR      ------------MFIILAAGHGKRMNSGLPKVLHKIGNFSMLQHIIYNARQLNPENISVV
GLMU_ANAMM      -----------MDIVILAAGCGSRMCSTTPKILHKLGNAPIIKHVLQLADELRPKRAVIV
                                :::* . *:     * :       .                  :

GLMU_ECOLI      YGHGGDLLKQALKDDN---------LNWVL-----QAEQLGTGHAMQQAAPFFAD-----
GLMU_ECO57      YGHGGDLLKQALKDDN---------LNWVL-----QAEQLGTGHAMQQAAPFFAD-----
GLMU_SHIFL      YGHGGDLLKQALKDDN---------LNWVL-----QAEQLGTGHAMQQAAPFFAD-----
GLMU_SHIDS      YGHGGDLLKQALKDDN---------LNWVL-----QAEQLGTGHAMQQAAPFFAD-----
GLMU_SHISS      YGHGGDLLKQALKDDN---------LNWVL-----QAEQLGTGHAMQQAAPFFAD-----
GLMU_SHIBS      YGHGGDLLKQALKDDN---------LNWVL-----QAEQLGTGHAMQQAAPFFAD-----
GLMU_ECOL6      YGHGGDLLKQALKDDN---------LNWVL-----QAEQLGTGHAMQQAAPFFAD-----
GLMU_SALPA      YGHGGELLKQTLKDDK---------LNWVL-----QAEQLGTGHAMQQAAPFFSD-----
GLMU_SALTY      YGHGGELLKQTLKDDK---------LNWVL-----QAEQLGTGHAMQQAAPFFSD-----
GLMU_SALCH      YGHGGELLKQTLKDDK---------LNWVL-----QAEQLGTGHAMQQAAPFFSD-----
GLMU_SALTI      YGHGGELLKQTLKDDK---------LNWVL-----QAEQLGTGHAMQQAAPFFSD-----
GLMU_YERPE      YGHGGELLKKTLADPS---------LNWVL-----QAEQLGTGHAMQQAAPHFAD-----
GLMU_YERPS      YGHGGELLKKTLADPS---------LNWVL-----QAEQLGTGHAMQQAAPHFAD-----
GLMU_PECAS      YGHGGDLLKHELTDPA---------LNWVL-----QAEQLGTGHAMQQAAPHFAD-----
GLMU_PHOLL      YGHGGDLIEQTLSDQT---------LNWVL-----QAEQLGTGHAMQQAAPHFAG-----
GLMU_HAEIN      YGHGGDLMRTHLANEQ---------VNWVL-----QTEQLGTAHAVQQAAPFFKD-----
GLMU_HAEI8      YGHGGDLMRTHLANEQ---------VNWVL-----QTEQLGTAHAVQQAAPFFKD-----
GLMU_MANSM      YGHGADLLKSHLADEP---------VNWVF-----QAEQLGTGHAMQQAAPFFAD-----
GLMU_PASMU      YGHGGEVMQTRLQDEP---------VNWVL-----QAEQLGTGHAMQQAAPFFAD-----
GLMU_HAEDU      YGHGGDLLKTHLKTEP---------LNWVL-----QAEQLGTGHAMQQAATFFAD-----
GLMU_VIBVU      YGHGGDQMQAALAEEP---------VNWVL-----QAEQLGTGHAVDQASPQFED-----
GLMU_VIBVY      YGHGGDQMQAALAEEP---------VNWVL-----QAEQLGTGHAVDQASPQFED-----
GLMU_VIBPA      FGHGGDQMQTTLADET---------VNWIL-----QADQLGTGHAVDQASPRFED-----
GLMU_VIBCH      YGHGGDQMQQALANEN---------VNWVL-----QAQQLGTGHAVDQASPHFQD-----
GLMU_ALIF1      YGHGGDQMKAELGEER---------VQWVL-----QAEQLGTGHAVNQAAPEFAD-----
GLMU_PHOPR      YGHGGDTMQQVLADEP---------VSWIL-----QAEQLGTGHAVNQASSGLAD-----
GLMU_COLP3      YGFGGDVLKATLTKDNTG-----DDLTFVE-----QVEQLGTGHAVDQASPFLTD-----
GLMU_PSET1      YGHGGELLQQQLANNN---------VNWVL-----QAEQLGTGHAVAQANSHVND-----
GLMU_SHEON      YGYGADKLKSTLGEQK---------LNWIL-----QAEQLGTGHAVAQAIPNIDD-----
GLMU_IDILO      YGHGGDQLKQAIAGDD---------LTWVE-----QREQLGTGHAVQQVIPHLKS-----
GLMU_PSESM      IGHGADAVREQLAADD---------LNFVM-----QDKQLGTGHAVAQALPALTA-----
GLMU_PSEU2      IGHGADAVREQLSADD---------LNFVM-----QDKQLGTGHAVAQALPALTA-----
GLMU_PSE14      IGHGADAVREQLAADD---------LNFVM-----QDKQLGTGHAVAQALPALTA-----
GLMU_PSEPK      IGHGAELVRERLAADD---------LNFVM-----QDKQLGTGHAVAQALPALTA-----
GLMU_PSEF5      IGHGADAVRERLDADD---------LNFVL-----QDKQLGTGHAVAQAVPFITA-----
GLMU_PSEPF      IGHGADVVRERLAADD---------LNFVL-----QDKQLGTGHATAQAVPFITA-----
GLMU_PSEAE      IGHGADLVRERMAADD---------LNFVL-----QAEQLGTGHAVAQALPFLSA-----
GLMU_NEIGO      VGHGKEQVLDTVK--RD--------AVWVE-----QTEQLGTGHAVKTALPHLAS-----
GLMU_NEIG1      VGHGKEQVLDTVK--RD--------AVWVE-----QTEQLGTGHAVKTALPHLAS-----
GLMU_NEIMA      VGHGKEQVLDTVK--RD--------VVWVE-----QTEQLGTGHAVKTALPHLAA-----
GLMU_NEIMB      IGHGKEQVLDTVK--RD--------VVWVE-----QTEQLGTGHAVKTALPHLSA-----
GLMU_CHRVO      YGHGGEQVRARIQD-AD--------IVWAE-----QAEQLGTGHALKMALPHLPQ-----
GLMU_AROAE      HGHGGEAVRARLQH-AA--------VQWAL-----QQPQLGTGHAVLQALPHLTD-----
GLMU_DECAR      YGHGGEVVRSTLAA-PD--------LSWAE-----QAQQLGTGHAVAQALSELGS-----
GLMU_BURMA      IGHGAEQVRAAVAA-PD--------VQFAV-----QEQQLGTGHAVRQALPLLDP-----
GLMU_BURP1      IGHGAEQVRAAVAA-PD--------VQFAV-----QEQQLGTGHAVRQALPLLDP-----
GLMU_BURPS      IGHGAEQVRAAVAA-PD--------VQFAV-----QEQQLGTGHAVRQALPLLDP-----
GLMU_BURL3      VGHGAEQVQAAVAA-PD--------VQFAV-----QAEQLGTGHAVRQALPLLDP-----
GLMU_CUPPJ      IGHGAERVREAVAA-DD--------VTFAE-----QDQQLGTGHAVMQALPQLDD-----
GLMU_RALSO      VGHGGDRVRDMVGA-PD--------VTFAT-----QDQQLGTGHAVMQALDQLDD-----
GLMU_THIDA      YGFGGEAVPQAMAE-AT--------LSFVL-----QAEQHGTGHAVKQALPQLAD-----
GLMU_BORBR      VGHGADRVKAAFEGLPG--------LQFAL-----QQPQHGTGHAVQQAVPQLLE-----
GLMU_BORPA      VGHGADRVKAAFEGLPG--------LQFAL-----QQPQHGTGHAVQQAVPQLLE-----
GLMU_BORPE      VGHGADRVKAAFEGQPG--------LQFAL-----QQPQHGTGHAVQQAVPQLLE-----
GLMU_NITEU      FGYGGELVRQVIGDHSD--------LIWVK-----QAQQLGTGHAVKQALPYLGN-----
GLMU_LEGPA      YGHGGEQIKSSLPNLP---------VHWVH-----QAEQLGTGHAVLQAMPHIPD-----
GLMU_LEGPH      YGHGGEQIKSSLPNLP---------VHWVH-----QAEQLGTGHAVLQAMPHIPD-----
GLMU_LEGPL      YGHGGEQIKSSLPNLP---------VHWVH-----QAEQLGTGHAVLQAMPHIPD-----
GLMU_COXBU      YGNGGSHVREKLNYLP---------VHWIE-----QSQPLGTGHAVLQAIPFCQN-----
GLMU_METCA      YGHGGEQALSALGHLP---------ATWIE-----QKKRRGTGHAVMQAVDRIGD-----
GLMU_NITOC      YGHGGETVPEAFRAAD---------ITWVR-----QELQLGTGHAALQTLPYIKP-----
GLMU_XANAC      YGHGGDQVQAAFADQGD--------LQWAE-----QREQLGTGHAVQQAMPAIPD-----
GLMU_XANC5      YGHGGDQVQAAFADQGD--------LQWAE-----QCEQLGTGHAVQQAMPAIPD-----
GLMU_XANOR      YGHGSDQVQAAFADQSD--------LQWAA-----QREQLGTGHAVQQAMPAIPD-----
GLMU_XANC8      HGHGGAQVQAAFAGQPD--------LQWAE-----QRQQLGTGHAVQQALHAVPD-----
GLMU_XANCP      HGHGGAQVQAAFAGQPD--------LQWAE-----QRQQLGTGHAVQQALHAVPD-----
GLMU_XYLFA      YGHAGNQVRAAFADQTD--------LHWVE-----QAQQLGTGHAVKQTMSAIPN-----
GLMU_XYLFT      YGHAGNQVRAAFADQTD--------LHWVE-----QTQQLGTGHAVKQTMSAIPN-----
GLMU_ACIAD      FGHGGAQVQQQFQQEN---------IQWVE-----QTEQLGTGHAVQMTLPVLPH-----
GLMU_PSYA2      HGFGGEQVQAHIAEQYAH-----LPITWVA-----QTEQLGTGHAVKVTLSDLPK-----
GLMU_FRATT      TGHLKEQVEDALQGRN---------ITFVY-----QQQQLGTGHAVLQALPYLKE-----
GLMU_BUCAI      YSDQKKPVLSNI----YN-----IPIQWII-----QKKPQGTGHAILLAIKKIS------
GLMU_BUCAP      YNNKEKEIKSKI----SD-----TSIDWVI-----QKEQKGTGDAILKASKKFS------
GLMU_BUCBP      YNKQYKKFKIKN----KN-----NSITWIK-----QKKILGTGNAISQIINNYK------
GLMU_WIGBR      YGYEGKLLRKKIIS--RG-----FSLNWTL-----QSEQNGTGHAVQQVIFKEIG-----
GLMU_BLOFL      YNESLREFIPTIYSNKCT-----ISIYWVL-----QESVRGTGYAVQQVLSMIHD-----
GLMU_BLOPB      HGYKGEMIIKEINTNQYK-----IPVYWIL-----QHDLTGTGDAVQRVLPFISD-----
GLMU_CAMJE      SHQKERVEKEILEYFPK------TQILEQD-----LQNYPGTAGALSGFE----------
GLMU_CAMJR      SHQKERVEKEILEYFPK------TQILEQD-----LQNYPGTAGALRGFE----------
GLMU_HELHP      FHQENVIKERLLCAYKQAYADGALHFHLQD-----HAHYPGTGGALMQGQNAGANAKKPF
GLMU_WOLSU      FHESEMVKKSIEKYFSD------IRYVIQD-----HVNYPGTGGALMGIE----------
GLMU_HELPJ      HHQQERIKEAVSKRFKG------VIFHAQI-----VEKYSGTGGAIMQEN------KTPI
GLMU_HELPY      HHQQERIKEAVLERFKG------VIFHTQI-----VEKYSGTGGAIMQKD------KTPI
GLMU_GEOSL      VGHQAERLREHFSNDAD--------ITLAV-----QEEQLGTGHAVACAAGDLSG-F---
GLMU_PELCD      VGHGAEAVQAELAEDP---------VSFAL-----QSEQLGTGHALLCARQALQE-F---
GLMU_BACSU      VGHGAEEVKKQLGDK----------SEYRV-----QAKQLGTAHAVKQAQPFLAD-E---
GLMU_BACLD      VGHGAEDVKKQLGEK----------SEYAL-----QAEQLGTAHAVKQAKSILGS-E---
GLMU_BACAN      VGHGAEMVQEQLGNV----------SEFAL-----QAEQLGTAHAVDQAAGVLAN-E---
GLMU_BACC1      VGHGAEMVQEQLGNV----------SEFAL-----QAEQLGTAHAVDQAASVLAN-E---
GLMU_BACHK      VGHGAEMVQEQLGNV----------SEFAL-----QAEQLGTAHAVDQAAGVLAN-E---
GLMU_BACCZ      VGHGAEMVQEQLGNV----------SEFAL-----QAEQLGTAHAVDQAAGVLAN-E---
GLMU_BACCR      VGHGAEMVQEQLGNV----------SEFAL-----QAEQLGTAHAVDQAASVLAN-E---
GLMU_GEOKA      VGFGAEQVKEQLGSQ----------CEYAL-----QEEQLGTAHAVMQAAPHLRG-L---
GLMU_ALKHC      IGHGADAVKSQLGER----------VSYAL-----QEEQLGTGHAVLQAESALGG-R---
GLMU_OCEIH      VGFGAEKVKAQLGSS----------SEFAF-----QKEQLGTGHAVLQAEDLLKD-E---
GLMU_LISMF      VGHGAEKVQEHLAGK----------SEFVK-----QEEQLGTAHAVLQAKAELAG-K---
GLMU_LISMO      VGHGAEKVQEHLAGK----------SEFVK-----QDEQLGTAHAVLQAKAELAG-K---
GLMU_LISIN      VGHGAEKVQEHLAGK----------SEFVK-----QDEQLGTAHAVLQAKSELAG-K---
GLMU_BACSK      VGHGAEEVKKTLTEK----------IEFVM-----QPEQLGTGHAVKCAEHLLAS-Q---
GLMU_LACPL      VGHGAKDVEAALGDR----------TEYAV-----QTEQLGTGHAVLQAESLLKD-A---
GLMU_LACSS      VGHGAEKVKDYLGDR----------SQYAL-----QAEQLGTGHAVLQAEDLLKD-Q---
GLMU_ENTFA      VGHGAEMIKSHLGER----------SQYAL-----QAEQLGTGHAVMQAQELLGG-K---
GLMU_LACAC      VGTGAGDVEKVLADK----------SKFVF-----QEKQLGTGDAVMTAKEVLGD-K---
GLMU_LACJO      VGNGAESVKDVLAGQ----------SEFAF-----QEKQLGTGDAVLAANDLLEN-L---
GLMU_STAAC      VGHGAESVKGHLGER----------SLYSF-----QEEQLGTAHAVQMAKSHLED-K---
GLMU_STAAS      VGHGAESVKGHLGER----------SLYSF-----QEEQLGTAHAVQMAKSHLED-K---
GLMU_STAAW      VGHGAESVKGHLGER----------SLYSF-----QEEQLGTAHAVQMAKSHLED-K---
GLMU_STAAR      VGHGAESVKGHLGER----------SLYSF-----QEEQLGTAHAVQMAKSHLED-K---
GLMU_STAAM      VGHGAESVKGHLGER----------SLYSF-----QEKQLGTAHAVQMAKSHLED-K---
GLMU_STAAN      VGHGAESVKGHLGER----------SLYSF-----QEKQLGTAHAVQMAKSHLED-K---
GLMU_STAEQ      IGHGAESVKDTLGNQ----------SLYSF-----QDKQLGTAHAVKMAHEHLAD-K---
GLMU_STAES      IGHGAESVKDTLGNQ----------SLYSF-----QDKQLGTAHAVKMAHEHLAD-K---
GLMU_STAEP      IGHGAESVKDTLGNQ----------SLYSF-----QDKQLGTAHAVKMAHEHLAD-K---
GLMU_STAHJ      VGHGAEDVKETLGNQ----------SLYSY-----QEEQLGTAHAVKMANEHLKE-V---
GLMU_STAS1      VGHGADSVKETLGDT----------SLYSF-----QEEQLGTAHAVKMASEHLSE-S---
GLMU_STRA1      IGHKAELVRDVLGDK----------SEFVM-----QTEQLGTGHAVMMAEEELAT-S---
GLMU_STRA5      IGHKAELVRDVLGDK----------SEFVM-----QTEQLGTGHAVMMAEEELAT-S---
GLMU_STRA3      IGHKAELVRDVLGDK----------SEFVM-----QTEQLGTGHAVMMAEEELAT-S---
GLMU_STRT1      IGHKAELVREVLDGQ----------SAFTM-----QTEQLGTGHAVMMAEEELAG-L---
GLMU_STRT2      IGHKAELVREVLDGQ----------SAFTM-----QTEQLGTGHAVMMAEEELAG-L---
GLMU_STRPN      VGHKAELVEEVLAGQ----------TEFVT-----QSEQLGTGHAVMMTEPILEG-L---
GLMU_STRR6      VGHKAELVEEVLAEQ----------TEFVT-----QSEQLGTGHAVMMTEPILEG-L---
GLMU_STRMU      VGHKAELVQKVLEDQ----------SEFVL-----QSEQLGTGHAVMMAESSLAE-L---
GLMU_STRP1      IGHKSEMVRAVLADQ----------SAFVH-----QTEQLGTGHAVMMAETQLEG-L---
GLMU_STRPM      IGHKSEMVRAVLADQ----------SAFVH-----QTEQLGTGHAVMMAETQLEG-L---
GLMU_STRP6      IGHKSEMVRAVLADQ----------SAFVH-----QTEQLGTGHAVMMAETQLEG-L---
GLMU_STRP3      IGHKSEMVRAVLADQ----------SAFVH-----QTEQLGTGHAVMMAETQLEG-L---
GLMU_STRP8      IGHKSEMVRAVLADQ----------SAFVH-----QTEQLGTGHAVMMAETQLEG-L---
GLMU_STREC      IGHQAEQVRAVLGDQ----------LLTVV-----QEEQLGTGHAVMMAEEELSG-L---
GLMU_LACLA      VGHEADRVIATLPKG----------TQFVK-----QVEQLGTGHAVRIAADLLAN-E---
GLMU_CLOPE      IGKGAELVKERTTSRN---------VSYSL-----QAEQLGTGHAVKCAKDFLEG-K---
GLMU_CLOTE      VGKKAKEVQLKTESRS---------VSFSF-----QEQQLGTGHAVKCAKEFLLG-K---
GLMU_CLOAB      IGKGAELVREATSKKN---------ISYSL-----QSEQLGTGHAVKCAEDFLRG-K---
GLMU_CALS4      VGHGREMVEEVLGDE----------VKYAY-----QKVQLGTGHAVMMAEEFLP--L---
GLMU_CARHZ      VGYRKEKVEEILRGR----------AVIAV-----QEEQLGTGHAALVAMPYVE------
GLMU_SYMTH      VGYQQERIREYLGDR----------VRYAV-----QSEQLGTGHAVLQAAGLIDETE---
GLMU_NOSS1      VGYQAEQVKTGLQS-PN--------LEF-----VEQTVQLGTGHAIQQLLPHLEGYR---
GLMU_THEEB      IGYGGDAVRAALADQPQ--------LEF-----VEQRQQLGTGHAVQQLLPYLKDYE---
GLMU_SYNP6      VGYQGDRVRESWAHRTD--------IEF-----VEQTQQLGTGHAVQQLLPHLKGYQ---
GLMU_SYNY3      VGYQAAAVESSLAGRSD--------VEF-----VEQREQLGTGHAIQQLLPCLQDYQ---
GLMU_GLOVI      VGQGAELVRGRIAR-PG--------VQF-----VEQTEQRGTGHAVQQVIPHLEGFE---
GLMU_PROMA      VGHESNKVKESVNHISG--------LEF-----VNQQPQRGTGHAVQQLIPVLKGFK---
GLMU_PROMT      VGHQANLVEDSLRKHQD--------LDF-----VLQQPQNGTGHAIQQLKPRLKGFN---
GLMU_PROMM      VGHQAQEVQQQLTDWQG--------LEF-----VVQQPQNGTGHAVQQVLPVLEGFD---
GLMU_SYNPX      VGHQADRVEEQLAAIGL--------LEF-----VLQQPQNGTGHAVQQLLPVLQGFE---
GLMU_PROMP      VGHKSKEVEESVLKNKN--------IHF-----IVQNPQKGTGHAIQVLSQEVKKHE---
GLMU_COREF      IGHGRDQVGPAVEDVAT--------HLGREVRIAIQEEQNGTGHAVQCAMDQL-EGF---
GLMU_CORGL      IGHGRDQVGPAVAQVAE--------ELDREVLIAIQEEQNGTGHAVQCAMDQL-EGF---
GLMU_CORDI      IGHRREQVRPEVEAVAA--------TVDCEISVAIQEQQNGTGHAVQCAMHEL-EGF---
GLMU_CORJK      IGHGREQVGPAVAEVAE--------QLGRSIDTAIQEQQNGTGHAVQCAMEQL-EGF---
GLMU_MYCBO      LGHDHQRIAPLVGELAD--------TLGRTIDVALQDRPLGTGHAVLCGLSALPDDY---
GLMU_MYCTU      LGHDHQRIAPLVGELAD--------TLGRTIDVALQDRPLGTGHAVLCGLSALPDDY---
GLMU_MYCPA      LGHDHERIAPLIADWAD--------DLGRPIDVALQERPRGTGDAVRCGLSALPDDY---
GLMU_MYCLE      LGHEHQRIAPLVAELAD--------TLERTIDVALQDRPRGTGHAVFCGLSALPDDY---
GLMU_NOCFA      VGHDREQVGAAVAAVAG--------ELGREIVPALQEQQLGTGHAVQCALRALPADF---
GLMU_STRAW      VGHAREQVTAHLAEIDP--------A----VRTAVQAEQNGTGHAVRMGLEELGG-----
GLMU_STRCO      VGHAREKVTAHLAEVAP--------D----VRTAVQEQQNGTGHAVRMGLEAMGG-----
GLMU_THEFY      VGHAREQVTEHLKSIAP--------H----AITALQEEQKGTGHAVRMAIEALRAQNV--
GLMU_LEIXX      VRHERDRLAEVIGVELP--------E----AVIVDQDEVPGTGRAVEQAVAALPADF---
GLMU_BIFLO      VHFQAERVAEAARSYDE--------Q----VTIVNQDDIPGTGRAVQCAMAQLTEAG---
GLMU_BDEBA      VGHGQNLVRQVVEPMGV--------ACYV------QDEQLGTAHAVRCAKPE--TIE---
GLMU_FUSNN      LGHKREKVLEVLGN-DV--------SYVV------QEEQLGTGHAVKQAIPKIKDYD---
GLMU_THEMA      LGFEAELVRKALPE-WV--------DVFV------QGEQLGTAHAVMCAKDFI-EPG---
GLMU_THET2      VGHGGEKVVEALEGYPV--------EVAW-----QKE-QLGTAHALLQAEGLLRDFP---
GLMU_THET8      VGHGGEKVVEALEGYPV--------EVAW-----QKE-QLGTAHALLQAEGLLRDFP---
GLMU_DEIRA      TGHGAEQVEAAVQQPGV--------AFAR-----QER-QLGTGDAFLSGASALTEGG---
GLMU_AQUAE      VGHKAQEVMEAFKNENL--------KFFI-----QENPKGGTADAVLAAKDFFSSYE---
GLMU_DESAG      IGHGADMVRKAFCHEDR---------EFVL-----QEKQLGTGHALQCAWDKVTASG---
GLMU_DESVH      VGHRADMIYAAFAGEDA---------RFVV-----QEQQLGTGHALQMAWESLRAAG---
GLMU_AGRFC      VGRDADNVAAAASLKGL------------QVEAFLQKERKGTGHAVLAAREAIKR-----
GLMU_RHIME      VGRDADAVSAAAATDEV------------AVTSFLQKERLGTAHAVLAAREAIAK-----
GLMU_BRUAB      VGRGAEDVRSAVEKIAG------------PVSAFEQKERLGTAHAVLAAHEAIAR-----
GLMU_BRUME      VGRGAEDVRSAVEKIAG------------PVSAFEQKERLGTAHAVLAAREAIAR-----
GLMU_BRUSU      VGRGAEDVRSAVEKIAG------------PVSAFEQKERLGTAHAVLAAREAIAR-----
GLMU_RHILO      IGHGAEEMRKAVTKFSP------------KAETFVQEERLGTAHAVLAAREAISR-----
GLMU_BARHE      VGFGAKDVVHVVESFVK------------NAMIFEQKERLGTAHAVLSARLALQK-----
GLMU_BARQU      VGAGAQDVTHVVQSFIK------------SVMIFEQKERLGTAHAVLSARLALQK-----
GLMU_BRADU      IGPDHQAVADEARRIRP------------DAVTFVQAERLGTAHAVLAAREAIAR-----
GLMU_NITWN      IGPGHQAVADEAKRVRP------------DVMTFVQDERLGTAHAVLAAKEAIIR-----
GLMU_RHOPA      IGPDHQAVGDEAKRVRS------------DAAIHIQAQRLGTAHAVLAAREAIAQ-----
GLMU_CAUVC      VGAHSPQVGESARKRLG------------PDATVIQDPPLGTGHAVLAAKDALAD-----
GLMU_CERS4      AGHGAEAVAKAARAFDE------------SIEVVVQAEQLGTAHAVAQAAPLLAD-----
GLMU_RUEPO      AGHGAEAVRAAALDEDE------------GATVVLQEEQLGTAHAVDQARAALEG-----
GLMU_GLUOX      TGPDMPELEKAVRPF----------------KTVTQVERLGTAHAANTARDLFG------
GLMU_ZYMMO      TGSGREQVENYLKQVDL------------PVTSVTQEEQLGTAHAVAQAKSALKD-----
GLMU_WOLPM      VDQPLIERLKCFKD----------------IQLITQELTLGTGDAVKTAMRNLRE-----
GLMU_WOLTR      ANLPLIERLKCLED----------------IQLITQESTLGTGDAVKTAVRNMKE-----
GLMU_ANAMM      TNAAVNGPVAALAGEHNL-----------RLNTVLQGEIAGTGGAATSALQALKN-----
                                                        **. *               

GLMU_ECOLI      -----DEDILMLYGDVPLISVETLQRLR-----DAKPQGG-----IGLLTVKLDDPTGYG
GLMU_ECO57      -----DEDILMLYGDVPLISVETLQRLR-----DAKPQGG-----IGLLTVKLDDPTGYG
GLMU_SHIFL      -----DEDILMLYGDVPLISVETLQRLR-----DAKPQGG-----IGLLTVKLDDPTGYG
GLMU_SHIDS      -----DEDILMLYGDVPLISVETLQRLR-----DARPQGG-----IGLLTVKLDDPTGYG
GLMU_SHISS      -----DEDILMLYGDVPLISVETLQRLR-----DAKPQGG-----IGLLTVKLDDPTGYG
GLMU_SHIBS      -----DEDILMLYGDVPLISVETLQRLR-----DAKPQGG-----IGLLTVKLDDPTGYG
GLMU_ECOL6      -----DEDILMLYGDVPLISVETLQRLR-----DAKPQGG-----IGLLTVKLDDPTGYG
GLMU_SALPA      -----DEDILMLYGDVPLISVETLQRLR-----DAKPQGG-----IGLLTVKLDDPSGYG
GLMU_SALTY      -----DEDILMLYGDVPLISVETLQRLR-----DAKPQGG-----IGLLTVKLDDPSGYG
GLMU_SALCH      -----DEDILMLYGDVPLISVETLQRLR-----DAKPQGG-----IGLLTVKLDDPSGYG
GLMU_SALTI      -----DEDILMLYGDVPLISVETLQRLR-----DAKPQGG-----IGLLTVKLDDPSGYG
GLMU_YERPE      -----DEDILMLYGDVPLISVDTLQRLL-----AAKPEGG-----IGLLTVKLDNPSGYG
GLMU_YERPS      -----DEDILMLYGDVPLISVDTLQRLL-----AAKPEGG-----IGLLTVKLDNPSGYG
GLMU_PECAS      -----DEDILMLYGDVPLISSQTLVHLR-----EAKPQGG-----IGLLTVKLDDPAGYG
GLMU_PHOLL      -----DEDILILYGDVPLIGADTLERLL-----AVKPEGG-----IGLLTAILDNPTGYG
GLMU_HAEIN      -----NENIVVLYGDAPLITKETLEKLI-----EAKPENG-----IALLTVNLDNPTGYG
GLMU_HAEI8      -----NENIVVLYGDAPLITKETLEKLI-----EAKPENG-----IALLTVNLDNPTGYG
GLMU_MANSM      -----DENILMLYGDSPLISKETLEKLI-----AAKPENG-----IALLTVNLDNPTGYG
GLMU_PASMU      -----DENILMLYGDGPLITAETLQTLI-----AAKPEHG-----IALLTVVLDDPTGYG
GLMU_HAEDU      -----DENILMLYGDTPLITAQTLTRLI-----AAKPANG-----IALLTVELADPTGYG
GLMU_VIBVU      -----DEKILVLYGDVPLISSETIESLL-----DAQPKGG-----IALLTVVLDNPTGYG
GLMU_VIBVY      -----DEKILVLYGDVPLISSETIESLL-----DAQPKGG-----IALLTVVLDNPTGYG
GLMU_VIBPA      -----DEKILVLYGDVPLISPETIENLL-----DAQPTGG-----IALLTVMLDNPTGYG
GLMU_VIBCH      -----DEKILVLYGDVPLISEDTIESLL-----EAQPTDG-----IALLTVVLEDPTGYG
GLMU_ALIF1      -----DEKVLVLYGDVPLISAETVENLL-----DAQPTGG-----IALLTVVLDNPMGYG
GLMU_PHOPR      -----NEKVLILYGDVPLISGDTLTNLL-----DAQPDGG-----IALLTVVLDNPVGYG
GLMU_COLP3      -----DEDVLVLYGDVPLTKVSTLESLL-----AAKPTDG-----MALLTVHLANPMGYG
GLMU_PSET1      -----DDTVLILYGDVPLTKQSTLERLL-----AATPKHG-----LAVLTVNLANPNGYG
GLMU_SHEON      -----NDTVLILYGDVPLIQASTLEALL-----AARPEYG-----VAILTVNLANPMGYG
GLMU_IDILO      -----SEKVIILYGDVPLLTESTLIKLV-----TASANTS-----LGLLTMTLAEPTGYG
GLMU_PSESM      -----E-TVLILYGDVPLIEVETLQRLL-----KRVTPEQ-----LGLLTVKLDDPTGYG
GLMU_PSEU2      -----D-TVLILYGDVPLIEVETLSRLL-----ERVNPQQ-----LGLLTVALDDPTGYG
GLMU_PSE14      -----E-TVLILYGDVPLIEVETLTRLL-----KLVNPQQ-----LGLLTVTLDDPTGYG
GLMU_PSEPK      -----D-TVLVLYGDVPLIEVETLQRLL-----AKANDQQ-----LGLLTVTLDDPTGYG
GLMU_PSEF5      -----D-TVLILYGDVPLIEVETLQRLL-----KQVGPEQ-----LGLLTVELDDPTGYG
GLMU_PSEPF      -----D-TVLILYGDVPLIEVETLQRLL-----KHVVPGQ-----MGLLTVELDDPTGYG
GLMU_PSEAE      -----D-QVLILYGDVPLIQLDTLQRLL-----AQVTPDQ-----LSLLTVDMLDPTGYG
GLMU_NEIGO      -----EGRTLVLYGDVPLIDVETLETLL-----EAAGNE------VGLLTDVPADPAGLG
GLMU_NEIG1      -----EGRTLVLYGDVPLIDVETLETLL-----EAAGNE------VGLLTDVPADPAGLG
GLMU_NEIMA      -----EGRTLVLYGDVPLIDVETLETLL-----EAAGNE------VGLLTDVPADPSGLG
GLMU_NEIMB      -----EGRTLVLYGDVPLIDVETLETLL-----EAAGNE------VGLLTDVPNDPTGLG
GLMU_CHRVO      -----DGKTLVLYGDVPLTKASTLQRLE-----QAAAGG------MAVLTDVLADASGYG
GLMU_AROAE      -----GDMALVLYGDVPLIGVPTLRRLE-----AAAGGER-----LALLTVELADPSGYG
GLMU_DECAR      -----AAQTLVLYGDVPLTTVATLKRL------LQAGKDA-----LSVLTVDLANPSGYG
GLMU_BURMA      -----SQPTLVLYGDVPLTRTATLKRLA-----DAATDAR-----YGVLTVTLDDPTGYG
GLMU_BURP1      -----SQPTLVLYGDVPLTRTATLKRLA-----DAATDAR-----YGVLTVTLDDPTGYG
GLMU_BURPS      -----SQPTLVLYGDVPLTRTATLKRLA-----DAATDAR-----YGVLTVTLDDPTGYG
GLMU_BURL3      -----AQPTLVLYGDVPLTRASTLQRLV-----DAAREGR-----YGILTVTLDDPTGYG
GLMU_CUPPJ      -----NQPTLVLYGDVPLTTAATLKALV-----EAAGNTR-----FGVLTVEMPDPTGYG
GLMU_RALSO      -----TVPTLVLYGDVPLTRAETLNALV-----GAAGQDH-----LGVLTVHLDDPTGYG
GLMU_THIDA      -----DGVTLVLYGDVPLIHTTTLAPLA-----AAADAGK-----FGLLTVNLAHPDGYG
GLMU_BORBR      -GDGEDDVTLVLYGDVPLVQPATLQNLL-----QARGRG------VAVLTEVLADSTGYG
GLMU_BORPA      -GDGEDDVTLVLYGDVPLVQPATLQNLL-----QARGRG------VAVLTEVLADSTGYG
GLMU_BORPE      -GDGEDDVTLVLYGDVPLVQPATLQNLL-----QARGRG------VAVLTEVLADSTGYG
GLMU_NITEU      -----KGVTLVLFGDVPLVKSDTLKALI-----EKAREDN-----LVLLTVELDNPTGYG
GLMU_LEGPA      -----DAYVLVLSADVPLIQVGTLQSLI-----ECSQRQNPDHSVLALLVAELENPSGLG
GLMU_LEGPH      -----DAYVLVLSADVPLIQVETLQSLI-----ECSQRQNPDHSVLALLVAELENPSGLG
GLMU_LEGPL      -----DAYVLVLSADVPLIQVETLQSLI-----ECSQRQNPDHSVLALLVAELENPSGLG
GLMU_COXBU      -----EDRVLILYGDVPLISPKTLNSLL-----ENTPSNG-----LGVVVAELPDPTGLG
GLMU_METCA      -----DSTVLVLYGDVPLLRRETVETLL-----HHAGESS-----LGLLTVELDNPTGYG
GLMU_NITOC      -----DTMLLILSGDVPLVKIETLKRLL-----AMVDQGG-----VGLLTVELANPNGYG
GLMU_XANAC      -----AATVLVLYGDVPLIRSESLLQLL-----HAPGRMA-------VLVAELANPTGYG
GLMU_XANC5      -----AATVLVLYGDVPLIRSESLLQLL-----HAPGRMA-------VLVAELANPTGYG
GLMU_XANOR      -----AARVLVLYGDVPLIRSESLLQLL-----HAPGRMA-------VLVAELADPTGYG
GLMU_XANC8      -----AATVLVLYGDVPLIRSESLRELL-----HAPGRIA-------VLVADLANPSGYG
GLMU_XANCP      -----AATVLVLYGDVPLIRSESLRELL-----HAPGRIA-------VLVADLANPSGYG
GLMU_XYLFA      -----AANVLVLYGDVPLIRAETLKRLP-----RASTPIA-------VLVTELANPAGYG
GLMU_XYLFT      -----AANVLVLYGDVPLIRAETLQRLP-----RASTPIA-------VLVTELANPAGYG
GLMU_ACIAD      -----DGLSLILYGDVPLVRQQTLEKLL-----AVSSTTG-----IGMITLRVEDPTGYG
GLMU_PSYA2      -----EGQSLILYGDVPLVSCQTLATLQ-----A-ANIYG-----VSMLTLTVDNPFGLG
GLMU_FRATT      ------QKVLILYGDVPLISTEVLENLV-----DTTNDDD-----LGVLTAFVENPQGLG
GLMU_BUCAI      ----DNTEILVLYGDVPFISPVSIKKLQ-----KSKKQSK-----ISLLTAKVKNPNGYG
GLMU_BUCAP      ----DKDDIVVLYGDMPYISIESIKKLF-----TSKKQSD-----ISLLTAYVKNPDGYG
GLMU_BUCBP      ----DHENILILYGDVPLISKNSIQKML-----LKKKNST-----ITLLTAKLNNPEEYG
GLMU_WIGBR      -N--DNDKILILYGDVPLISINTLRKLL-----YSHSGFN-----ISLLTAVIDSPDGYG
GLMU_BLOFL      ----DNEDILILYGDVPLISDKTLNNLC-----LMKSKCD-----IGLLTAYVKNPQGYG
GLMU_BLOPB      ----D-EEVLVLYGDVPFVSYKTLQRLH-----VIKSQCD-----ISMLTATLPNPKGYG
GLMU_CAMJE      ---PKNERVLILCGDMPLVEQTSLEALL-----GNNAKL-------NLAVFKARDPKSYG
GLMU_CAMJR      ---PKNERVLILCGDMPLVEQTSLEALL-----SNNAKL-------NLAVFKARDPKSYG
GLMU_HELHP      C--YQYDEILILNGDMPLVCSQTLKSLC-----QNKAQI-------VMSVLHLQNPDGYG
GLMU_WOLSU      ---PKYQKILVLNGDMPLVEAEELKQFL-----RAGSDF-------VMSVLDLEDGSGYG
GLMU_HELPJ      P--TQHERVLILNADMPLITKDALTPLL-----ESHNN--------AIGLLHLADPKGYG
GLMU_HELPY      S--TKHERVLILNADMPLITKDALAPLL-----ESKNN--------AIGLLHLADPKGYG
GLMU_GEOSL      -----SGKVLILCGDVPLIRTETLRAM------VTAHEAT--GAVLTVLTARQENPHGYG
GLMU_PELCD      -----SGTLLLLCGDVPLLRDETLERL------IAEHEKT--RAAVTVLTAELSQPFGYG
GLMU_BACSU      -----KGVTIVICGDTPLLTAETMEQM------LKEHTQR--EAKRTILTAVAEDPTGYG
GLMU_BACLD      -----KGTTIVICGDTPLLTAETMEAM------LTEHQKK--AAKVTILTAVAEDPTGYG
GLMU_BACAN      -----EGTTLVICGDTPLITAETMEAL------LQQHKEA--GAMATVLTAYIEEPAGYG
GLMU_BACC1      -----EGTTLVICGDTPLITAETMEAL------LQQHKEA--GAMATVLTAYIEEPAGYG
GLMU_BACHK      -----EGTTLVICGDTPLITAETMEAL------LQQHKEA--GAMATVLTAYIEEPAGYG
GLMU_BACCZ      -----EGTTLVICGDTPLITAETMEAL------LQQHKEA--GAMATVLTAYIEEPAGYG
GLMU_BACCR      -----EGTTLVICGDTPLITAETMEAL------LQQHKEA--GAMATVLTAYIEEPAGYG
GLMU_GEOKA      -----EGVTIVVCGDTPLITAETMEML------IEHHMAA--KAKATVLTAIADDPSGYG
GLMU_ALKHC      -----RGVTIVLCGDTPLLTAETIDHV------MSYHEEE--QAKATVLTAELADPTGYG
GLMU_OCEIH      -----KGVTVVACGDTPLIRAETFEEL------IQYHKKT--GAKASILTTKVENPTGYG
GLMU_LISMF      -----DGVTLVVCGDTPLIEASTMEAL------LKYHHEK--RAKATILTTVIEDPTGYG
GLMU_LISMO      -----DGVTLVVCGDTPLIEASTMEAL------LKYHHEK--RAKATILTTVIEDPTGYG
GLMU_LISIN      -----DGVTLVVCGDTPLIEASTMEAL------LKYHHEK--RAKATILTTVIEDPTGYG
GLMU_BACSK      -----KGTTVVLCGDTPLITAATIKKL------MDTHEAN--GAKATVLTAHAPDPTGYG
GLMU_LACPL      -----DGMTLIVSGDTPLFKAETFEEL------FEYHQAK--GAAGTILTSKAPNPQGYG
GLMU_LACSS      -----DGITIVVSGDTPLLTAGTFEKL------FAYHHDK--GAKATILTATAPDPTGYG
GLMU_ENTFA      -----QGTTLVITGDTPLLTAETLKNL------FDYHQGK--NASATILTAHAEDPTGYG
GLMU_LACAC      -----DGATLVVTGDTPLFTTDTFNEL------FKYHTEK--GNAATVLTAEAPNPFGYG
GLMU_LACJO      -----EGSTLVATGDTPLFTAETFNNL------FKKHEES--GNSATVLTAKAPNPFGYG
GLMU_STAAC      -----EGTTIVVCGDTPLITKETLETL------IAHHEDA--NAQATVLSASIQQPYGYG
GLMU_STAAS      -----EGTTIVVCGDTPLITKETLETL------IAHHEDA--NAQATVLSASIQQPYGYG
GLMU_STAAW      -----EGTTIVVCGDTPLITKETLETL------IAHHEDA--NAQATVLSASIQQPYGYG
GLMU_STAAR      -----EGTTIVVCGDTPLITKETLETL------IAHHEDA--NAQATVLSASIQQPYGYG
GLMU_STAAM      -----EGTTIVVCGDTPLITKETLETL------IAHHEDA--NAQATVLSASIQQPYGYG
GLMU_STAAN      -----EGTTIVVCGDTPLITKETLETL------IAHHEDA--NAQATVLSASIQQPYGYG
GLMU_STAEQ      -----EGTTLVVCGDTPLITYQTLQSL------IEHHEST--QSHVTVLSASTINPYGYG
GLMU_STAES      -----EGTTLVVCGDTPLITYQTLQSL------IEHHEST--QSHVTVLSASTINPYGYG
GLMU_STAEP      -----EGTTLVVCGDTPLITYQTLQSL------IEHHEST--QSHVTVLSASTINPYGYG
GLMU_STAHJ      -----EGTTLVVCGDTPLITAHTLQKL------IEHHEST--HAQATVLSATAQIPFGYG
GLMU_STAS1      -----QGTTLVVCGDTPLITTATLKSL------VEHHENN--QAHATVLSATAENPFGYG
GLMU_STRA1      -----KGHTLVIAGDTPLITGESLKNL------IDFHVNH--KNVATILTADAANPFGYG
GLMU_STRA5      -----KGHTLVIAGDTPLITGESLKNL------IDFHVNH--KNVATILTADAANPFGYG
GLMU_STRA3      -----KGHTLVIAGDTPLITGESLKNL------IGFHVNH--KNVATILTADAANPFGYG
GLMU_STRT1      -----EGQTLVIAGDTPLITGESLKNL------IDFHVNH--KNVATILTATADNPFGYG
GLMU_STRT2      -----EGQTLVIAGDTPLITGESLKNL------IDFHVNH--KNVATILTATADNPFGYG
GLMU_STRPN      -----SGHTLVIAGDTPLITGESLKNL------IDFHINH--KNVATILTAETDNPFGYG
GLMU_STRR6      -----SGHTLVIAGDTPLITGESLKNL------IDFHINH--KNVATILTAETDNPFGYG
GLMU_STRMU      -----EGQTLVIAGDTPLIRGESLKNL------LHYHKSH--KNVATILTAEADDPFGYG
GLMU_STRP1      -----EGHTLVIAGDTPLITGESLKSL------IDFHVNH--KNVATILTATAQDPFGYG
GLMU_STRPM      -----EGHTLVIAGDTPLITGESLKSL------IDFHVNH--KNVATILTATAQDPFGYG
GLMU_STRP6      -----EGHTLVIAGDTPLITGESLKSL------IDFHVNH--KNVATILTATAQDPFGYG
GLMU_STRP3      -----EGHTLVIAGDTPLITGESLKSL------IDFHVNH--KNVATILTATAPDPFGYG
GLMU_STRP8      -----EGHTLVIAGDTPLITGESLKSL------IDFHVNH--KNVATILTATAPDPFGYG
GLMU_STREC      -----EGQTLVIAGDTPLIRGESLKAL------LDYHIRE--KNVATILTANAKDPFGYG
GLMU_LACLA      -----DGATLVIAGDTPLITGQTLEAL------FDYHFAQ--NATATILTAIAPNPTGYG
GLMU_CLOPE      -----TGVVAIFTGDAPLIKPETVKNL------VDTHINE--KNSATLLTSVIENPTGYG
GLMU_CLOTE      -----EGNVAIFTGDAPLITSKTIKTL------MEYHETN--GFHGTILTSIIDNPSGYG
GLMU_CLOAB      -----DGVVAIFTGDAPLITEDTVKNL------IDFHEKG--GYKATIITALIDNPEGYG
GLMU_CALS4      -----EGMVLILTGDTPLITSDTLRKL------VEYHISE--GNDVTILSSIFDDPTGYG
GLMU_CARHZ      -----DENVIIVPGDTPLLKASTLQAL------IKKHLET--GAYATVLTCFLSNPYGYG
GLMU_SYMTH      -----GGHVLVMYGDNPFIGPELIERL------IRAHVEA--DAAASLLTAELADPGALG
GLMU_NOSS1      ------GDLLVLNGDVPLLRTQTLEQL------LQTHQTN--QNAATILTSHLPNPKGYG
GLMU_THEEB      ------GHLLVLNGDVPLLRGQTLAHL------IEVHQNH--NNAATILTAQIPNPQGYG
GLMU_SYNP6      ------GDLLVLNGDVPLLRGETLEAL------VSGHQRS--GAAATLLTAQLNQPKGYG
GLMU_SYNY3      ------GDLLVLNGDAPLLRSETLENL------LATHQRH--GNAATLLTAHLPDPKGYG
GLMU_GLOVI      ------GEVLVLNGDAPLLRPSTVAHL------VEKHRSF--AADATILAARIADPGGYG
GLMU_PROMA      ------GDLLVLNGDVPLLKAKTINDL------INKHRSS--KANVSILSARLSNPSGYG
GLMU_PROMT      ------GELLVLNGDVPLLKEETLSSL------LKFHKES--NASVTFLSASLDSPTGYG
GLMU_PROMM      ------GELLVLNGDVPLLRPSTIEHL------VNEHRSS--GADVTLLTARLADPTGYG
GLMU_SYNPX      ------GELLVLNGDVPLLRAETIESL------VNGHRES--GADVTLLTARLEDPTGYG
GLMU_PROMP      ------GNLMVLNGDVPLIKAETLRDL------INFHDSK--TADVSLITSRKKNPHGYG
GLMU_COREF      -----DGTIIVTNGDVPLLTSDTLGSL------LAAHTAT--PTAVTVLTMNLDDPTGYG
GLMU_CORGL      -----EGTIIVTNGDVPLLTDHTLSAL------LDAHVEV--PTAVTVLTMRLDDPTGYG
GLMU_CORDI      -----EGTVVVTNGDVPLLRSETLRSL------VDAHTAV--PTAVTVLTMSLSDPTGYG
GLMU_CORJK      -----EGTVVVTNADVPLLSPETLQEL------TATHDG----ASVTVLSVNQDNPTGYG
GLMU_MYCBO      -----AGNVVVTSGDTPLLDADTLADL------IATHRAV--SAAVTVLTTTLDDPFGYG
GLMU_MYCTU      -----AGNVVVTSGDTPLLDADTLADL------IATHRAV--SAAVTVLTTTLDDPFGYG
GLMU_MYCPA      -----AGVLVVTSGDTPLLDADTVADL------IAGHTAT--RAAVTVLTTTLSDPSGYG
GLMU_MYCLE      -----GGIVVVTSGDTPLLDANTLAEL------IATHNAT--SAAVTVLTTTFSDPLGYG
GLMU_NOCFA      -----AGDLLVTSADVPLLDGHTLGAL------LDEHRSYQERSAVTVLTFVPDDPNGYG
GLMU_STRAW      ---VVDGTVVVVCGDTPLLSGETLRQL------AATHTAD--GNAVTVLTAEVPDATGYG
GLMU_STRCO      ---AVDGVVVVVCGDTPLLTGETLKAL------AATHTAD--GNAVTVLTAEVPDATGYG
GLMU_THEFY      ---ELTGTVVLTCGDTPLLRGATLRDL------VAAHEAE--GNAVTILSARVPDPTGYG
GLMU_LEIXX      -----SGDVLVVNGDVPLLDAGTLREL------IAAHRAG--GSAATILSAFPAVAAGYG
GLMU_BIFLO      ---KVDGPVLIAASDMPLLDSETLHRL------VEFHTAS--GNGATVLTTILDDPTGYG
GLMU_BDEBA      ------GVVVIMNGDHPLIEASDIKDF------VRIFRDE--KCDLAVVTAVLKNPGEFG
GLMU_FUSNN      ------GDVLIINGDIPLIRKQTLIDF------YNLYKNE--NADGIILSAIFENPFSYG
GLMU_THEMA      ------DDVLILYGDVPLISENTLKRM------IEEHR-K--GADVTILVADLEDPSGYG
GLMU_THET2      ------GPFLVTQGDTPLLSPRTLEAL------LRRVRE---GAGMALLTAELPDPTGYG
GLMU_THET8      ------GPFLVTQGDTPLLSPRTLEAL------LRRVRE---GAGMALLTAELPDPTGYG
GLMU_DEIRA      ------ADILVLYGDTPLLRPDTLREL------VASHREQ--GSAMTVLTGELPDATGYG
GLMU_AQUAE      ------GYVLIINGDSPLVSGETIRNMQQFIHMVRTYEGI--KLGGVVLTTHLPDPTGYG
GLMU_DESAG      -----IDYVLVINGDTPLVRPDSIVRLL-----DRTAGSG---ADVGFITLTLEDPAAFG
GLMU_DESVH      -----LDRVVVVNGDTPLLATETIDFFL-----KESAE-----ADIAFMTLTLPDPGAYG
GLMU_AGRFC      --GFDDVIVA--YGDVPLITSATLDRAR------EAIAAG---ADVAVIGFHTDRPTGYG
GLMU_RHIME      --GYDDVLVV--FGDTPLITAAPLKAAR------DGLAAG---NDVVVIGFQATDPTGYG
GLMU_BRUAB      --GYDDLLIV--FGDTPLIEAQSLLAAR------ERLAQG---ADLVVIGFRPASPHGYG
GLMU_BRUME      --GYDDLLIV--FGDTPLIEAQSLLAAR------ERLAQG---ADLVVIGFRPASPHGYG
GLMU_BRUSU      --GYDDLLIV--FGDTPLIEAQSLLAAR------ERLAQG---ADLVVIGFRPASPHGYG
GLMU_RHILO      --GYDDILVM--FGDTPLIDAEALNLAR------LKLAEG---AAVAVIGFRPPLPNGYG
GLMU_BARHE      --GVDDVLIV--FGDTPLIEQDSLLQLR------AQLAGG---ADVVVAGFRAFNPTGYG
GLMU_BARQU      --EVDDVLIV--FGDTPLIKQDSLLKVR------EQLAVG---ADVVVAGFYASDPTGYG
GLMU_BRADU      --GVDDLLIA--FGDTPLISAETFARLR------APLANG---AALAALGFRAADPAGYG
GLMU_NITWN      --GADDLLIA--FGDTPLISADTFARMR------APLRAG---ASLAVLGFHARDPAGYG
GLMU_RHOPA      --GADDLLIA--FGDTPLISAETFARLR------EPLHDG---SSLVVLGFRAADPTGYG
GLMU_CAUVC      --FHGDVVVT--YADCPLTTAPVIAPLF------DLITHV---AHVAVLGFEAQNPTGYG
GLMU_CERS4      --APGEAVVL--YGDTPFIRPETLERML------DLRSR----HAVVVLGFEATDPGRYG
GLMU_RUEPO      --FEGDVVVL--YGDTPFLQPDTLERML------AARKT----HDLVILGFEAADPARYG
GLMU_GLUOX      ---TGDVAIL--YADNPLITAETMRRLL------AARREG---ASLALLGMRPAEPGRYG
GLMU_ZYMMO      --FKGDIVVL--YGDVPLVQPKTIKALL------ERLHHED-KPTVAVLAFRPDDPRQYG
GLMU_WOLPM      --LPDSSIVVVQYGDTPLIKSSTITKMI------SYLE----GKALVCLGFRTSN-KEYG
GLMU_WOLTR      --LSDSNIIVVQYGDTPLIKNSTITQMV------SCLE----GKALVCLGFKTSN-KEYG
GLMU_ANAMM      --PSE-EIVLILYGDTPLLDKATVCHAL------DRLSS---GAKIVLVAFKSEN-NQYG
                             .* *      .                                   *

GLMU_ECOLI      RITRENG----KVTGIVEHKDATDE--QRQIQEINTGILIANGADMKRWLAKLTNN-NAQ
GLMU_ECO57      RITRENG----KVTGIVEHKDATDE--QRQIQEINTGILIANGADMKRWLAKLTNN-NAQ
GLMU_SHIFL      RITRENG----KVTGIVEHKDATDE--QRQIQEINTGILIANGADMKRWLAKLTNN-NAQ
GLMU_SHIDS      RITRENG----KVTGIVEHKDATDE--QRQIQEINTGILIANGADMKRWLAKLTNN-NAQ
GLMU_SHISS      RITRENG----KVTGIVEHKDATDE--QRQIQEINTGILIANGADMKRWLAKLTNN-NAQ
GLMU_SHIBS      RITRENG----KVTGIVEHKDATDE--QRQIQEINTGILISNGADMKRWLAKLTNN-NAQ
GLMU_ECOL6      RITRENG----KVTGIVEHKDATDE--QRQIQEINTGILIANGADMKRWLAKLTNN-NAQ
GLMU_SALPA      RITRENG----KVTGIVEHKDATDE--QRQIQEINTGILIANGADLKRWLSKLTNN-NAQ
GLMU_SALTY      RITRENG----KVTGIVEHKDATDE--QRQIQEINTGILIANGADMKRWLSKLTNN-NAQ
GLMU_SALCH      RITRENG----KVTGIVEHKDATDE--QRQIQEINTGILIANGADLKRWLSKMTNN-NAQ
GLMU_SALTI      RITRENG----KVTGIVEHKDATDE--QRQIQEINTGILIANGADLKRWLSKLTNN-NAQ
GLMU_YERPE      RIVRENG----DVVGIVEHKDASDA--QREINEINTGILVANGRDLKRWLSLLDNN-NAQ
GLMU_YERPS      RIVRENG----DVVGIVEHKDASDA--QREINEINTGILVANGRDLKRWLSLLDNN-NAQ
GLMU_PECAS      RIVREKG----AVVGIVEHKDASEA--QRQINEINTGILIANGKDLKRWLSQLNNN-NAQ
GLMU_PHOLL      RIVRENG----EVTGIIEQKDATEE--QRKINEINTGILVANGSDLKRWLSQLDNN-NVQ
GLMU_HAEIN      RIIRENG----NVVAIVEQKDANAE--QLNIKEVNTGVMVSDGASFKKWLARVGNN-NAQ
GLMU_HAEI8      RIIRENG----NVVAIVEQKDANAE--QLNIKEVNTGVMVSDGASFKKWLARVGNN-NAQ
GLMU_MANSM      RIIREKG----SVVAIVEQKDADAE--QLKITEVNTGVMVSDGASFKKWLGRLNNN-NAQ
GLMU_PASMU      RIVRENG----NVVAIVEQKDANAE--QLKIQEINTGLLVADGKSLKKWLSQLTNN-NAQ
GLMU_HAEDU      RIIRQNG----SVVAIVEQKDASPT--QLTICEVNTGVMVASGASFKKWLSRLNNQ-NAQ
GLMU_VIBVU      RIVRKNG----PVVAIVEQKDANEE--QKLIKEINTGVMVATGGDLKRWLAGLNND-NAQ
GLMU_VIBVY      RIVRKNG----PVVAIVEQKDANEE--QKLIKEINTGVMVATGGDLKRWLAGLNND-NAQ
GLMU_VIBPA      RIIRKNG----PVVAIVEQKDASEE--QKQIKEINTGVMVATGGDLKRWLSGLNNN-NAQ
GLMU_VIBCH      RIVRKRG----PVVAIVEQKDASEE--QKLIKEVNTGVLVATGRDLKRWLAGLNNN-NAQ
GLMU_ALIF1      RIIRRNG----PVIAIVEQKDATEE--QKLIKEINTGVMVATGGDLKRWLAALKNE-NAQ
GLMU_PHOPR      RIVRRNG----PVVAIVEQKDASEE--QKLIKEINTGVMVANGGDLKRWLGQLKNE-NSQ
GLMU_COLP3      RIVRQEISGKQQVVGIIEQKDANEE--QLKINEANTGILLANGGDLKRWLSNLSSD-NAQ
GLMU_PSET1      RMLRVDG----KLVGIVEQKDASPE--QLLISEVNTGIMAVNGRLLKSWLGNLSNN-NAQ
GLMU_SHEON      RIVREQG----KVVGIVEQKDANPE--QLAINEVNTGIMAVPGNALKTWLDRLSNN-NAQ
GLMU_IDILO      RIVRNER---RSVTGIVEQKDANAQ--QLAINEVNTGIMIADSDKLKSWLEQLSND-NAQ
GLMU_PSESM      RIVRDDQ---HRVCAIVEHKDATDA--QKAITEGNTGILAVPASHLQDWLGRLSNN-NAQ
GLMU_PSEU2      RIVRDDQ---NRVCAIVEHKDASDA--QKAITEGNTGILAVPAAHLADWLGRLSNN-NAQ
GLMU_PSE14      RIVRDQQ---NRVCAIVEHKDANDV--QKAITEGNTGILAVPAKRLADWLGRLSNN-NAQ
GLMU_PSEPK      RIVRDEQ---GKVTAIVEHKDANDA--QKAIKEGNTGILALPAARLADWMGRLSNN-NAQ
GLMU_PSEF5      RIVRDAD---GKVVAIVEQKDADEA--TRAITEGNTGILAVPGKRLGDWTGRLSNN-NAQ
GLMU_PSEPF      RIVRDAD---GKVAAIVEHKDASEA--QRAITEGNTGILAVPANRLADWMSRLSNN-NAQ
GLMU_PSEAE      RIVRDDQ---GAVQAIVEHKDATPA--QRQIGEINTGILAVPGKRLADWLGRLSND-NAQ
GLMU_NEIGO      RIIRDGSG---SVTAIVEEKDASAT--QKTIREINTGILVLPNAKLENWLNSLSSN-NAQ
GLMU_NEIG1      RIIRDGSG---SVTAIVEEKDASAT--QKTIREINTGILVLPNAKLENWLNSLSSN-NAQ
GLMU_NEIMA      RIIRDSSG---SVTAIVEEKDADAA--QKAVKEINTGILVLPNAKLEAWLNSLSSN-NAQ
GLMU_NEIMB      RIIRDSNG---SVTAIVEEKDADAV--QKAVKEINTGILVLPNAKLENWLNSLSSN-NAQ
GLMU_CHRVO      RMVRGADG---KLQAIVEHKDCTPE--QLAIREINTGMMALPNARLADWLSALNNG-NAQ
GLMU_AROAE      RILRDGAG---RVVRIVEEKDASAD--ERRVREVNTGILVAPVARLRDWLARLGND-NAQ
GLMU_DECAR      RIVRDGAG---NMISIVEEKDASAE--QKAIREVNTGIMAVPTARLADWLGKLKND-NAQ
GLMU_BURMA      RIVRDQAG---CVTRIVEQKDASPD--ELRIDEINTGIVVAPTAQLSMWLGALGND-NAQ
GLMU_BURP1      RIVRDQAG---CVTRIVEQKDASPD--ELRIDEINTGIVVAPTAQLSMWLGALGND-NAQ
GLMU_BURPS      RIVRDQAG---CVTRIVEQKDASPD--ELRIDEINTGIVVAPTAQLSMWLGALGND-NAQ
GLMU_BURL3      RIVRDAAG---FVTRIVEQKDASPE--QLKIAEINTGIIVTPTAQLSMWLGALKNE-NAQ
GLMU_CUPPJ      RIVRDAAG---SIVRIVEQKDASEA--VRAIREINTGIIVCPTGHLRRWLATLRND-NAQ
GLMU_RALSO      RIVRDATG---RITRIVEQKDANET--QLAIHEVNTGILVCPTARLKTWLATLRND-NAQ
GLMU_THIDA      RIVRENA----RVARIVEHKDASAA--ERAIQEVNTGILAVPTRHLKRWIGELRND-NAQ
GLMU_BORBR      RIVRDAQG---QVCRIVEHKDASEA--ERAIKEVNTGILAAPTARLKDWLGRITND-NAQ
GLMU_BORPA      RIVRDAQG---QVCRIVEHKDASEA--ERAIKEVNTGILAAPTARLKDWLGRITND-NAQ
GLMU_BORPE      RIVRDAQG---QVCRIVEHKDASEA--ERAIKEVNTGILAAPTARLKDWLGRITND-NAQ
GLMU_NITEU      RIVRDPVTN--RIQAIVEEKDASQS--QKKIREINTGIMVLPNGRLGNWLDNLSDA-NTQ
GLMU_LEGPA      RIIRNNQG---EIYSIVEEKDANEQ--VKNIKEIYSGVCCTLANNLKKWLPQLSNS-NAQ
GLMU_LEGPH      RIIRNNQG---EIYSIVEEKDANEQ--VKNIKEIYSGVCCTLANNLKKWLPQLSNS-NAQ
GLMU_LEGPL      RIIRNNQG---EIYSIVEEKDANEQ--VKNIKEIYSGVCCTLANNLKKWLPQLSNS-NAQ
GLMU_COXBU      RIIRDDFG---NILSIVEHKDAEEH--QLKIREINTGIMTTTAMNLKKWLPQLNNN-NCQ
GLMU_METCA      RIIRDASG---RVLRIVEEKDATPE--ERAVREVNTGILAVEGAPLKRWLKALRND-NAQ
GLMU_NITOC      RIIRDRVG---GVSKIIEEADASPE--QRRIREVNTGITAIEARYLKQIAPKLSNN-NAQ
GLMU_XANAC      RILRDAEG---KVAAIVEQKDANDE--QRRIRTINTGILTAESTALRRWLAGLSND-NAQ
GLMU_XANC5      RILRDAEG---KVAAIVEQKDANDE--QRRIRTINTGILTAESTALRRWLAGLSKD-NAQ
GLMU_XANOR      RILRDAEG---KVAAIVEQKDANDE--QRRIRTINTGILTAESTALRRWLGGLSND-NAQ
GLMU_XANC8      RIVRNPEG---KVAAIVEQKDADDE--QRRIRTINTGILTAESTALRRWLGGLSND-NAQ
GLMU_XANCP      RIVRNPEG---KVAAIVEQKDADDE--QRRIRTINTGILTAESTALRRWLGGLSND-NAQ
GLMU_XYLFA      HIVRNSEG---KVAAIIEDKDADEE--QRRIHTVNTGILCAESTALRRWLSKLSNT-NMQ
GLMU_XYLFT      HIVRNSEG---KVAAIIEDKDADEE--QRRIHTVNTGILCAESTALRRWLSKLSNT-NMQ
GLMU_ACIAD      RIIRE-SD---KIQAIVEHKDASEQ--QRQIQEINTGIYCVSNQKLHEWLPKLSNN-NAQ
GLMU_PSYA2      RIKRDKAG---NIEAIIEQKDASSD--EQQIQEINSGIYCVDNALLHKFLPKLSND-NAQ
GLMU_FRATT      RIVRDKFG---AVTEIVEEKDANDI--QRQIKEINTGIYCVHKNLLQKWLPEIKAN-NVQ
GLMU_BUCAI      RILRKK----GKVISIIEDQDASNE--QKNIKEIYSGIFIAQSKDLTRWLKKIDKK-NEK
GLMU_BUCAP      RVFKKN----GKVIKIIEEQDANFH--EKKIKEVYSGTFIANGKDLKRWLNQINNK-NIK
GLMU_BUCBP      RIIRKN----KKIVKIIEYKDATDE--QLNIKEVNSGILIVSSTNLKKWIFQIHAK-NNQ
GLMU_WIGBR      RIIRKN----GKISKIIEHEDALSI--DKNIREINTGVMVVNRYYLRFWLNKLLNKRNKD
GLMU_BLOFL      RIIRNQY---GDVVSIIEDIDIVNQN-DRIIKEIHSGIFISVSGYLKSWLNYLIENNLWC
GLMU_BLOPB      RIVRNQE---GSVVSIIEHDDIINDD-QKKIKEVSTGIFIAISNHLKCWLSTLTTHKS-K
GLMU_CAMJE      RVVIKNDS----VEKIVEFKDANTQ--EKEINTCNAGVYVIDSRLLKELLPLIDNN-NAA
GLMU_CAMJR      RVVIKNDS----VEKIVEFKDANTQ--EKEINTCNAGVYVIDSRLLKELLPLIDNN-NAA
GLMU_HELHP      RVVMESGV----VQRIIEQKDAKES--ELLIKDVNAGVYKIHKSILDLYLPQVGNA-NNQ
GLMU_WOLSU      RVVIHGGS----VERIVEEKDATGE--EKSLGTVNAGVYLFDRALLACYLPRLKND-NAQ
GLMU_HELPJ      RVILENHQ----VKKIVEEKDANDE--EKTIKSVNAGVYFFERKFLERYLPKLHDQ-NAQ
GLMU_HELPY      RVVLENHQ----VKKIVEEKDANDE--EKEIKSVNAGVYGFERDFLEKYLPKLHDQ-NAQ
GLMU_GEOSL      RIIRG-FD--GRVIRIVEEKDATPD--ERSRTEVNAGIYCAEASFLFDAVKRIGND-NAQ
GLMU_PELCD      RILRE-GD---EVLGIVEEKDASSE--QKTIREINTGIYAFEAPFVFEALSGVGCD-NAQ
GLMU_BACSU      RIIRS-EN--GAVQKIVEHKDASEE--ERLVTEINTGTYCFDNEALFRAIDQVSND-NAQ
GLMU_BACLD      RIIRN-EN--GDVAKIVEHKDATEE--ERLVKEINTGTYCFDNEALFQTIEQVSND-NVQ
GLMU_BACAN      RIVRN-EN--GHVEKIVEHKDANEK--ELAIKEINTGTYCFDNKALFASLSKVSND-NVQ
GLMU_BACC1      RIVRN-EN--GHVEKIVEHKDANEK--ELAIKEINTGTYCFDNKALFASLSKVSND-NVQ
GLMU_BACHK      RIVRN-EN--GHVEKIVEHKDANEK--ELAIKEINTGTYCFDNKALFASLSKVSND-NVQ
GLMU_BACCZ      RIVRN-EN--GHVEKIVEHKDANEK--ELAIKEINTGTYCFDNKALFASLSKVSND-NVQ
GLMU_BACCR      RIVRN-EN--GHVEKIVEHKDANEK--ELAIKEINTGTYCFDNKALFASLSKVSND-NVQ
GLMU_GEOKA      RIVRN-EA--GHVEKIVEHKDASEQ--ERNIREINTGTYCFDNETLFQALTKVTNQ-NAQ
GLMU_ALKHC      RIVRN-DK--GLVERIVEHKDATSE--EKQITEVNTGTYCFDNEALFQALKEVGNN-NAQ
GLMU_OCEIH      RVVRN-DQ--DEVERIVEHKDANEG--ERLIQEINTGTYCFDNQALFAALKEVSND-NAQ
GLMU_LISMF      RIIRD-DL--GIVEKIVEHKDATEK--EQRISEINTGTYCFDNKALFEALENVSND-NVQ
GLMU_LISMO      RIIRD-DL--GIVEKIVEHKDATEK--EQRISEINTGTYCFDNKALFEALENVSND-NVQ
GLMU_LISIN      RIIRD-DL--GIVEKIVEHKDATEK--EQRISEINTGTYCFDNKALFEALENVSND-NVQ
GLMU_BACSK      RVIRG-NQ--GQVEKIVEHKDASVD--ELAIAEVNTGTYCFDNEALFEALAEVKNE-NAQ
GLMU_LACPL      RVVRN-RL--GIVEKIVEQKDATKE--EQEIHEINTGVYCFDNQKLFAALHEVTND-NAQ
GLMU_LACSS      RIIRN-DI--GIVEKIVEQKDTNDK--EAAVNEINTGVYCFDNKTLFQALHEVTNE-NAQ
GLMU_ENTFA      RIIRD-HV--GIVERIVEQKDASEE--EARVQEINTGTFCFDNESLFEALAKTDTN-NTQ
GLMU_LACAC      RIIRD-EQ--GNVLRIVEQKDGNPE--ELKVKEINTGVFCFDNKKLFEALKHVDNN-NAQ
GLMU_LACJO      RIIRD-ED--GNVLRIVEQKDGTPE--ELAVDEINTGVFCFDNKELFKALKQVGND-NAQ
GLMU_STAAC      RIVRN-AS--GRLERIVEEKDATQA--EKDINEISSGIFAFNNKTLFEKLTQVKND-NAQ
GLMU_STAAS      RIVRN-AS--GRLERIVEEKDATQA--EKDINEISSGIFAFNNKTLFEKLTQVKND-NAQ
GLMU_STAAW      RIVRN-AS--GRLERIVEEKDATQA--EKDINEISSGIFAFNNKTLFEKLTQVKND-NAQ
GLMU_STAAR      RIVRN-AS--GRLERIVEEKDATQA--EKDINEISSGIFAFNNKTLFEKLTQVKND-NAQ
GLMU_STAAM      RIVRN-AS--GRLERIVEEKDATQA--EKDINEISSGIFAFNNKTLFEKLTQVKND-NAQ
GLMU_STAAN      RIVRN-AS--GRLERIVEEKDATQA--EKDINEISSGIFAFNNKTLFEKLTQVKND-NAQ
GLMU_STAEQ      RIIRN-HN--GILERIVEEKDANDS--ERAIKEISSGIFAFNNRVLFEKLEQVKND-NAQ
GLMU_STAES      RIIRN-HN--GILERIVEEKDANDS--ERAIKEISSGIFAFNNRVLFEKLEQVKND-NAQ
GLMU_STAEP      RIIRN-HN--GILERIVEEKDANDS--ERAIKEISSGIFAFNNRVLFEKLEQVKND-NAQ
GLMU_STAHJ      RIVRD-EQ--RRLQRIVEEKDASEA--QKALTEISSGIFAFDNRVLFSKLEEVKND-NAQ
GLMU_STAS1      RILRD-SE--GRLVSIVEQKDATDA--EQQINEISSGIFAFDNQVLFEKLELVKND-NAQ
GLMU_STRA1      RIIRN-SD--DEVTKIVEQKDANDF--EQQVKEINTGTYVFDNQSLFEALKDINTN-NAQ
GLMU_STRA5      RIIRN-SD--DEVTKIVEQKDANDF--EQQVKEINTGTYVFDNQSLFEALKDINTN-NAQ
GLMU_STRA3      RIIRN-SD--DEVTKIVEQKDANDF--EQQVKEINTGTYVFDNQSLFEALKDINTN-NAQ
GLMU_STRT1      RIIRN-EN--GEVTKIVEQKDANEF--EQQVKEINTGTYVFDNKRLFEALKNINTN-NAQ
GLMU_STRT2      RIIRN-EN--GEVTKIVEQKDANEF--EQQVKEINTGTYVFDNKRLFEALKNINTN-NAQ
GLMU_STRPN      RIVRN-DN--AEVLRIVEQKDATDF--EKQIKEINTGTYVFDNERLFEALKNINTN-NAQ
GLMU_STRR6      RIVRN-DN--AEVLRIVEQKDATDF--EKQIKEINTGTYVFDNERLFEALKNINTN-NAQ
GLMU_STRMU      RIIRN-QN--AEVIKIVEQKDASDY--EQQVKEINTGTYVFDNKRLFEALKEINTN-NAQ
GLMU_STRP1      RIVRN-KD--GEVIKIVEQKDANEY--EQQLKEINTGTYVFDNKRLFEALKCITTN-NAQ
GLMU_STRPM      RIVRN-KD--GEVIKIVEQKDANEY--EQQLKEINTGTYVFDNKRLFEALKCITTN-NAQ
GLMU_STRP6      RIVRN-KD--GEVIKIVEQKDANEY--EQQLKEINTGTYVFDNKRLFEALKCITTN-NAQ
GLMU_STRP3      RIVRN-KD--GEVIKIVEQKDANEY--EQQLKEINTGTYVFDNKRLFEALKCITTN-NAQ
GLMU_STRP8      RIVRN-KD--GEVIKIVEQKDANEY--EQQLKEINTGTYVFDNKRLFEALKCITTN-NAQ
GLMU_STREC      RIIRN-AA--GEVVNIVEQKDANEA--EQEVKEINTGTYIFDNKRLFEALKHLTTD-NAQ
GLMU_LACLA      RIIRD-EN--GSVEKIVEQKDANDF--EKSITEINTGTYIFDNKSLFKALNEITTD-NAQ
GLMU_CLOPE      RIVR--NG--ESVEKIVEHKDCNEQ--EIKIQEVNAGMYCFDIESLLTSLEQLSND-NAQ
GLMU_CLOTE      RVLRE-NN--GEVDKIIEHKDCLKE--ELKIKEINAGMYCFNIQALLEALDKLDNN-NAQ
GLMU_CLOAB      RIIRN-VD--GSVKKIVEHKDCTED--ELKVKEINSAMYCFDIKSLLESLDKLNNN-NVQ
GLMU_CALS4      RIIRD-ES--GNVVKIVEEKDASEE--EKRVKEINSGMYVVDIAKLRAALKEITND-NAQ
GLMU_CARHZ      RIVRD-GY--GKIIKIVEEKDATLE--EKQIAEVNTGIYCFNTKILKEILPLLKAE-NAQ
GLMU_SYMTH      RILRDPAT--GAFLGSVEYKDATPE--QRRIREIWTGVAVFRRAGFTALLNRLDRN-NAQ
GLMU_NOSS1      RVFCN-GN--NIVQQIVEDKDCSPA--QRQNHRINAGIYCFRWENLAQVLPHLEAN-NAQ
GLMU_THEEB      RVICD-SQ--NMLKQIIEDRDCTTA--QKQNCRINAGVYCFHWPQLAAVLPHLQSN-NDQ
GLMU_SYNP6      RVFCD-AT--SRVCEIIEDRDCTPA--QRQNPRVNAGVYCFRWPDLEAVLPNLSTA-NDQ
GLMU_SYNY3      RVFCN-GD--NRVTQIVEDRDCNAA--QRQNHRVNGGIYCFHWPRLAAALPKLSAN-NDQ
GLMU_GLOVI      RVFLD-AD--GRVRQVIEDRDCTEE--QRRNDLINGGVYCFRWPALMTVLPALSAD-NDQ
GLMU_PROMA      RVFSN-EH--GHIEKIIEDRDCTKL--EAKNNLTNAGIYCFDWESLSKILPYISNK-NNQ
GLMU_PROMT      RVFTD-ES--GLVKKIIEERDCTNE--QRKNKLINAGIYCFNWQQLSDVLNLLSNQ-NSQ
GLMU_PROMM      RVFSD-QQ--GRVSSIVEHRDCSDE--QRHNNLTNAGIYCFNWKKLAAVLPQLCSD-NDQ
GLMU_SYNPX      RVFVD-AD--GKVSAIVEHRDCSEE--QLSNNLTNAGIYCFNWQALAEVLPKLSTD-NDQ
GLMU_PROMP      RVFT--KN--NLIERIVEEKDCNKD--ERSNLLTNAGIYCFSWKRLSKIINTLKSN-NKQ
GLMU_COREF      RIVRN-AD--GEVTAIVEQKDASDE--ERSITEVNSGVFAFDATILRSALSQLKSD-NAQ
GLMU_CORGL      RIVRN-EE--GEVTAIVEQKDASAE--VQAIDEVNSGVFAFDAAILRSALAELKSD-NAQ
GLMU_CORDI      RIVRN-DE--GEVTAIVEQKDGDEE--TLKITEVNSGVFAFDAAILRSSLGKLDSN-NAQ
GLMU_CORJK      RILRT-ND--GMVTAIVEEKDATEK--QKEITEVNSGVFAFDAAILRDGLAQLNTD-NAQ
GLMU_MYCBO      RILRT-QD--HGVMAIVEQTDATPS--QREIREVNAGVYAFDIAALRSALSRLSSN-NAQ
GLMU_MYCTU      RILRT-QD--HEVMAIVEQTDATPS--QREIREVNAGVYAFDIAALRSALSRLSSN-NAQ
GLMU_MYCPA      RILRT-QD--NEVTAIVEHADATES--QREIREVNAGVYAFDTAALRSALNRLSAD-NAQ
GLMU_MYCLE      RILRT-QD--NEVMAIIEHADASPS--QREIREVNAGVYAFDITALRSALIRLNSN-NTQ
GLMU_NOCFA      RIVRD-AD--GQVVEIVEHADATPE--QAAITEVNSGVYAFDATVLRAMIGRLSTA-NAQ
GLMU_STRAW      RIVRDGAS--GAVTAIVEHKDASES--QRAVREINSGVFAFDGRLLADALGKVRTD-NSQ
GLMU_STRCO      RIVRDGAS--GAVTAIVEHKDASES--QRAIREINSGVFAFDGQLLADALGKVRTD-NSQ
GLMU_THEFY      RIVRD-AA--GAVTGIVEHADATEE--QRAVDEINSGMYAFDGALLSQVVHRLSAD-NAK
GLMU_LEIXX      RIVRT-ST--GRLDRIVEHKDATEA--ERAIGEINAGIYVFGAAALRDKLAAITTD-NAQ
GLMU_BIFLO      RIIRD-RE--GNVLRIVEQKDANRS--ELAVQEVNTSVYVFEASVLTEAIAGLKSN-NAQ
GLMU_BDEBA      RIVRH--K--GDLAAIVEAKDASAE--ALKIREINTGIYIVKASVLSEYLPQISNN-NAK
GLMU_FUSNN      RVIKD--G--NKVLRIVEEKEANEE--QKKVKEINAGVYIFKAQALVKALEKINNN-NEK
GLMU_THEMA      RVIQD-----GDKYRIIEDTDLPEE--LKSVTTINTGFYVFSGDFLLRALPEIKNE-NAK
GLMU_THET2      RILR-EGE--E-VLGNVEEKDAPPE--VRAIREVNAGAYAF-DGFLFQALKEVRNE-NAA
GLMU_THET8      RILR-EGE--E-VLGNVEEKDAPPE--VRAIREVNAGAYAF-DGFLFQALKEVRNE-NAA
GLMU_DEIRA      RIVRGEGG--A-VERIVEQKDASDA--EKAIGEFNSGVYVF-DERAPELARRIGND-NKA
GLMU_AQUAE      RIIKEEGT--DRIIRIVEEKDATPE--EKAITEINAGTYIFYAPYLLEALYRIKPS-PVT
GLMU_DESAG      RVVRRHGH----VAAVIEAKDYDTAQHGPEPREINAGIYLLKVAAVSPLLPLLTNA-NAS
GLMU_DESVH      RVVRHNGH----VAAIVEAKDYDEALYGPEPSEINTGIYALRLDAVESLLPRLTNA-NRS
GLMU_AGRFC      RLLVENGE----LVAIREEKDATDE--ERKVTWCNSGLMAINGRNALDLLDRIGNS-NVK
GLMU_RHIME      RLIVKDGA----LVAIREHRDASDE--ERRITYCNGGLMAIDGRKALDLLNRIGNA-NAK
GLMU_BRUAB      RLIEEGGQ----LVAIIEEKEATDE--QKKIGFCNGGLMALRGQHALALLDAVGND-NAK
GLMU_BRUME      RLIEEGGQ----LVAIIEEKEATDE--QKKIGFCNGGLMALRGQHALALLDAVGND-NAK
GLMU_BRUSU      RLIEEGGQ----LVAIIEEKEATDE--QKKIGFCNGGLMALRGQHALALLDAVGND-NAK
GLMU_RHILO      RLVEKGGK----LIAIREEKDCSEA--EKKIGFCNAGMMAVAGAHALKLLDAVGNK-NAK
GLMU_BARHE      RLLEKNGK----LIAIIEEKDASDE--EKKLSFCNGGILALNGKYALSLLEKIGNN-NSK
GLMU_BARQU      RLLEKNGK----LIAIVEEKDASDE--EKKISFCNGGILALNGKRALSLLEKVNNY-NSK
GLMU_BRADU      RFIVEGDR----LVAIREQADASAD--ERKIDLCNAGVMAIDGRRALAILDKIGNA-NSK
GLMU_NITWN      RLIVTDGR----LTAIREDADASPE--ERRMTLCNAGVMAFDGRTALRIIEKIGNA-NSK
GLMU_RHOPA      RLVVQDGK----LTAIREQADASAD--ELKITLCNAGVMAIDGKIALDVLDKIGNA-NAK
GLMU_CAUVC      RLILAPGHV---LLRIVEEKEADLA--TKQVKHCNSGVLAADRAVLFDLLANVRND-NAK
GLMU_CERS4      RLVTRGEE----LDRIVEWKDATDE--ERTISLCNSGVICAEAGLLLALVSEVGNA-NAA
GLMU_RUEPO      RLVMQGDS----LERIVEFKEATEQ--ERAIRFCNSGLLACNAETLFALIAAVGNN-NAS
GLMU_GLUOX      RIVEDHGR----VVKIVEFKDATED--ERRITLCNAGVMCAGVDDFRTWLANVGND-NAQ
GLMU_ZYMMO      RIVTDKTAH---IQKMVEYKDASEE--ERAITLCNSGLLAIRAHDLWPLLSRVQNN-NAS
GLMU_WOLPM      RLIIENGS----LREIVEAKSD-KN--NHEEFLANAGIMVACAKNLRELVEKIECN-SST
GLMU_WOLTR      RLIIENGS----LREIVETQDD-EN--SDEEFLANAGIMVAYAKNLRELVEKIECN-GST
GLMU_ANAMM      RIVL--GS----SGNVLEVSHG-RD--TNG--LAVSGAIAGYRQVISGLLGGLSCR-DG-
                :.               *                  .                       

GLMU_ECOLI      GEYYITDIIALAYQEGREIVAVHPQRLSEVEGVNNRLQLSRLERVYQSEQAEKLLLAGVM
GLMU_ECO57      GEYYITDIIALAYQEGREIVAVHPQRLSEVEGVNNRLQLSRLERVYQSEQAEKLLLAGVM
GLMU_SHIFL      GEYYITDIIALAYQEGREIVAVHPQRLSEVEGVNNRLQLSRLERVYQSEQAEKLLLAGVM
GLMU_SHIDS      GEYYITDIIALAYQEGREIVAVHPQRLSEVEGVNNRLQLSRLERVYQSEQAEKLLLAGVM
GLMU_SHISS      GEYYITDIIALAYQEGREIVAVHPQRLSEVEGVNNRLQLSRLERVYQSEQAEKLLLAGVM
GLMU_SHIBS      GEYYITDIIALAYQEGREIVAVHPQRLSEVEGVNNRLQLSRLERVYQSEQAEKLLLAGVM
GLMU_ECOL6      GEYYITDIIALAYQEGREIVAVHPQRLSEVEGVNNRLQLSRLERVYQSEQAEKLLLAGVM
GLMU_SALPA      GEYYITDIIALAYQEGREIAAVHPARISETDGVNNRLQLSRLERIYQAEQAEKLLLSGVM
GLMU_SALTY      GEYYITDIIALAYQEGREIAAVHPARISETDGVNNRLQLSRLERIYQAEQAEKLLLSGVM
GLMU_SALCH      GEYYITDIIALAYQEGREIAAVHPARISETDGVNNRLQLSRLERIYQAEQAEKLLLSGVM
GLMU_SALTI      GEYYITDIIALAYQEGREIAAVHPARISETDGVNNRLQLSRLERIYQAEQAEKLLLSGVM
GLMU_YERPE      GEFYITDIIALAHADGKKIATVHPTRLSEVEGVNNRLQLSALERVFQTEQAEKLLLAGVM
GLMU_YERPS      GEFYITDIIALAHADGKKIATVHPTRLSEVEGVNNRLQLSALERVFQTEQAEKLLLAGVM
GLMU_PECAS      GEFYITDIIAMASAEGQRVEAVHPERLSEVEGVNNRLQLSALERIYQREQADKLLLAGVM
GLMU_PHOLL      GEYYLTDVIALAYKEGRKIEAVHPTRLSEMEGVNNRLQLSALERIYQSEQAEQLLLAGVM
GLMU_HAEIN      GEYYLTDLIALANQDNCQVVAVQATDVMEVEGANNRLQLAALERYFQNKQASKLLLEGVM
GLMU_HAEI8      GEYYLTDLIALANQDNCQVVAVQATDVMEVEGANNRLQLAALERYFQNKQASKLLLEGVM
GLMU_MANSM      GEYYMTDVIGLANQDGFQVAAVSATDKMEVEGANNRLQLAALERYYQHKQAERLLLEGVM
GLMU_PASMU      GEYYITDVIALANQDGCQVVAVQASDFMEVEGVNNRQQLARLERYYQRKQADNLLLAGVA
GLMU_HAEDU      GEYYITDIIAMANQEGYSVQAVQANTLMEVEGANNHLQLAALERFYQQTQAEKLLLSGVS
GLMU_VIBVU      GEYYLTDVIAAAHDEGNAVEAVHPVSPIEVEGVNDRAQLARLERAFQAAQAKKLLEQGVM
GLMU_VIBVY      GEYYLTDVIAAAHDEGNAVEAVHPVSPIEVEGVNDRAQLARLERAFQAAQAKKLLEQGVM
GLMU_VIBPA      GEYYLTDVIAAAHDEGRAVEAVHPVNAIEVEGVNDRAQLARLERAFQSMQAQKLLEQGVM
GLMU_VIBCH      GEYYLTDVIAAAHDEGRAVEAVHPSHSIEVEGVNDRIQLARLERAFQARQAKKLLEQGVM
GLMU_ALIF1      GEYYLTDIIAAAHDEGRAVEAVHPVSPIEVEGVNDRAQLARLERAYQAAQAQKLLEQGVM
GLMU_PHOPR      GEYYLTDIIAIAHDEGRAVEAVHPVNPIEVEGVNNRIQLARLERAYQAMQAERLLEQGVM
GLMU_COLP3      GEYYLTDIIAAAHGEGKVVATAHPETEIEVEGANNRVQLATLERAYQARIAEELMIAGAS
GLMU_PSET1      GEYYLTDIVAMAHSEGVEITSAQPDHPMEVEGANNRIQLAGLERAYQAWQAQELMLNGAT
GLMU_SHEON      GEYYLTDIIAMAHADGVEINTAQPQSAIEVEGANNRVQLAQLERAYQAREAEKLMIAGAN
GLMU_IDILO      KEYYLTDIVAMAAREGINIATAQPDNAQEVEGANNRQQLASLERALQQRQAEELMTQGVT
GLMU_PSESM      GEYYLTDVIAMAVNDGLVVATEQPHDAMEVQGANDRKQLSELERHYQLREARRLMAAGVT
GLMU_PSEU2      GEYYLTDVIAMAANDGLVVATEQPHDAMEVQGANDRKQLSELERHYQMREARRLMAAGVT
GLMU_PSE14      GEYYLTDVIAMAVNDGLIVATEQPYGAMEVQGANDRKQLSELERHYQLREARRLMAGGVT
GLMU_PSEPK      GEYYLTDVIAMAVADGLVVATEQPHDAMEVQGANDRRQLSELERHYQLREGRRLMAQGVT
GLMU_PSEF5      GEYYLTDVIAMAVSDGLIVATEQPHDAMEVQGANDRKQLAELERHYQLRAGRRLMAQGVT
GLMU_PSEPF      GEYYLTDVIEMAVSDGLTVATEQPHDPMEVQGANDRKQLSELERHYQLRAGRRLMAQGVT
GLMU_PSEAE      GEYYLTDVIAMAVGDGLVVASAQPLDAMEVQGVNDRMQQAQLERHYQRLRAEELMRQGVT
GLMU_NEIGO      GEYYLTDLIAKAVADGIKVRPVRVRASHLAAGVNNKRQLAELERIFQTEQAQELLKAGVT
GLMU_NEIG1      GEYYLTDLIAKAVADGIKVRPVRVRASHLAAGVNNKRQLAELERIFQTEQAQELLKAGVT
GLMU_NEIMA      GEYYLTDLIAKAVADGIKIHPVQVRSSHLAAGVNNKLQLAELERIFQTEQAQELLKAGVT
GLMU_NEIMB      GEYYLTDLIAKAVADGIKVHPVQVRASHLAAGVNNKLQLTELERIFQTEQAQELLKAGVT
GLMU_CHRVO      GEYYLTDVLELAVKDGVAVESASVDASWEAAGVNNKVQLAELERILQANQARALLEAGVT
GLMU_AROAE      REYYLTDIIGMAVAEGVEVTTVQPDAIWETLGVNSKAQLAELERLHQRNIATRLMEDGVT
GLMU_DECAR      GEYYLTDIIALAVAEGMPVRTAQPEGEWEVLGVNSKVQLAELERQHQLNLAGELLVAGVR
GLMU_BURMA      GEYYLTDVVEQAIEAGFEIVTTQPDDEWETLGVNSKAQLAELERIHQRNLADALLAAGVT
GLMU_BURP1      GEYYLTDVVEQAIEAGFEIVTTQPDDEWETLGVNSKAQLAELERIHQRNLADALLAAGVT
GLMU_BURPS      GEYYLTDVVEQAIEAGFEIVTTQPDDGWETLGVNSKAQLAELERIHQRNLADALLAAGVT
GLMU_BURL3      GEYYLTDVVELAIEAGFEVVTAQPDEEWETLGVNSKAQLAELERIHQRNIAEALLVDGVT
GLMU_CUPPJ      GEYYLTDTVERAATEGIDIVSAQPAALWETLGVNSKVQLAEVERIHQRNLAQRLLETGVT
GLMU_RALSO      GEYYLTDVIERAASEGLPITSAHPLAEWETLGVNSKVQLAELERIHQRNLAQQLLEDGVT
GLMU_THIDA      GEYYLTDIVALAVRDGVEIETHQPQHDWEVLGVNSKAQLAELERIHQNEVAQRLLADGVT
GLMU_BORBR      GEYYLTDVIGLAVGDGVPVGAAQPGASWETLGVNSRVQQAQLERAWQSELARRQLEAGVT
GLMU_BORPA      GEYYLTDVIGLAVGDGVPVGAAQPGASWETLGVNSRVQQAQLERAWQSELARRQLEAGVT
GLMU_BORPE      GEYYLTDVIGLAVGDGVPVGAAQPGASWETLGVNSRVQQAQLERAWQSELARRQLEAGVT
GLMU_NITEU      GEYYLTDIIAMAVDAGIPIETSSPASDWEVSGVNDKIQLSILERAHQQDTANRLMEQGVM
GLMU_LEGPA      GEYYLTEIISLAVQNKTPITSLTAKNSFEVQGINNRQQLQQLERTWQQRAANQLMEKGAT
GLMU_LEGPH      GEYYLTEIISLAVQNKTPITSLTAKNSFEVQGINNRQQLQQLERIWQQRAANQLMEKGAT
GLMU_LEGPL      GEYYLTEIISFAVQNKTPIRSLTTKNSFEVQGINNRQQLQQLERIWQQRAANQLMEKGVT
GLMU_COXBU      KEYYLTDTVALAVAEGCPVGGVAAQCCEEVQGVNDRWELTKLERYYQRLMAKKLSLAGVT
GLMU_METCA      GEYYLTDIVAMAVAEGYFIDATHPTSPDEVLGVNDRRQLAELERIYQVHQARALMERGVT
GLMU_NITOC      GEYYLTDIIEHAVASGEKVVAVSAADSIEVMGVNDRQQLAYLERFYQKREAARLMGEGVS
GLMU_XANAC      AEFYLTDVFASAAADFTPADMVHVADPQDVEGANDPWQLAQLERAWQLRAARTLCLQGVR
GLMU_XANC5      GEFYLTDVFASAAADFTPADMVHVADPQHVEGANDPWQLAQLERAWQLRAARTLCLQGVR
GLMU_XANOR      GEFYLTDVFASAAADFTPADMVHVADPQDVEGANDPWQLAQLERAWQLRTARALCLQGVR
GLMU_XANC8      GEFYLTDVFASAAADYTPADMVQVSDPQDVEGANDPWQLAQLERAWQLRAARALCLQGVR
GLMU_XANCP      GEFYLTDVFASAAADYTPADMVQVSDPQDVEGANDPWQLAQLERAWQLRAARALCLQGVR
GLMU_XYLFA      GEYYLTDIFASATADLTPANMIMVTDAREVEGVNDLWQLTQLERAWQIRAARALCLQGAR
GLMU_XYLFT      GEYYLTDIFASATADLTPANMIMVTDAQEVEGVNDLWQLTQLERAWQIRAARALCLQGAR
GLMU_ACIAD      GEYYLTDIVAMAVADGLEIASIQPDLAFEVEGVNDRLQLAALEREFQLQQAKSLMQQGVT
GLMU_PSYA2      QEYYLTDIVKMAVADGITIAAIEPEHTFEIEGVNNRQQLASLERTWQGKLVADLQEAGVQ
GLMU_FRATT      KEYYLTDIITFAKADHVSINVTHPINEFEILGVNDRTQLASLERVWQRNVAEKIMAKGVS
GLMU_BUCAI      QEFYATDIIALAHLEGSFIKTIEPLNYEEILGINNKLQLSNLEKIFQKKQINKLLINGVT
GLMU_BUCAP      KEFYATDIVHFANLENSTIKTVQVLNCKEILGVNNKLQLSILEKIFRKKQVNDLLLSGVT
GLMU_BUCBP      NEYYITDIISLANKDNHKINSVRPEKNDEIQGINNLLQLVRAEKIYQKQQAKLLLLSGIM
GLMU_WIGBR      KEIYLTDIISIAYKSGNIINSVQPEKVFEIFGINNRFQLMKLEKIYQIEQAKKLLLNGVT
GLMU_BLOFL      NELYLTAIIDIAYKNNFVINAIHPVDVCEVIGINNKSDLVKAERVYQIKEAQKLLELGVM
GLMU_BLOPB      NEFYLTDIIQIAHQSGYSIHTMCPDDTFEIMGVNSKSDFVDLDKQYQQRKVQCLLSSGLM
GLMU_CAMJE      KEYYLTDIVKLAKEKDVMIKAVFVDED-EFMGINDKFELSIAENFMQKKIKKYWMQQGVI
GLMU_CAMJR      KEYYLTDIVKLAKEKDVMIKAVFVDED-EFMGINDKFELSIAENFMQEKIKKYWMQQGVI
GLMU_HELHP      QEFYLTDVVFYAKENGIEIAALEVKEE-EFMGVNSKIQLACAQEIMLQRLREKAMEQGVI
GLMU_WOLSU      KEFYLTDVVEMARKDRLIVAPLFVKEE-NFKGVNSKADLAEAEAIMTGRIRRRWMREGVR
GLMU_HELPJ      KEYYLTDLIALGIKGNEKIDAIFLEEE-CFLGVNSQTERAKAEEIMLERLRKNAMDLGVV
GLMU_HELPY      KEYYLTDLIALGINENETIDAIFLKEE-CFLGVNSQTERAKAEEIMLERLRKNAMDLGVV
GLMU_GEOSL      GEYYLTDIITMANDRGLRCTAHPVADPVEVMGINDRVQLAEAARHARRRIAEEHMLNGVT
GLMU_PELCD      REYYLTDVLAAARAAGRRVGAVVLEDADEAMGINDRVQLAQASALMRRRINENLMRAGVS
GLMU_BACSU      GEYYLPDVIEILKNEGETVAAYQTGNFQETLGVNDRVALSQAEQFMKERINKRHMQNGVT
GLMU_BACLD      GEYYLPDVIEILKNQGETVAAYQTVNFQETLGVNDRVALSQAEIYMKQRINKRHMQNGVS
GLMU_BACAN      GEYYLPDVIEILKNEGHIVSAYQTEHFDETLGVNDRVALSQAEIIMKNRINRKNMVNGVT
GLMU_BACC1      GEYYLPDVIEILKNEGHIVSAYQTEHFDETLGVNDRVALSQAEIIMKNRINRKNMVNGVT
GLMU_BACHK      GEYYLPDVIEILKNEGHIVSAYQTEHFDETLGVNDRVALSQAEIIMKNRINRKNMVNGVT
GLMU_BACCZ      GEYYLPDVIEILKNEGHIVSAYQTEHFDETLGVNDRVALSQAEIIMKNRINRKNMVNGVT
GLMU_BACCR      GEYYLPDVIEILKNEGHIVSAYQTEQFDETLGVNDRVALSQAEIIMKNRINRKNMVNGVT
GLMU_GEOKA      GEYYLTDVIEIIKADGGVVSAYQAPSFEETIGVNDRIALAEAERIMRARICRQHMKNGVT
GLMU_ALKHC      GEYYLPDVIQILQTKGEKVAAYKTAHVEETLGVNDRVALAQAEQVMKRRINEAWMRKGVT
GLMU_OCEIH      GEYYLPDVIKILRHQGDTVSAFMTPDFDETIGINDRIALAEAEKIMKKRINEQHMRNGVS
GLMU_LISMF      GEYYLPDVIKILKDSDEVVAAYRMESFEESLGVNDRIALAEASRLMQRRINENHMRNGVT
GLMU_LISMO      GEYYLPDVIKILKDSDEVVAAYRMESFEESLGVNDRIALAEASKLMQRRINENHMRNGVT
GLMU_LISIN      GEYYLPDVIKILKDADEVVAAYKMESFEESLGVNDRIALAEASKLMQRRINENHMRNGVT
GLMU_BACSK      GEYYLPDVIGILRQKGETISAYQTDSLSETMGVNDRVALSQAEAAMRKRINEEWMRQGVT
GLMU_LACPL      GEYYLTDVIQIMKNQGDVVAAYQMDDFDESMGVNTRAALAQATKVMQQRINAQHMENGVS
GLMU_LACSS      GEYYLTDVVEILKKKGEIVAAYKMPNFEESMGVNDRVALSQATKVMRQRINTAHMRNGVT
GLMU_ENTFA      GEYYLTDIIEILKKEGKAVAAYQMADFDEAMGVNDRVALSTANKIMHRRLNEMHMRNGVT
GLMU_LACAC      GEYYLTDVLEILRNSGENVGAYKMPDFSESLGVNDRIALAQATKIMQRRINEEHMRNGVS
GLMU_LACJO      GEYYLTDVLEIMRKAGHKVGAYEMPDFSESLGVNDRIALAQATKIMQRRINEEHMRNGVS
GLMU_STAAC      GEYYLPDVLSLILNDGGIVEVYRTNDVEEIMGVNDRVMLSQAEKAMQRRTNHYHMLNGVT
GLMU_STAAS      GEYYLPDVLSLILNDGGIVEVYRTNDVEEIMGVNDRVMLSQAEKAMQRRTNHYHMLNGVT
GLMU_STAAW      GEYYLPDVLSLILNDGGIVEVYRTNDVEEIMGVNDRVMLSQAEKAMQRRTNHYHMLNGVT
GLMU_STAAR      GEYYLPDVLSLILNDGGIVEVYRTNDVEEIMGVNDRVMLSQAENAMQRRTNHYHMLNGVT
GLMU_STAAM      GEYYLPDVLSLILNDGGIVEVYRTNDVEEIMGVNDRVMLSQAEKAMQRRTNHYHMLNGVT
GLMU_STAAN      GEYYLPDVLSLILNDGGIVEVYRTNDVEEIMGVNDRVMLSQAEKAMQRRTNHYHMLNGVT
GLMU_STAEQ      GEYYLPDVLSLILKDGGKAEVYCTEDFDEIIGVNDRLMLSEAEKALQQRINRYHMENGVT
GLMU_STAES      GEYYLPDVLSLILKDGGKAEVYCTEDFDEIIGVNDRLMLSEAEKALQQRINRYHMENGVT
GLMU_STAEP      GEYYLPDVLSLILKDGGKAEVYCTEDFDEIIGVNDRLMLSEAEKALQQRINRYHMENGVT
GLMU_STAHJ      GEYYLPDVISLILAENGVAEVYHTDDFNEIMGVNDRVMLSNAEKALQQRINIEHMRNGVT
GLMU_STAS1      SEYYLPDVLSLILEDRGIVEVFHTNDFEEIMGVNDRVMLSEAEKAFRKRINEQHMKNGVT
GLMU_STRA1      GEYYLTDVIGIFKEAGKKVGAYKLRDFDESLGVNDRVALATAEKVMRHRIARQHMVNGVT
GLMU_STRA5      GEYYLTDVIGIFKEAGKKVGAYKLRDFDESLGVNDRVALATAEKVMRHRIARQHMVNGVT
GLMU_STRA3      GEYYLTDVIGIFKEAGKKVGAYKLRDFDESLGVNDRVALATAEKVMRHRIARQHMVNGVT
GLMU_STRT1      GEYYLTDVISIFRENGEKVGAYTLRDFEESLGVNDRVALATAEDVMRRRINKAHMINGVT
GLMU_STRT2      GEYYLTDVISIFRENGEKVGAYILRDFEESLGVNDRVALATAEDVMRRRINKTHMINGVT
GLMU_STRPN      GEYYITDVIGIFRETGEKVGAYTLKDFDESLGVNDRVALATAESVMRRRINHKHMVNGVS
GLMU_STRR6      GEYYITDVIGIFRETGEKVGAYTLKDFDESLGVNDRVALATAESVMRRRINHKHMVNGVS
GLMU_STRMU      GEYYLTDVISIFKEADEKVGAYKLADFDESLGVNDRVALAKAEKVMRRRINHAHMVNGVT
GLMU_STRP1      GEYYLTDVVAIFRANKEKVGAYILRDFNESLGVNDRVALAIAETVMRQRITQKHMVNGVT
GLMU_STRPM      GEYYLTDVVTIFRANKEKVGAYILRDFNESLGVNDRVALATAETVMRQRITQKHMVNGVT
GLMU_STRP6      GEYYLTDVVAIFRANKEKVGAYILRDFNESLGVNDRVALATAETVMRQRITQKHMVNGVT
GLMU_STRP3      GEYYLTDVVAIFRANKEKVGAYILRDFNESLGVNDRVALATAETVMRQRITQKHMVNGVT
GLMU_STRP8      GEYYLTDVVAIFRANKEKVGAYILRDFNESLGVNDRVALATAETVMRQRITQKHMVNGVT
GLMU_STREC      GEYYLTDVISIFKASQEKVGAYLLKDFDESLGVNDRLALAQAEVIMQERINKQHMLNGVT
GLMU_LACLA      GEYYLTDVIEIFKKAGQTVAAHILDDFDESLGVNDRVALSQAELTMRKRINHQHMVNGVT
GLMU_CLOPE      GEYYLTDVIEILKKENKKVGAMITDFE-ETLGVNSRAELAKVESIMRNRINRTHLDNGVT
GLMU_CLOTE      GEYYLTDVIEILKKDGKKVGALAVNFE-ETMGVNSRLQLAEVEAIMRKRINAMHLENGVT
GLMU_CLOAB      GEYYLTDVIGILEEEGAKIGAISVPFE-EILGVNSRLQLCQVGKVMQKRINEKHMENGST
GLMU_CALS4      GEYYLTDAVEIIRNMGGKIGAVVGESE-EIIGVNSRVQLSNAEKVMRRRINEKHMENGVT
GLMU_CARHZ      KEYYLTDVIPLLLERGKVVETITIQDETEVYGVNDRVQLARLTKGVYRRKAEALMQEGVT
GLMU_SYMTH      GEYYLPQVWEILLQRGEKVQALLLASEEDALAPNDRVELARAEARLRRQINERHMRNGVT
GLMU_NOSS1      KEYYLTDAVTQV----GQVMAVDVEDYQEILGINDRLQLATAYEILQRRVKEQWMMAGVT
GLMU_THEEB      QEYYLTDAVNAL----SPVMAVDVEDYEEILGVNDRVQLAAAYQVLQNRIKKAWMQAGVT
GLMU_SYNP6      QEYYLTEAITYL----DPVSAVEVADSQEILGINDRLQLADSFRILQERIRQQWMLAGVT
GLMU_SYNY3      KEYYLTEVVDYL----DQVMAVDVDDYLEINGINDRKQLAAANDILQNRIKDDWMAQGIT
GLMU_GLOVI      GELYLPDALPML----THVRAVAVEDPQEIFGINDRLQLSQASRILNERTLVGLMLSGVT
GLMU_PROMA      NELYLTDTIQKL----PLAVHLEIEDAGEVSGINDKRQLAKCEQLLQERLQDFWMEQGVT
GLMU_PROMT      NEIYLTDTISLL----KKALHFEVDNPFEIKGINDRVQLSECEHYIQEELKSLWMSKGVS
GLMU_PROMM      GELYLTDTVALL----PIAMHVEVADPDEVNGINDRCQLANCEALLQERLRNYWMKEGVT
GLMU_SYNPX      GELYLTDTVAML----PKAMHVEVADPDEVNGINNRKQLAQCEAVLQQRLRDHWMAEGVT
GLMU_PROMP      KEIYLTDTISLL----KNSYSFEVEDNGELQGINNRVQLSECEETIQTLIKRKHMLGGVT
GLMU_COREF      GELYLTDVLGIARSEGHPVRAHIAADARELAGVNDRVQLAEAGAELNRRTVEAAMRGGAT
GLMU_CORGL      GELYLTDVLGIARGEGHPVRAHTAADARELAGVNDRVQLAEAGAELNRRTVIAAMRGGAT
GLMU_CORDI      GELYLTDVLSIARTEGHPVRAYRAHDHRELAGVNDRVQLAQAGKILNQRLVEDAMRNGAT
GLMU_CORJK      GELYLTDVLSIARRAGHPVRAHIASDAAELAGVNDRVQLAAAGAELNRRTVTAAMRGGAT
GLMU_MYCBO      QELYLTDVIAILRSDGQTVHASHVDDSALVAGVNNRVQLAQLASELNRRVVAAHQLAGVT
GLMU_MYCTU      QELYLTDVIAILRSDGQTVHASHVDDSALVAGVNNRVQLAELASELNRRVVAAHQLAGVT
GLMU_MYCPA      QELYLTDVIAILRGDGLPIRARHVDDSALVAGVNNRVQLAQLGAELNRRIVAAHQLAGVT
GLMU_MYCLE      QELYLTDVISILRREGQKVNAQHIDDNALVAGVNNRVQLAELSAELNRRIVATHQVAGVT
GLMU_NOCFA      HELYLTDVLRLAREAGHPVHGARLLDAAKVTGVNDRVQLSIATRTMNRYILERHMRAGVT
GLMU_STRAW      GEEYLTDVLGILREAGHRVGASVAADHREIAGINNRVQLAEARRILNDRLLTRAMLAGVT
GLMU_STRCO      GEEYLTDVLGILREAGHRVGASVAGDHREIAGINNRVQLAEARRILNDRLLTGAMLAGVT
GLMU_THEFY      GEEYITDAVALLRGDGHRVGAYIAPDRTEVEGVNDRVQLAEARRLLNARLLEQLMRDGVT
GLMU_LEIXX      GEKYITDVIGLLRESGFDVDALPVSDSWLVDGINDRAQLSEAAAKLNALTVRAWQLAGVT
GLMU_BIFLO      GEFYLTDALETAKAAG-KVGAFAAPDPLTVEGVNDRVQLAALSKTYNRRVCERWMRDGVT
GLMU_BDEBA      KEYYITDLIALCIQD-KCRVQAIQSTPKVAVGVNNQLELARATRLLFKRKALRLMEDGVL
GLMU_FUSNN      GEYYITDVIEILSND-KKVISYSLEDSMEIQGVNSKVELALVSKVLRERKNTALMEDGVI
GLMU_THEMA      GEYYLTDAVNFA----EKVRVVRTDDLLEITGVNTRKTLVWLEEQLRMRKIEELLENGVT
GLMU_THET2      REYYLPDLVAIYRAHGRRVLAVRGV-AEEALGVNTREELARVEGVLLRRLRAEWMGKGVR
GLMU_THET8      REYYLPDLIAIYRAHGRRVLAVRGV-AEEALGVNTREELARVEGVLLRRLRAEWMGKGVR
GLMU_DEIRA      GEYYLTDLLGLYRAGGATVRAFRLSDPDEVLGANDRAGLTQLEATLQRRINEGHLKAGVS
GLMU_AQUAE      GELYLTDVIEYMVNKGYEVRSFMAKEPTEALGVNTRWDLALVENVIKLKIARYWAERGVT
GLMU_DESAG      GEYYITDIVELAVRQGLRVEGVECGNDPDLLGVNTPAELMRSEELLRENIVTRHLHNGVH
GLMU_DESVH      GEYYITDLVGLAVAERMNVLGIQCGEDPNLLGVNNPAELIRSEALLRTRLVIGHIEGGVL
GLMU_AGRFC      GEYYLTDVVEIARSLGRRAIAIDAPEK-ELTGCNNRAELAFIERLWQERRRHELMVDGVS
GLMU_RHIME      GEYYLTDLVEIARSLDGRAIAVEAPEE-ELTGCNTRAELAYIERLWQQRRRHELMLAGVS
GLMU_BRUAB      GEYYLTDIVAIAHGKGLNVTAIEVPVD-NVIGINNRAELAEAETIWQNRKRRELMLSGVT
GLMU_BRUME      GEYYLTDIVAIAHGKGLNVTAIEVPVD-NVIGINNRAELAEAETIWQNRKRRELMLSGVT
GLMU_BRUSU      GEYYLTDIVAIAHGKGLNVTAIEVPVD-NVIGINNRAELAEAETIWQNRKRRELMLSGVT
GLMU_RHILO      GEYYLTDIVEIAGAQGLDVVATEASFE-NALGINNRAELAQAEGIWQARRRQEAMLSGVT
GLMU_BARHE      REYYLTDIVSIASQEGLDVRVVEVPFD-NIIGVNNCFELFEADSLWQKRKARDLMLSGVT
GLMU_BARQU      QEYYLTDIVSIASREGLEVQVVEVPFD-NIVGINNCFELFEADSLWQKRKARDLMLSGVT
GLMU_BRADU      GEYYLTDAVEIVREQGWESVVIETSED-EVRGINTKAQLAEAESVMQARLRKAAMEAGVT
GLMU_NITWN      GEYYLTDAVGLVAELGLTAAVIETGED-EVRGINTKAQLAEAEQVMQARLRKAALDAGVT
GLMU_RHOPA      GEYYLTDAVGIVRDLGLTASVIETSED-EVRGINTKAQLAEAETVMQTRLRLAAMAAGVT
GLMU_CAUVC      GEYYLTDVVGLAHERHLSTRTAFAPEA-SVQGVNAQAELAAAEAVWQQNRRKALMVDGVT
GLMU_CERS4      GEYYLTDVVALARVRGLSAGVAICDEA-ETLGVNTRAQLAEAEAEFQKRARAAALEDGVT
GLMU_RUEPO      GEYYLTDVVEIARKQGLAVTAVACDEA-QTLGVNSRADLAAADAIFQTRARAELLDLGVT
GLMU_GLUOX      GEYYLTDVVEMAAKAG-PVVCVEAPEA-ELAGVNSRSELARAEATLQTRLRNAAMDAGVT
GLMU_ZYMMO      GEYYLPDIVMLALSEGRQAVTVDAEAW-EVSGVNNRAELASLESLWQNRKRQDVMKDGAS
GLMU_WOLPM      HEYYLTDIVSIAVKSNLNVGYVITGGE-EATGINNRNDLIKAEFYFQENKRKIFTDSGVT
GLMU_WOLTR      YEYYLTDIVSIAVKSNLNVGYVTTDEE-EATGINSRNDLAKAEFYFQENRRKFFTDSGVT
GLMU_ANAMM      -ELYLTDIVQSAAEKNVEVGYVIADER-KAMGINTRADLAIAESYFQCMKRASFLQSGVT
                 * * .                         . *                       *  

GLMU_ECOLI      LRDPARFDLRGT-LTHGRDVEIDTNVIIEGNVTLGHRVKIGTGCVIK-------------
GLMU_ECO57      LRDPARFDLRGT-LTHGRDVEIDTNVIIEGNVTLGHRVKIGTGCVIK-------------
GLMU_SHIFL      LRDPARFDLRGT-LTHGRDVEIDTNVIIEGNVTLGHRVKIGTGCVIK-------------
GLMU_SHIDS      LRDPARFDLRGT-LTHGRDVEIDTNVIIEGNVTLGHRVKIGTGCVIK-------------
GLMU_SHISS      LRDPARFDLRGT-LTHGRDVEIDTNVIIEGNVTLGHRVKIGTGCVIK-------------
GLMU_SHIBS      LRDPARFDLRGT-LTHGRDVEIDTNVIIEGNVTLGHRVKIGTGCVIK-------------
GLMU_ECOL6      LRDPARFDLRGT-LTHGRDVEIDTNVIIEGNVTLGHRVKIGAGCVIK-------------
GLMU_SALPA      LRDPARFDLRGT-LHCGMDVEIDANVIIEGYVTLGHRVKIGAGCIIK-------------
GLMU_SALTY      LRDPARFDLRGT-LHCGMDVEIDANVIIEGYVTLGHRVKIGAGCIIK-------------
GLMU_SALCH      LRDPARFDLRGT-LHCGMDVEIDANVIIEGYVTLGHRVKIGAGCIIK-------------
GLMU_SALTI      LRDPARFDLRGT-LYCGMDVEIDANVIIEGYVTLGHRVKIGAGCIIK-------------
GLMU_YERPE      LLDPSRFDLRGE-LTHGRDITIDTNVIIEGHVILGDRVRIGTGCVLK-------------
GLMU_YERPS      LLDPSRFDLRGE-LTHGRDITIDTNVIIEGHVILGDRVRIGTGCVLK-------------
GLMU_PECAS      LLDPARFDLRGE-LTHGRDVVMDVNVVVEGNVKLGNRVKIGAGCVIK-------------
GLMU_PHOLL      LLDPARFDLRGT-LIHGRDVVIDTNVIIEGNVTLGNNVQIGTGCVLK-------------
GLMU_HAEIN      IYDPARFDLRGT-LEHGKDVEIDVNVIIEGNVKLGDRVKIGTGCVLK-------------
GLMU_HAEI8      IYDPARFDLRGT-LEHGKDVEIDVNVIIEGNVKLGDCVKIGAGCVLK-------------
GLMU_MANSM      LIDPARFDLRGT-LEHGKDCEIDVNVIIEGSVKLGDRVKIGAGCVIK-------------
GLMU_PASMU      LADPERFDLRGE-LSHGKDVEIDVNVIIEGKVSLGHRVKIGAGCVLK-------------
GLMU_HAEDU      LMDPHRFDLRGS-LQYGKDIQIDVNVILEGEVKLGNRVRIGAGCILK-------------
GLMU_VIBVU      LRDPARFDLRGE-LQCGLDVEIDVNVIIEGNVSLGDNVVIGAGCVLK-------------
GLMU_VIBVY      LRDPARFDLRGE-LQCGLDVEIDVNVIIEGNVSLGDNVVIGAGCVLK-------------
GLMU_VIBPA      LRDPARFDLRGE-LQCGMDCEIDANVIIEGNVSLGDNVIIGTGCVLK-------------
GLMU_VIBCH      LRDPARFDLRGT-LQCGSDVEIDVNVIIEGNVSIGNNVVIGAGSILK-------------
GLMU_ALIF1      LRDPSRFDLRGT-LQCGMDIEIDANVIIEGNVTLGDNVIIGAGCVLK-------------
GLMU_PHOPR      LRDPSRFDLRGK-LQCGTDVEIDVNVIIEGNVSIGNNVLIGTGCVLK-------------
GLMU_COLP3      LRDPARIDVRGN-LTTGTEVSIDINCIFEGEVSLADNVQIGANCIIK-------------
GLMU_PSET1      LADPARIDVRGT-VTTGEDVLIDINVIFEGKVTIGHNVEIGPNCVLK-------------
GLMU_SHEON      LRDPSRIDIRGE-VTVGMDVMIDVNVIFEGKVVIGNNVTIGAGAIII-------------
GLMU_IDILO      LIDPARFDCRGK-LSAGSDVTIDINAVFEGNVVLGDRVVIEPNCVIR-------------
GLMU_PSESM      LRDPSRFDVRGE-VSVGRDVLIDINVILEGKVIIEDDVVIGPNCVIK-------------
GLMU_PSEU2      LRDPARFDVRGE-VIVGRDVLIDINVILEGKVVIEDDVVIGPNCVIK-------------
GLMU_PSE14      LRDPARFDVRGE-VSVGRDVLIDINVILEGKVVIEDNVVIGPNCVIK-------------
GLMU_PSEPK      LRDPARFDVRGE-VSVGRDVLIDINVILEGKVVIEDDVQIGPNCVIK-------------
GLMU_PSEF5      LRDPARFDVRGE-VIVGRDVLIDINVILEGRVVIEDDVIIGPNCVIK-------------
GLMU_PSEPF      LRDPARFDVRGE-VTVGRDVLIDINVILEGKVVIEDDVVIGPNCVIK-------------
GLMU_PSEAE      LLDPQRLDVRGE-ISVGRDVLIDVNVVLEGRVVIEDDVRIGPNCVIR-------------
GLMU_NEIGO      LRDPARFDLRGR-LKHGQDVVIDVNVVIEGEVELGDNVEIGANCVIK-------------
GLMU_NEIG1      LRDPARFDLRGR-LKHGQDVVIDVNVVIEGEVELGDNVEIGANCVIK-------------
GLMU_NEIMA      LRDPARFDLRGR-LKHGQDVVIDVNCIFEGKIELGDNVEIGANCVIK-------------
GLMU_NEIMB      LRDPARFDLRGR-LKHGQDVVIDVNCIFEGDIELGDNVEIGANCVIK-------------
GLMU_CHRVO      LADPARIDIRGE-LKHGMDVSIDIGCVFEGAVELGDQVEIGAHCVLK-------------
GLMU_AROAE      LFDPSRIDVRGE-LLCGRDVEIDVNCVFEGRVEIADDVRIGANCVIR-------------
GLMU_DECAR      LADPARIDIRGE-LTHGRDVAIDVGCVFEGKVELADAVEVGPYCVLK-------------
GLMU_BURMA      LADPARIDVRGT-LACGRDVSIDVNCVFEGDVTLADGVTIGANCVIR-------------
GLMU_BURP1      LADPARIDVRGT-LACGRDVSIDVNCVFEGDVTLADGVTIGANCVIR-------------
GLMU_BURPS      LADPARIDVRGT-LACGRDVSIDVNCVFEGDVTLADGVTIGANCVIR-------------
GLMU_BURL3      LADPARLDVRGT-LRCGRDVSIDVNCVFEGNVTLADNVTIGANCVIR-------------
GLMU_CUPPJ      LADPARIDVRGE-LTCGRDVSIDIGCVFEGRVHLGDGVQIGANCVIR-------------
GLMU_RALSO      LIDPARIDIRGR-LTCGRDVVIDIDCIFEGNVTLGDGVRIGAHAVIR-------------
GLMU_THIDA      LMDPARLDVRGS-LVCGRDVTIDVNCVFEGRVELGDGVQIGANCVLR-------------
GLMU_BORBR      LADPARFDVRGT-LSCGRDVFIDVGCVFEGTVTLGDGVRVGPHCVLR-------------
GLMU_BORPA      LADPARFDVRGT-LSCGRDVFIDVGCVFEGTVTLGDGVRVGPHCVLR-------------
GLMU_BORPE      LADPARFDVRGT-LSCGRDVFIDVGCVFEGTVTLGDGVRVGPHCVLR-------------
GLMU_NITEU      FADPARFDVRGR-LVCGNDVEIDINCIFEGNVRLGNNVKIHANCILR-------------
GLMU_LEGPA      LADANRFDLRGE-LYCGKDVYIDINCIFTGKVVLGNGCKIGPNCSLT-------------
GLMU_LEGPH      LADANRFDLRGE-LYCGKDVYIDINCIFTGKVVLGNGCKIGPNCSLT-------------
GLMU_LEGPL      LADANRFDLRGE-LYCGKDVYIDINCIFTGKVVLGNGCKIGPNCSLT-------------
GLMU_COXBU      IIDPERFDARGENIEIAPDVVIDVNVILEGNVQLDRNVRIGPNVILK-------------
GLMU_METCA      LRDPARFDLRGEIVELGRDVEIDVNVILEGRIALGDEVRIGPNVYLK-------------
GLMU_NITOC      LSDPDRFDLRGELL-VGKDVYIDINVILEGRVILGDGVKIGPHCYLR-------------
GLMU_XANAC      MADPARVEQRGS-VQVGRDVQLDIDVILEGNVTLGDDVVIGPFVRLR-------------
GLMU_XANC5      MADPARVEQRGS-VQVGRDVQLDIDVILEGNVTLGDDVVIGPFVRLR-------------
GLMU_XANOR      MADPARVEQRGS-VQVGRDVQLDIDVILEGEVTLGDDVVIGPFVRLR-------------
GLMU_XANC8      MADPARVEQRGR-VQVGHDVQLDIDVILEGEVTLGDGVVIGPFVRLR-------------
GLMU_XANCP      MADPARVEQRGR-VQVGHDVQLDIDVILEGEVTLGDGVVIGPFVRLR-------------
GLMU_XYLFA      VADPARLDQRGT-IRIGQNVHIDIDVVLEGEIELGDNVVIGPFVRLK-------------
GLMU_XYLFT      VADPARLDQRGT-IRIGQNVHIDIDVVLEGEIELGDNVVIGPFVRLK-------------
GLMU_ACIAD      LTDPSRFDLRGT-LKIGQDVRIDINVIIEGNCELGDFVEIGAGCVLK-------------
GLMU_PSYA2      FADPTRVDIRGT-LSVGQDVFVDVGVVFEGDCTLGDNVYIEAGCVIK-------------
GLMU_FRATT      IADPNRFDVRGN-LDVGKDCWIDINVIIKGNVKLGNNVVIGANCILK-------------
GLMU_BUCAI      IKDPSHFIFRGT-LQHGQNVEIDTGVILENNVILGDDVKIGPGCIIR-------------
GLMU_BUCAP      LKDPNHFILRGI-LKHGKNIEIDTGVILEGNIILGNNIKIGVGSVIK-------------
GLMU_BUCBP      IYNPSNFSLRGT-LKHGKNIKIDHGVILEGSVKIGNSVIIEPGCIIK-------------
GLMU_WIGBR      LSDYNRFDLRGT-LKHGKDIFIDINVVLKGSVIIGDRVKIGNGCVLK-------------
GLMU_BLOFL      ISDLNRFDLRGK-LVCGEDVCIDVNVIIEGCVSLGNRVKIGASCILK-------------
GLMU_BLOPB      IIDPNRFDLRGT-LVHGKDVYIDINVIIEGHVSLGNRVKIGASCILK-------------
GLMU_CAMJE      FHLP-------------QSTFIGADVEFVGECEVYENVRIEGKSKII-------------
GLMU_CAMJR      FHLP-------------QSTFIGADVEFVGECEVYENVRIEGKSKII-------------
GLMU_HELHP      MNLP-------------HTIYLESNVTFSGECIIEQGVQILGDSHIS-------------
GLMU_WOLSU      MRLP-------------ETIYIDEGVKFVGECFIENGVSITGDSYIE-------------
GLMU_HELPJ      MQLP-------------SSIYLEKGVSFKGECVLEQGVRLIGNCLIE-------------
GLMU_HELPY      MQLP-------------NSIYLEKGVSFKGECVLEQGVRLIGNCLIE-------------
GLMU_GEOSL      LVDPAATYIDQG-VVIGADTTIQPGVQIAGGCRVGEGCTIEAGAIIKGSELGDRCVVESR
GLMU_PELCD      FIDPEQTYIEPQ-VEIGPDSVIYPGVCLGGDTRIGSGCLIEAQVTI--------------
GLMU_BACSU      LIDPMNTYISPD-AVIGSDTVIYPGTVIKGEVQIGEDTIIGPHTEIM-------------
GLMU_BACLD      LIDPDNTYISPE-AVIGRDTVIYPGTVIKGRVVIGEDAVIGQNSELE-------------
GLMU_BACAN      IIDPSNTYISAD-AIIGSDTVLHPGTIIEGNTVIGSDCEIGPHTVIR-------------
GLMU_BACC1      IIDPSNTYISAD-AIIGSDTVLHPGTIIEGNTVIGSDCEIGPHTVIR-------------
GLMU_BACHK      IIDPSNTYISAD-AIIGSDTVLHPGTIIEGNTVIGSDCEIGPHTVIR-------------
GLMU_BACCZ      IIDPSNTYISAD-AIIGSDTVLHPGTIIEGNTVIGSDCEIGPHTVIR-------------
GLMU_BACCR      IIDPSNTYISAD-AVIGSDTVLHPGTIIEGNTVIGSDCEIGPHTVIR-------------
GLMU_GEOKA      IIDPASTYISAE-AVIGRDTVIYPGTVIEGETVIGEDCVIGPNSEIK-------------
GLMU_ALKHC      FIDPEQTYVSPD-ATIGQDTVIYPGTMVLGQTTIGEGCVLGPHTELK-------------
GLMU_OCEIH      IIDPEQTYIEPD-VQIESDVILHPGTVLKGETIIRTGAEIGPHSELK-------------
GLMU_LISMF      LVNPENTYIDID-VKIGQDTVIEPGVMLRGETVIGDDCVVTSGSEIV-------------
GLMU_LISMO      LVNPESTYIDID-VKIGQDTVIEPGVMLRGKTVIGDDCVVTSGSEIV-------------
GLMU_LISIN      LVNPENTYIDID-VKIGQDTVIEPGVMLRGKTVIGDDCVVTSGSEIV-------------
GLMU_BACSK      IIDPQTTYISAD-ASIGQDTVLYPNTSIKGPSVIGEDCVIESGTEIA-------------
GLMU_LACPL      IINPDDTYIDAG-VKIGADTIIEPGVLIKGHTTIGEDCFIGAHSEIH-------------
GLMU_LACSS      LIDPESTYIEVG-VKIGNDTIIEPNVVLKGNTTIGSDCFVGAGSTII-------------
GLMU_ENTFA      FIDPDTTYIDEG-VVIGSDTVIEAGVTIKGKTVIGEDCLIGAHSEIV-------------
GLMU_LACAC      FIDPDTAYIDAD-VKIGNDTVIEGNVVIKGNTEIGSECYITSGSRII-------------
GLMU_LACJO      FIDPDTAYIDSD-VKIGNDTVIEGNVVIKGKTEIGSNCYITNSSRII-------------
GLMU_STAAC      IIDPDSTYIGPD-VTIGSDTVIEPGVRINGRTEIGEDVVIGQYSEIN-------------
GLMU_STAAS      IIDPDSTYIGPD-VTIGSDTVIEPGVRINGRTEIGEDVVIGQYSEIN-------------
GLMU_STAAW      IIDPDSTYIGPD-VTIGSDTVIEPGVRINGRTEIGEDVVIGQYSEIN-------------
GLMU_STAAR      IIDPDSTYIGPD-VTIGSDTVIEPGVRINGRTEIGEDVVIGQYSEIN-------------
GLMU_STAAM      IIDPDSTFIGPD-VTIGSDTVIEPGVRINGRTEIGEDVVIGQYSEIN-------------
GLMU_STAAN      IIDPDSTFIGPD-VTIGSDTVIEPGVRINGRTEIGEDVVIGQYSEIN-------------
GLMU_STAEQ      IIDPSSTFIGTD-VKIGIDTTIEPGVRIGGHTTIEEDVWIGQYSEIN-------------
GLMU_STAES      IIDPSSTFIGTD-VKIGIDTTIEPGVRIGGHTTIEEDVWIGQYSEIN-------------
GLMU_STAEP      IIDPSSTFIGTD-VKIGIDTTIEPGVRIGGHTTIEEDVWIGQYSEIN-------------
GLMU_STAHJ      IIDPTTTFIGPD-VKIGMDTIIEPGVRINGETVIGEEAVIGQYSEIN-------------
GLMU_STAS1      IIDPVTTYIGAD-VRIGEDTVVEPGVKLSGNSVIGEDTVIGQHTEIT-------------
GLMU_STRA1      VVNPDSAYIDID-VEIGEESVIEPNVTLKGQTKIGKGTLLTNGSYLV-------------
GLMU_STRA5      VVNPDSAYIDID-VEIGEESVIEPNVTLKGQTKIGKGTLLTNGSYLV-------------
GLMU_STRA3      VVNPDSAYIDID-VEIGEESVIEPNVTLKGQTKIGKGTLLTNGSYLV-------------
GLMU_STRT1      FQNPNATYIDVD-VEIAPDVVIEANVTLKGQTKVGAESVLTNGTYIV-------------
GLMU_STRT2      FQNPNATYIDVD-VEIAPDVVIEANVTLKGQTKVGAESVLTNGTYIV-------------
GLMU_STRPN      FVNPEATYIDID-VEIASEVQIEANVTLKGQTKIGAETVLTNGTYVV-------------
GLMU_STRR6      FVNPEATYIDID-VEIAPEVQIEANVILKGQTKIGAETVLTNGTYVV-------------
GLMU_STRMU      LTNPASTYIDSD-VIIAPDVVIEANVTLKGQTKIETGAVLTNGTYIV-------------
GLMU_STRP1      FQNPETVYIESD-VEIAPDVLIEGNVTLKGRTHIGSGTVLTNGTYIV-------------
GLMU_STRPM      FQNPETVYIESD-VEIAPDVLIEGNVTLKGRTHIGSGTVLTNGTYIV-------------
GLMU_STRP6      FQNPETVYIESD-VTIAPDVLIEGNVTLKGRTHIGSGTVLTNGTYIV-------------
GLMU_STRP3      FHNPETVYIESD-VTIAPDVLIEGNVTLKGRTHIGSGTVLTNGTYIV-------------
GLMU_STRP8      FQNPETVYIESD-VEIAPDVLIEGNVTLKGRTHIGSGTVLTNGTYIV-------------
GLMU_STREC      LQNPAATYIESS-VEIAPDVLIEANVTLKGQTRIGSRSVITNGSYIL-------------
GLMU_LACLA      LIDPATTYIDSE-VTIGEETVIEANVTIKGNTFIGKNVLITNGSRIE-------------
GLMU_CLOPE      IIDPLNTYIEPE-VVIGKDTIIYPGNVIEGKTVIGEDCILYPNSRIN-------------
GLMU_CLOTE      IIDPNNTYIDCN-VVIHNDSIIYPGNILQGKTVIKENCVLYPNSRIV-------------
GLMU_CLOAB      LIDPDNTYIGAD-VEIESDTIIYPGNVLQGKTVIKTGCVLYPNSRIE-------------
GLMU_CALS4      IIDPDSTYIDAE-VEIGRDTVILPGTILQGKTKIGEDCEIGPNSRIV-------------
GLMU_CARHZ      IIDPETVYIGEE-VVVGSDTVIYPNTYLEGKTVIGSGCRLGPNTRIT-------------
GLMU_SYMTH      IINPDATYIDED-VEIGRDTVIWPFTFIHGKTVIGPHCKIGPMTTIV-------------
GLMU_NOSS1      LIDPNSITIDDT-VELQPDVIIEPQTHLRGSTVIQSGSRIGPGSLIE-------------
GLMU_THEEB      LIDPASITIEDT-VELAPDVVIEPQTHLRGQTRIGSGSIIGPGTLIE-------------
GLMU_SYNP6      LVDPTSITIDET-VQLGTDVVIEPQTHLRGNTVIGNNCSIGPNSLIT-------------
GLMU_SYNY3      LINPDSITIDDT-VVLEADVIIEPNTHLRGKTVIGRGSRIGPGSLIE-------------
GLMU_GLOVI      IVDPLRVTIDET-VEIEPDVVIEPETHLRGATRIAGGCRIGPGTLLE-------------
GLMU_PROMA      FINPSSCTISEQ-CEFGKDVTIEPETHLRGKCIIANNCHLGPNCFIS-------------
GLMU_PROMT      FVDPISCSLSED-SNFGTDVIIEPQTHLRGKCSIGNGCHLGPGSVIT-------------
GLMU_PROMM      FTDPASCTLSED-CQFGRDVVIEPQTHLRGCCNIGDGCQLGPGSLIE-------------
GLMU_SYNPX      FVDPGSCTLSEN-CCFGRDVVIEPQTHLRGSCRIGDNCRLGPGSLLE-------------
GLMU_PROMP      FINPASCTISEE-SIIGLDVIIEANTHIRGNSRISNNCRIGPNSFIK-------------
GLMU_COREF      IVDPATTWIDVE-VTIGRDVLINPGTQLRGTTSIGDRAEIGPDTTLT-------------
GLMU_CORGL      IVDPATTWIDVE-VSIGRDVIIHPGTQLKGETVIGDRVEVGPDTTLT-------------
GLMU_CORDI      IVDPDTTWIDSE-VTIGRDVIIHPSTQLLGKTSIADNCVIGPDTTLT-------------
GLMU_CORJK      IVDPATTWIDVD-VQVGQDVTILPGTQLLGTTTIGDNAQIGPDTTLE-------------
GLMU_MYCBO      VVDPATTWIDVD-VTIGRDTVIHPGTQLLGRTQIGGRCVVGPDTTLT-------------
GLMU_MYCTU      VVDPATTWIDVD-VTIGRDTVIHPGTQLLGRTQIGGRCVVGPDTTLT-------------
GLMU_MYCPA      VVDPATTWIDVD-VTIGRDTVIHPGTQLLGRTQIGGHCVVGPDTTLT-------------
GLMU_MYCLE      IIDPATTWIDID-VTIGNDTVIHPGTQLLGRTQIGECCVIGPDTTLT-------------
GLMU_NOCFA      IIDPASTWVDAG-VRIGRDAVLRPGVQLLGSTVIGEDAEIGPDSTLT-------------
GLMU_STRAW      VVDPATTWIDVT-VTFGQDAIVHPGTQLQGTTQLGEGAEVGPNSRLK-------------
GLMU_STRCO      VVDPATTWVDVT-VTFEQDVVVHPGTQLHGTTHLAEGCEVGPNTRLT-------------
GLMU_THEFY      VVDPASTWVDVD-VRVGRDAVLEPQTQLQGRTVIGEGAQVGPATVLC-------------
GLMU_LEIXX      VQDPATTWIDVR-VRLAPDVTLLPGTQLRGATAVETGATIGPDTTLL-------------
GLMU_BIFLO      ILDPETTWIEDD-VQIGRDATILPGSFLQGHTVVGEDAIVGPYTTLI-------------
GLMU_BDEBA      MIDPRTVYVEES-VEIGAGTVIYPNVFIRGRTKIGSFTVIESNAFIS-------------
GLMU_FUSNN      LIDPATTYIDDE-VKIGRDTTIYPNVTLQGNTEIGENSEILSGTRII-------------
GLMU_THEMA      ILDPATTYIHYS-VEIGMDTVIYPMTFIEGKSRVGENCEIGPMTRIV-------------
GLMU_THET2      MILPETIYLEPS-VELAPDVTLWPGAVLKGKTRIGEGCEVGPYAVLE-------------
GLMU_THET8      MILPETIYLEPS-VELAPDVTLWPGAVLKGKTRIGEGCEVGPYAVLE-------------
GLMU_DEIRA      ISLPGTVLIEDT-VEIGRDVVIEPGALLRGQTRIAGGAVIGAYSVIT-------------
GLMU_AQUAE      VHYPETVWIEPD-VSIEPDVEIFPDVMLKGKTKIKKGSVIGKGSVIK-------------
GLMU_DESAG      VHAAGSVRIGPD-VVIEPGAVIHGPCELYGNTFVGAQAVIDSHCWVK-------------
GLMU_DESVH      IHAPETVRISPR-ATIEPGAEIYGPCEIYGTSRIARGAVVHSHCWLR-------------
GLMU_AGRFC      MIAPETVFLSFD-------TKIGQDVLIEPNVVFGPGVTIEPGAIVH-------------
GLMU_RHIME      MIAPETVFLSWD-------TALAQDVLLEPNVVFGPGVRVESGAVIH-------------
GLMU_BRUAB      LIAPETVFFSYD-------TVIEPDVVIEPNVFFGPSVHVASGALIH-------------
GLMU_BRUME      LIAPETVFFSYD-------TVIEPDVVIEPNVFFGPSVHVASGALIH-------------
GLMU_BRUSU      LIAPETVFFSYD-------TVIEPDVVIEPNVFFGPSVHVASGALIH-------------
GLMU_RHILO      LIAPETVYFSHD-------TEIGADTVVEPNVWFGPGVKIAGGAKIH-------------
GLMU_BARHE      ILKPETVYFSYD-------TQIKPGVMIEPNVYFGLGVKVHSGAVIH-------------
GLMU_BARQU      ILKPETVYFSYD-------TEIEQGVVIEPNVYFGLGVKVQSGAVIH-------------
GLMU_BRADU      LIAPETVYLSAD-------TVFGKDVTIEPFVVIGPGVSIADGTVIH-------------
GLMU_NITWN      MVAPETVFLSAD-------TSFGRDVTIEPYVIIGQGVTIADGAVVH-------------
GLMU_RHOPA      LIAPETVYLAAD-------TTFGKDVVIEPFVVIGPGVSIADGAVIH-------------
GLMU_CAUVC      MPAPDTVHLAWD-------TQIAGGAVVEQFVVFGPGVSVASGAVIK-------------
GLMU_CERS4      LTAPDTVFFALD-------TFLGRDAIVGPNVVFGPGVTVESGAEIR-------------
GLMU_RUEPO      LMAPETVYLAAD-------TVIGRDTVIEPNVVFGPGVTVESGATIR-------------
GLMU_GLUOX      LVAPETVFFSTD-------TVIEADVTIEPNVFFGPGVKVRSGALIR-------------
GLMU_ZYMMO      LIAPETVWFSYD-------TEIGRDVIIEPQVYFGRNVKVANGVTIH-------------
GLMU_WOLPM      LVAPETVFFSLD-------TQIARDSVIYPYVFFGTGVKIESGAKIL-------------
GLMU_WOLTR      LVAPETVFFSLD-------TQIGMDSIIYPYVFFGPGVRIGPGAKIG-------------
GLMU_ANAMM      LTSPDQVFFSID-------TQIAQDVIVHPYVVFGAGVAVEPGAEIL-------------
                .                    .     .     .     :     :              

GLMU_ECOLI      ----NSVIGDDCEISPYTVVEDANLAAACTIGPFARLRPGAELLEGAHVGNFVEMKKARL
GLMU_ECO57      ----NSVIGDDCEISPYTVVEDANLAAACTIGPFARLRPGAELLEGAHVGNFVEMKKARL
GLMU_SHIFL      ----NSVIGDDCEISPYTVVEDANLAAACTIGPFARLRPGAELLEGAHVGNFVEMKKARL
GLMU_SHIDS      ----NSVIGDDCEISPYTVVEDANLAAACTIGPFARLRPGAELLEGAHVGNFVEMKKARL
GLMU_SHISS      ----NSVIGDDCEISPYTVVEDANLAAACTIGPFARLRPGAELLEGAHVGNFVEMKKARL
GLMU_SHIBS      ----NSVIGDDCEISPYTVVEDVNLAAACTIGPFARLRPGAELLEGAHVGNFVEMKKARL
GLMU_ECOL6      ----NSVIGDDCEISPYTVVEDANLAAACTIGPFARLRPGAELLEGAHVGNFVEMKKARL
GLMU_SALPA      ----NSVIGDDCEISPYSVVEDAHLEAACTIGPFARLRPGAELLAGAHVGNFVEMKKARL
GLMU_SALTY      ----NSVIGDDCEISPYSVVEDAHLEAACTIGPFARLRPGAELLAGAHVGNFVEMKKARL
GLMU_SALCH      ----NSVIGDDCEISPYSVVEDAHLEAACTIGPFARLRPGAELLAGAHVGNFVEMKKARL
GLMU_SALTI      ----NSVIGDDCEISPYSVVEDAHLEAACTIGPFARLRPGAELLAGAHVGNFVEMKKARL
GLMU_YERPE      ----NCVIGDDSEISPYTVLEDARLDANCTVGPFARLRPGAELAEGAHVGNFVEIKKARL
GLMU_YERPS      ----NCVIGDDSEISPYTVLEDARLDANCTVGPFARLRPGAELAEGAHVGNFVEIKKARL
GLMU_PECAS      ----NCIIGDDSEISPYSVLEDSVLEAQCTIGPFARLRPGSELAEGAHVGNFVELKKARL
GLMU_PHOLL      ----NCIIGDDSIISPYTIVEDSEMETGCTVGPFARLRPGSKLAEKAHVGNFVEMKKSYL
GLMU_HAEIN      ----NVVIGNDVEIKPYSVLEDSIVGEKAAIGPFSRLRPGAELAAETHVGNFVEIKKSTV
GLMU_HAEI8      ----NVVIGNDVEIKPYSVLEDSIVGEKAAIGPFSRLRPGAELAAETHVGNFVEIKKSTV
GLMU_MANSM      ----NCEIGDDVEIKPYSVFEDSTIGARASIGPFSRLRPGAELAEETHIGNFVEIKKATV
GLMU_PASMU      ----NCQIGDDVEIKPYSVLEEAIVGQAAQIGPFSRLRPGTALADNTHIGNFVEIKKAHI
GLMU_HAEDU      ----NCVVGDDVDIKPYSVFENAIIGNKAQVGPFARLRPGAKLEAESHVGNFVEIKNAHI
GLMU_VIBVU      ----DCEIDDNTIVRPYSVIEGATVGEQCTVGPFTRLRPGAEMRNDSHVGNFVEVKNARI
GLMU_VIBVY      ----DCEIDDNTIVRPYSVIEGATVGEQCTVGPFTRLRPGAEMRNDSHVGNFVEVKNACI
GLMU_VIBPA      ----DCEIDDNTIVRPYSVIEGATVGEECTVGPFTRLRPGAELRNDAHVGNFVEVKNARI
GLMU_VIBCH      ----DCEIDDNTVIRPYSVIEGATVGENCTVGPFTRLRPGAELRDDAHVGNFVEMKNARL
GLMU_ALIF1      ----DCEIDDNTVIRPYSVIEGATVGEECTVGPFTRLRPGAELCNDAHVGNFVEVKNVRL
GLMU_PHOPR      ----DCEIDDNSVIRPYSVIEGATVGEDCTVGPFTRLRPGAELVGDSHVGNFVEMKKSRL
GLMU_COLP3      ----NSTIGANVEIKPNSIIEDTIIEADCSVGPFARLRPGSVMKQDSHVGNFVEMKKTTL
GLMU_PSET1      ----NCSIGDNVIIKANTLIEDATVAAKCTLGPYARLRPGAIMEEDSHVGNFVEMKKTRL
GLMU_SHEON      ----DTEIADNAEIKPYSIIEGAKLGVAASAGPFARLRPGAELMQDAHIGNFVEMKKAVL
GLMU_IDILO      ----NSVIGDDTVIRANSHIEDAKVAKGCKVGPFARLRPGAELADEAQVGNFVEMKKSRL
GLMU_PSESM      ----DSTLRKGVVVKANSHIDGALLGECSDAGPFARLRPGSVLGAKAHVGNFVELKNANL
GLMU_PSEU2      ----DSTLRKGVVVKANSHIEGAILGEGSDAGPFARLRPGSVLGAKAHVGNFVELKNANL
GLMU_PSE14      ----DSTLRKGVIVKANSHIEGAILGEGSDAGPFARLRPGSVLGAKAHVGNFVELKNANL
GLMU_PSEPK      ----NTTLRKGAVVKANSHLEGAVMGEGSDAGPFARLRPGSVLDAKAHVGNFVELKNAHL
GLMU_PSEF5      ----DSTLRKGAVIKANSHLDGAVMGEGSDAGPFARLRPGTVLEARAHVGNFVELKNAHL
GLMU_PSEPF      ----DSTLRKGVVIKANSHIEGAVLGEGSDAGPFARLRPGTVLEARAHVGNFVELKNARM
GLMU_PSEAE      ----DSVLRRGAVIKANSHLEGAELGEGSDAGPFARLRPGSVLGARAHVGNFVELKNARL
GLMU_NEIGO      ----NAKIGANSKIAPFSHLEGCEVGENNRIGPYARLRPQARLADDVHVGNFVEIKNAAI
GLMU_NEIG1      ----NAKIGANSKIAPFSHLEGCEVGENNRIGPYARLRPQAKLADNVHVGNFVEIKNAAI
GLMU_NEIMA      ----NAKIGANSKIAPFSHLEGCEVGENNQIGPYARLRPQAKLADDVHVGNFVEIKNAAI
GLMU_NEIMB      ----NAKIGANSKIAPFSHLESCEVGENNRIGPYARLRPQARLADDVHVGNFVEIKNAAI
GLMU_CHRVO      ----NVKIASGTRIAPFSHLEDAVVGAECRIGPYARLRPGAELAGHVHIGNFVEVKKSKI
GLMU_AROAE      ----NARIGAGTRLAPFSHVEDTTTGRDCVIGPYARTRPGTTLGDGVHLGNFVEVKNSAI
GLMU_DECAR      ----NVKVGAGTRIAAFCHFEDAVIGPDGVLGPYARLRPGTELGPEVHIGNFVEVKKSII
GLMU_BURMA      ----HAAIAAGARVDAFSHLDGATVGANAVVGPYARLRPGAVLAADAHVGNFVEVKNATL
GLMU_BURP1      ----HAAIAAGARVDAFSHLDGATVGANAVVGPYARLRPGAVLAADAHVGNFVEVKNATL
GLMU_BURPS      ----HAAIAAGARVDAFSHLDGATVGANAVVGPYARLRPGAVLAADAHVGNFVEVKNATL
GLMU_BURL3      ----NASVGAGTRIDAFTHIDGAELGAHTVIGPYARLRPGAQLADEAHVGNFVEVKNAVI
GLMU_CUPPJ      ----NSSIDAGAQVQPFCHIDSAKIGADGRIGPYARLRPGTELGEDVHIGNFVEVKNSQV
GLMU_RALSO      ----DAAIQAGAEILPFCHIEQATVGAQSRIGPYARLRPGTELAEDVHIGNFVEVKNSQI
GLMU_THIDA      ----NVSIAAGTRLDAFTLIDDATIGEAGRLGPFSRIRPGTRLARDVHVGNFVEIKNSAI
GLMU_BORBR      ----DVAVQAGARIEAYSHLQQAKVGQEAVVGPYARLRPGADLGERSHVGNFVEIKNSVL
GLMU_BORPA      ----DVAVQAGARIEAYSHLQQAKVGQEAVVGPYARLRPGADLGERSHVGNFVEIKNSVL
GLMU_BORPE      ----DVAVQAGARIEAYSHLQQAKVGQEAVVGPYARLRPGADLGERSHVGNFVEIKNSVL
GLMU_NITEU      ----NVIVSDGSVVHPFSLIEDAEVGKNCRIGPYARIRPGTQLDDAVHVGNFVEIKNSHI
GLMU_LEGPA      ----NVTLGDGCEVYANSVLEGCHIANDCHIGPFARLRSGTQLASHCKIGNFVETKKAIF
GLMU_LEGPH      ----NVTLGDGCEVYANSVLEGCHIANDCHIGPFARLRSGTQLASHCKIGNFVETKKAIF
GLMU_LEGPL      ----NVTLGDGCEVYANSVLEGCHIANDCHIGPFARLRSGTQLASHCKIGNFVETKKAIF
GLMU_COXBU      ----NTTVGENTEIHANSVIEAAVIKANCSVGPFARLRPGSVLEEGAKVGNFVEMKKTTL
GLMU_METCA      ----DTVIGPGVAVLANSVIEGAVIGAGSRVGPFARLRPESVLAEGVHIGNFVEVKQSDI
GLMU_NITOC      ----NAVLGEGVEVLANCVIEEAAIDACARVGPFTRIRPETRLGEGVHIGNFVEIKKSTI
GLMU_XANAC      ----DVTLGAGTQVRAHSDLEGVITEGAVQIGPFARLRPGTVLADGVHIGNFVETKKVTM
GLMU_XANC5      ----DVTLGAGTHVRAHSDLEGVVTEGAVQIGPFARLRPGTVLADGVHIGNFVETKKVTM
GLMU_XANOR      ----DVTLGAGTQVRAHSDLEGVITEGAVQIGPFARLRPGTVLADGVHIGNFVETKKVTM
GLMU_XANC8      ----DVQLAAGTQVRAHCDLEGVVTEGAVQIGPFARLRPGTVLADGVHIGNFVETKKVVM
GLMU_XANCP      ----DVQLAAGTQVRAHCDLEGVVTEGAVQIGPFARLRPGTVLADGVHIGNFVETKKVVM
GLMU_XYLFA      ----NVKLGPGTKVHAHCDLEGVTTTGSALIGPFARLRPGTMLADGVHIGNFVETKNTSI
GLMU_XYLFT      ----NVKLGPGTKVHAHCDLEGVTTTGSALIGPFARLRPETMLADGVHIGNFVETKNTSI
GLMU_ACIAD      ----NTKIAAGTKVQPYSIFEDAVVGENTQIGPFARLRPGAHLAAEVHIGNFVEVKNTSI
GLMU_PSYA2      ----NSQIGNACHIKPYCVIDEATVGAGVDIGPFAHLRPETVLSDNSKVGNFVEIKKSTI
GLMU_FRATT      ----NCIIEDNVRIKSNSMVDGSIIREGAIVGPFARVRPECDVKEGAVIGNFVEAKKTIL
GLMU_BUCAI      ----NSSIDSNTNIQAYTIIENSKIGKGCIIGPFAHLRSNTLLDRNVHIGNFVETKDTFI
GLMU_BUCAP      ----NSFIDDQTEIKEYTIIENVKIGKKCIIGPFAHLRPKTVLDDQIHVGNFVEIKDSII
GLMU_BUCBP      ----NSTIGNNCTIKAYSIIEKTIISNKCIVGPFTHLQHGTVLKNNTHVGNFVEIKKTTL
GLMU_WIGBR      ----NVIINNDVIIHPYSIIEDACLDSNSVIGPFAHIHSKSKIKKNVHVGNFVEIKNTIF
GLMU_BLOFL      ----DVEIGDDVIIYPFSFIENSKIHCKSKIGPFARLRPGTCLQEQVHIGNFVELKNIKL
GLMU_BLOPB      ----DTIVADDVEIYPFSIIENTTIGFQSKVGPFVRLRPGTELKEKSHVGNFVEIKNTRL
GLMU_CAMJE      ----NSIIK------SSSVIENSIVE-NSDVGPLAHLRPNC-ELKNTHIGNFVECKNAKL
GLMU_CAMJR      ----NSIIK------SSSVIENSIVE-NSDVGPLAHLRPNC-ELKNTHIGNFVECKNAKL
GLMU_HELHP      ----DSHIK------AHSVIEQSIIE-SSDVGPLAHIRPKS-HIKNTHIGNFVETKSSTL
GLMU_WOLSU      ----ESHIK------AHSVIEESRVI-RSDVGPMAHLRPQC-EVTETHIGNFVEVKKSKL
GLMU_HELPJ      ----NARIK------AYSVIEESQII-NSSVGPFAHARPKS-VICDSHVGNFVETKNAKL
GLMU_HELPY      ----NAHIK------AYSVIEESQIV-NSSVGPFAHARPKS-VICNSHVGNFVETKNAKL
GLMU_GEOSL      AVIRGCRLGSDVVIKAGTVMEDSTVMDHAAIGPMAHLRPGSELGAHVKIGNFVETKKIVM
GLMU_PELCD      ---RDCQLADNVHVKPGSVLEGSRVGSDTAIGPMAHLRPGTVLAGHNKIGNFVETKKAHI
GLMU_BACSU      ----NSAIGSRTVIKQ-SVVNHSKVGNDVNIGPFAHIRPDSVIGNEVKIGNFVEIKKTQF
GLMU_BACLD      ----NSTVGSRTVIKQ-SVIVDSEVGDDVTIGPFAHIRPDSKIGNEVRIGNFVEVKKSEF
GLMU_BACAN      ----DSEIGDRTTIRQ-STVHDSKLGTEVSVGPFAHIRPDSVIGDEVRVGNFVEIKKTVF
GLMU_BACC1      ----DSEIGDRTTIRQ-STVHDSKLGTEVSVGPFAHIRPDSVIGDEVRVGNFVEIKKTVF
GLMU_BACHK      ----DSEIGDRTIIRQ-STVHDSKLGTEVSVGPFAHIRPDSVIGDEVRVGNFVEIKKTVF
GLMU_BACCZ      ----DSEIGDRTTIRQ-STVHDSKLGTEVSVGPFAHIRPDSVIGDEVRVGNFVEIKKTVF
GLMU_BACCR      ----DSEIGDRTTIRQ-STVHDSKLGTEVSVGPFAHIRPDSVIGDEVRVGNFVEIKKTVF
GLMU_GEOKA      ----NCYIGHRTSIRH-SVAHDSEIGSDVTIGPFAHIRPLSKIDDEVRIGNFVEVKKSTF
GLMU_ALKHC      ----DSKIGNKTAVKQ-SVVHNSEVGERVSIGPFSHIRPASMIHDDVRIGNFVEVKKSTI
GLMU_OCEIH      ----DCEVGEDTVIRH-SVATSSKVGNRVNIGPYAHIRPESRVGNDTKVGNFVEIKKTNL
GLMU_LISMF      ----NSVIGERVHVRT-SSIFESKVGDDVQIGPYAHLRPESDIHDHVKIGNYVETKKAVV
GLMU_LISMO      ----NSVIGERVHVRT-SSIFESKVGDDVQIGPYAHLRPESDIHDHVKIGNYVETKKAVV
GLMU_LISIN      ----SSVIGERVHVRN-SSIFESKVGDDVQIGPYAHLRPESDIHNHVKIGNYVETKKAVV
GLMU_BACSK      ----SATLGRGVHVCS-SVISNSVVADGSSIGPFAHIRPGSDVGENVRVGNFVELKKASI
GLMU_LACPL      ----DMVIEDRVRVTA-SFLEDSIMHADSNIGPYSHLRPQAEIGEHVHLGNFVEVKKAKI
GLMU_LACSS      ----DSTIEDNIQITS-STIESAIMHTGSNIGPNSHLRPNAEIGVDVHVGNFCEVKNAKI
GLMU_ENTFA      ----DSHIGNQVVVKQ-SVIEESVVHEGADVGPYAHLRPKADVGANVHIGNFVEVKNATI
GLMU_LACAC      ----DSKIGNNVTVTS-STIEKSEMEDNTDIGPNSHLRPKALIKKGAHIGNFVEVKKAEI
GLMU_LACJO      ----DSKIGNNVTITS-STLQEAQMDDNTDIGPNSHLRPKAVIRKGAHIGNFVEIKKAEI
GLMU_STAAC      ----NSTIENGACIQQ-SVVNDASVGANTKVGPFAQLRPGAQLGADVKVGNFVEIKKADL
GLMU_STAAS      ----NSTIENGACIQQ-SVVNDASVGANTKVGPFAQLRPGAQLGADVKVGNFVEIKKADL
GLMU_STAAW      ----NSTIENGACIQQ-SVVNDASVGANTKVGPFAQLRPGAQLGADVKVGNFVEIKKADL
GLMU_STAAR      ----NSTIENGACIQQ-SVVNDASVGANTKVGPFAQLRPGAQLGADVKVGNFVEIKKADL
GLMU_STAAM      ----NSTIENGACIQQ-SVVNDASVGANTKVGPFAQLRPGAQLGADVKVGNFVEIKKADL
GLMU_STAAN      ----NSTIENGACIQQ-SVVNDASVGANTKVGPFAQLRPGAQLGADVKVGNFVEIKKADL
GLMU_STAEQ      ----NSTIHSNANIKQ-SVINDSIVGENTTVGPFAQLRPGSNLGSEVKVGNFVEVKKADI
GLMU_STAES      ----NSTIHSNANIKQ-SVINDSIVGENTTVGPFAQLRPGSNLGSEVKVGNFVEVKKADI
GLMU_STAEP      ----NSTIHSNANIKQ-SVINDSIVGENXXVGPFAQLRPGSNLGSEVKVGNFVEVKKADI
GLMU_STAHJ      ----NSHIGSQVDIKQ-SVINDSIVGDKTKVGPFAQLRPGSNLGSDVKVGNFVEVKKADL
GLMU_STAS1      ----NSKIGSNVTIKQ-SVINEAIVDDYATIGPFAQLRPGADLGKKVKVGNFVEVKKSVV
GLMU_STRA1      ----DAQVGNDVTITN-SMVEESIISDGVTVGPYAHIRPGTSLAKGVHIGNFVEVKGSQI
GLMU_STRA5      ----DAQVGNDVTITN-SMVEESIISDGVTVGPYAHIRPGTSLAKGVHIGNFVEVKGSQI
GLMU_STRA3      ----DAQVGNDVTITN-SMVEESIISDGVTVGPYAHIRPGTSLAKGVHIGNFVEVKGSQI
GLMU_STRT1      ----DSTIGANTVITN-SMIEHSVVEKGATVGPFAHIRPDSMLKEGVHIGNFVEVKGSTI
GLMU_STRT2      ----DSTIGANTVITN-SMIEHSVVEKGATVGPFAHIRPDSMLKEGVHIGNFVEVKGSTI
GLMU_STRPN      ----DSTIGAGAVITN-SMIEESSVADGVIVGPYAHIRPNSSLGAQVHIGNFVEVKGSSI
GLMU_STRR6      ----DSTIGAGAVITN-SMIEESSVADGVTVGPYAHIRPNSSLGAQVHIGNFVEVKGSSI
GLMU_STRMU      ----DSVIGENTVITH-SMIEASRIEKNVTVGPYAHLRPNSVLEEAVHVGNFVEVKASTL
GLMU_STRP1      ----DSEIGDNCVVTN-SMIESSVLAAGVTVGPYAHLRPGTTLDREVHIGNFVEVKGSHI
GLMU_STRPM      ----DSEIGDNCVVTN-SMIESSVLAAGVTVGPYAHLRPGTTLDREVHIGNFVEVKGSHI
GLMU_STRP6      ----DSEIGDNCVVTN-SMIESSVLAAGVTVGPYAHLRPGTTLDREVHIGNFVEVKGSHI
GLMU_STRP3      ----DSEIGDNCVVTN-SMIESSVLAAGVTVGPYAHLRPGTTLDREVHIGNFVEVKGSHI
GLMU_STRP8      ----DSEIGQGSIITN-SMIESSVLAAGVTVGPYAHLRPGTTLDREVHIGNFVEVKDSHI
GLMU_STREC      ----DSRLGEGVVVSQ-SVIEGSVLADGVTVGPYAHIRPDSQLDECVHIGNFVEVKGSHL
GLMU_LACLA      ----NSEIHSNCEVRN-STVEESRMSVGSNVGPYAHLRPGTVLSEEVHVGNFVEIKGSTL
GLMU_CLOPE      ----NSTIGNGVEIQS-SVILDSKIGDETTVGPFAYVRPESNIGEHVRIGDFVEIKKSTI
GLMU_CLOTE      ----DSIIEKSVVIQN-SVILQSNIGENTTVGPFAYIRPDSNIGSAVRIGDFVEIKKSTI
GLMU_CLOAB      ----DSVIGKNVTVQS-SVILESKVGEDTTVGPFAYIRPESNIGNKVRIGDFVEIKKSTI
GLMU_CALS4      ----DSTIGNGCNVMY-SVVLSSSVGNNVKIGPFAHIRPESVIKNNVKIGDFVEIKKSVI
GLMU_CARHZ      ----DSVIGNNTEITF-SVIIQARVGDEVNVGPFAYLRPGTEIANGVKIGDFVEIKKSFI
GLMU_SYMTH      ----SSTVAEGCVVEQ-SVVEESYVGPGCRIGPMAHLRPGCELEGAAEIGNYAELKKAKV
GLMU_NOSS1      ----NSQLGANVTVHY-SVVTDSTIQDGTKIGPYAHLRGHAQVGANCRIGNFVELKNTEL
GLMU_THEEB      ----NSVIGERVTARY-AVITDSEIGEDTQVGPFAHIRQQSVVADHCRIGNFVELKKARL
GLMU_SYNP6      ----NSQIGDGVTVQM-SVISDSTIAANSKIGPFAHLRGAAAIGEACRIGNFVEVKKSTV
GLMU_SYNY3      ----DSIVGSDASVLF-SVVSQSQIGDGCRLGPYSHVRGEADIQANCRIGNFVEVKKSVI
GLMU_GLOVI      ----DTVVGAGTEILY-SVLRRSRVGAHSTIGPYSHLRPGADVGSHCRVGNYVEIKNATI
GLMU_PROMA      ----NAVIGKNSSIIY-SVVKNAQIGDNVKVGPFANIRPDTMIQNNCKIGNFVEIKKSYI
GLMU_PROMT      ----NSTLAENVLAIH-SFINEATIGNNTSIGPFAHIRPESNIRQNSKIGNFVEIKKSCI
GLMU_PROMM      ----NAELGHGVSVLH-SVVCDAKVGNEVAIGPFSHLRPGAGIADQCRIGNFVEIKKSQI
GLMU_SYNPX      ----NAELGSDVSVLH-SVVREATVGNGVAIGPFAHLRPAADIADGCRIGNFVEVKKSQV
GLMU_PROMP      ----DAIINENCEIIN-STIFDSKIMDHVKIGPYSHIRPNCEISSKSKIGNFVEIKNSQL
GLMU_COREF      ----NMVIGTGASVIR-THGSDSEIGEDATVGPFTYIRPGTKLGAEGKLGGFVETKKATI
GLMU_CORGL      ----NMTIGDGASVIR-THGFDSTIGENATVGPFTYIRPGTTLGPEGKLGGFVETKKATI
GLMU_CORDI      ----NMVIDEDAHVIR-THGFDSRIGAHANIGPFTYIRPGTVVGENGKLGGFVEAKNAQI
GLMU_CORJK      ----NVKVGEGAQVVR-THGFDSTIGPRAEVGPFTYIRPGTVLGEEGKLGGFVEAKKANI
GLMU_MYCBO      ----DVAVGDGASVVR-THGSSSSIGDGAAVGPFTYLRPGTALGADGKLGAFVEVKNSTI
GLMU_MYCTU      ----DVAVGDGASVVR-THGSSSSIGDGAAVGPFTYLRPGTALGADGKLGAFVEVKNSTI
GLMU_MYCPA      ----DVSVGDGASVVR-THGTGSSVGAGATVGPFAYLRPGTVLGDDGKLGAFVETKNATI
GLMU_MYCLE      ----DVLVSQRATVVR-THGTSSTIGAGAMVGPFTYLRPGTVLGTKGKLGAFVETKNSTI
GLMU_NOCFA      ----DVRVGDGAKVVR-THGEGATIGPNASVGPFAYLRPGTILGEAGKLGAFVETKNADI
GLMU_STRAW      ----DTRVGAGARIDN-TVAERADVGAQASVGPFAYLRPGTRLGAKAKVGTYVETKNASI
GLMU_STRCO      ----DTRVEAGARVDN-TVANGAHVGPQASVGPYAYLRPGTRLGLKSKIGTFVEAKNSSI
GLMU_THEFY      ----DTEVGEDAVVSH-TVAREAVIGPEATVGPYAYLRPGARLDRGVKIGTFVEVKNSTV
GLMU_LEIXX      ----DTEVGAGATVKR-TDATLAVIGAAATVGPFAYLRPGTVLGADGKIGTFVETKNAVI
GLMU_BIFLO      ----DATVDEGAVVER-SRVQESHIGARTNIGPWTYLRPGNEFGEDAKAGAFVEMKKAHI
GLMU_BDEBA      ----DCEIGDSVQIRGGSYLESSKLHNKVSAGPYARLRPETEIFEEAHVGNFVEMKKVKF
GLMU_FUSNN      ----DSKIYDNVRIES-SVIEESIVENGVTIGPYAHLRPKSHLKENVHIGNFVETKKSTL
GLMU_THEMA      ----DCEIGNNVKITRSECFK-SVIEDDVSVGPFARLREGTILKKSSKIGNFVEIKKSTI
GLMU_THET2      ----DTVLEPGAKVLAHTVAQGAHLHPGASAGPFARLRPGAVLMEEVHVGNFVEVKNSLL
GLMU_THET8      ----DTVLEPGAKVLAHTVAQGAHLHPGASAGPFARLRPGAVLMEEVHVGNFVEVKNSLL
GLMU_DEIRA      ----DSVIHERAVIKAHSVLEQAEVGAGSDVGPFARLRPGSVLGEGVHIGNFVETKNARL
GLMU_AQUAE      ----DSLVEENVIVREYSVIENSEIKKRAVVGPFARIRNESVIGEEAEIGNFVEVKKSSI
GLMU_DESAG      ----DSRLHPGSTLRNFSHAEQAEIATGAVAGPYARLRPGAVLEQDARMGNFVEMKKAVL
GLMU_DESVH      ----NAEVESGSEVKSFSHLEGATVGKGCSVGPFARLRPGAVLDEEARVGNFVEMKKARL
GLMU_AGRFC      ---------------AFSHLEGAHLAEGAVVGPFARLRPGANLHANAKVGNFCEVKKAEI
GLMU_RHIME      ---------------AFSHLEGAHVRAGATVGPFARLRPGADLGAKSKVGNFCEVKNAEI
GLMU_BRUAB      ---------------SFSHLEGAQVGEKAEIGPFARLRPGADLAEKSKVGNFCEVKNAKV
GLMU_BRUME      ---------------SFSHLEGAQVGEKAEIGPFARLRPGADLAEKSKVGNFCEVKNAKV
GLMU_BRUSU      ---------------SFSHLEGAQVGEKAEIGPFARLRPGADLAEKSKVGNFCEVKNAKV
GLMU_RHILO      ---------------AFSHIEGATIAANCDVGPFARLRPGADLRNKAKVGNFCEVKQAVI
GLMU_BARHE      ---------------AFSYLEGAVVGTDARIGPYARLRPGTELAGSVKIGNFCEVKKAKI
GLMU_BARQU      ---------------AFSYLEGAVVGIDAQIGPYAHLRPGTELARSVKIGNFCEVKKAKI
GLMU_BRADU      ---------------SFSHIVETTLGRNVSIGPYARLRPGTSLGDGARIGNFVETKAATL
GLMU_NITWN      ---------------AFSHLVQASIGRNASVGPYARLRPGTSVGDGARIGNFVETKAAVL
GLMU_RHOPA      ---------------SFSHLTEAKIGSKAQVGPYARLRPGTSLGDGAKIGNFVETKAAQI
GLMU_CAUVC      ---------------AFSHLEGAVVGEGALIGPYARLRPGAEIGPDAHIGNFVEVKKVKV
GLMU_CERS4      ---------------AFCHLEGCHISRGATVGPFARLRPGAELAEDVHVGNFVEIKNAVL
GLMU_RUEPO      ---------------AFSHLEGCHVSRGAVVGPYARLRPGAELAENARIGNFVEIKNAEI
GLMU_GLUOX      ---------------AFSHLEGCEVGENAMIGPYARLRPGTLCAAQTHVGNFVELKNVEL
GLMU_ZYMMO      ---------------SFSHIEGADIKENVEIGPFARLRPGAEIAEKAKIGNFVEIKKSKI
GLMU_WOLPM      ---------------PFSHLENCLIKSNAEVGPFTRIRGNTTIGNKAKIGNFVEVKTSEV
GLMU_WOLTR      ---------------PFTKCED------------------TTIGDGAIVGNFVEAKASDI
GLMU_ANAMM      ---------------SYSHLEFCHIKKGAIVGPFARVRGNSTIDRGCVVGNFVEIKESSL
                                                                 * : * *   .

GLMU_ECOLI      GKGSKAGHLTYLGDAEIGDNVNIGAGTITCNYDG-ANKFKTIIGDDVFVGSDTQLVAPVT
GLMU_ECO57      GKGSKAGHLTYLGDAEIGDNVNIGAGTITCNYDG-ANKFKTIIGDDVFVGSDTQLVAPVT
GLMU_SHIFL      GKGTKAGHLTYLGDAEIGDNVNIGAGTITCNYDG-ANKFKTIIGDDVFVGSDTQLVAPVT
GLMU_SHIDS      GKGSKAGHLTYLGDAEIGDNVNIGAGTITCNYDG-ANKFKTIIGDDVFVGSDTQLVAPVT
GLMU_SHISS      GKGSKVGHLTYLGDAEIGDNVNIGAGTITCNYDG-ANKFKTIIGDDVFVGSDTQLVAPVT
GLMU_SHIBS      GKGSKAGHLTYLGDAEIGDNVNIGAGTITCNYDG-ANKFKTIIGDDVFVGSDTQLVAPVT
GLMU_ECOL6      GKGSKAGHLTYLGDAEIGDNVNIGAGTITCNYDG-ANKFKTIIGDDVFVGSDTQLVAPVT
GLMU_SALPA      GKGSKAGHLTYLGDAEIGDNVNIGAGTITCNYDG-ANKFKTVIDDDVFVGSDTQLVAPVT
GLMU_SALTY      GKGSKAGHLTYLGDAEIGDNVNIGAGTITCNYDG-ANKFKTVIGDDVFVGSDTQLVAPVT
GLMU_SALCH      GKGSKAGHLTYLGDAEIGDNVNIGAGTITCNYDG-ANKFKTVIGDDVFVGSDTQLVAPVT
GLMU_SALTI      GKGSKAGHLTYLGDAEIGDNVNIGAGTITCNYDG-ANKFKTVIGDDVFVGSDTQLVAPVT
GLMU_YERPE      GKGSKAGHLSYLGDAEIGAGVNIGAGTITCNYDG-ANKFKTIIGDDVFVGSDTQLVAPVT
GLMU_YERPS      GKGSKAGHLSYLGDAEIGAGVNIGAGTITCNYDG-ANKFKTIIGDDVFVGSDTQLVAPVT
GLMU_PECAS      GKGSKAGHLSYLGDADIGSGVNIGAGTITCNYDG-ANKHKTVIGDDVFVGSDTQLVAPVN
GLMU_PHOLL      GKGSKAGHLTYLGDADIGRDVNIGAGTITCNYDG-ANKFKTIIGDNVFVGSDTQLVAPVI
GLMU_HAEIN      GKGSKVNHLTYVGDSEIGSNCNIGAGVITCNYDG-ANKFKTIIGDDVFVGSDTQLVAPVK
GLMU_HAEI8      GKGSKVNHLTYVGDSEIGSNCNIGAGVITCNYDG-ANKFKTIIGDDVFVGSDTQLVAPVK
GLMU_MANSM      GKGSKVNHLTYVGDAQVGTDCNLGAGVITCNYDG-ANKFKTVIGDNVFVGSDVQLVAPVN
GLMU_PASMU      GTGSKVNHLSYVGDAEVGMQCNIGAGVITCNYDG-ANKFKTIIGDNVFVGSDVQLVAPVT
GLMU_HAEDU      GKGSKVNHLAYVGDAEVGENCNLGAGVITCNYDG-ANKFKTTIGNNVFVGSDVQLIAPVN
GLMU_VIBVU      GEGSKANHLTYLGDAEIGQRTNIGAGTITCNYDG-ANKFKTIIGNDVFVGSDSQLVAPLT
GLMU_VIBVY      GEGSKANHLTYLGDAEIGQRTNIGAGTITCNYDG-ANKFKTIIGNDVFVGSDSQLVAPVT
GLMU_VIBPA      GEGSKANHLTYLGDAEIGQRTNIGAGTITCNYDG-ANKFKTIIGNDVFVGSDSQLVAPVT
GLMU_VIBCH      GEGSKANHLTYLGDAEIGKGVNVGAGVITCNYDG-ANKHKTVIGDDVFVGSDCQLVAPVT
GLMU_ALIF1      GEGSKANHLTYLGDAEIGKRVNVGAGVITCNYDG-ANKFKTIIGDDVFVGSDSQLIAPVT
GLMU_PHOPR      GRGSKANHLTYLGDADIGDRVNIGAGTITCNYDG-VNKFKTEIGDDVFVGSDTQLIAPVK
GLMU_COLP3      GVGSKAGHLSYLGNAEIGTKVNIGAGTITCNYDG-VNKSTTEIGDNAFIGSNSSLVAPVI
GLMU_PSET1      GKGSKANHLSYLGDAEIGEKVNIGAGTITCNYDG-VNKAKTIIGNNAFIGSNSSLVAPVN
GLMU_SHEON      GVGSKAGHLAYLGDAQIGAGVNIGAGTITCNYDG-ANKHLTVIEDNVFVGSDTQLVAPVT
GLMU_IDILO      GKGSKASHLTYLGDTQVGEYANIGAGTITCNYDG-VNKALTEIGDGAFIGSNSSLVAPVA
GLMU_PSESM      GEGAKVGHLTYLGDAEVGARTNIGAGTITCNYDG-ANKHKTTLGADVFIGSNNSLVAPVD
GLMU_PSEU2      GEGAKVGHLTYLGDAEIGARTNIGAGTITCNYDG-ANKHKTTLGADVFIGSNNSLVAPVD
GLMU_PSE14      GEGAKVGHLTYLGDAEVGARTNIGAGTITCNYDG-ANKHKTTLGTDVFIGSNNSLVAPVD
GLMU_PSEPK      GEGAKAGHLTYLGDAEIGARTNIGAGTITCNYDG-ANKFKTVMGEDVFIGSNNSLVAPVE
GLMU_PSEF5      GQGAKAGHLTYLGDAVIGARTNIGAGTITCNYDG-VNKHKTIMGEDVFIGSNNSLVAPVD
GLMU_PSEPF      GEGAKAGHLTYLGDAEIGARTNIGAGTITCNYDG-ANKWKTVLGEDVFIGSNNSLVAPVD
GLMU_PSEAE      GEGSKAGHLSYLGDAELGANCNIGAGTITCNYDG-ANKFRTELGDDVFIGSNNSLVAPLK
GLMU_NEIGO      GKGTKANHLTYIGDAEVGSKTNFGAGTIIANYDG-VHKHKTVIGDEVRIGSNCVLVAPVT
GLMU_NEIG1      GKGTKANHLTYIGDAEVGSKTNFGAGTIIANYDG-VHKHKTVIGDEVRIGSNCVLVAPVT
GLMU_NEIMA      GKGTKANHLTYIGDAEVGSKTNFGAGTIIANYDG-VHKHKTVIGDEVRIGSNCVLVSPVK
GLMU_NEIMB      GKGTKANHLTYIGDAEVGCKTNFGAGTIIANYDG-VHKHKTVIGDEVRIGSNCVLVAPVT
GLMU_CHRVO      GEGSKVNHLSYVGDAEIGRKVNVGAGSVTCNYDG-VNKFKTIIGDNVFVGSGTLMVAPVK
GLMU_AROAE      ADDSKANHLAYIGDADIGRRVNVGAGTITCNYDG-ANKYRTTIGDDVFIGSDTQLVAPVR
GLMU_DECAR      GAQSKANHLAYIGDAEIGQRVNVGAGTITCNYDG-ANKFKTVIEDDVFIGSDTQLVAPVT
GLMU_BURMA      GQGSKANHLTYLGDADIGARVNVGAGTITCNYDG-ANKFRTVIEDDVFVGSDTQFVAPVR
GLMU_BURP1      GQGSKANHLTYLGDADIGARVNVGAGTITCNYDG-ANKFRTVIEDDVFVGSDTQFVAPVR
GLMU_BURPS      GQGSKANHLTYLGDADIGARVNVGAGTITCNYDG-ANKFRTVIEDDVFVGSDTQFVAPVR
GLMU_BURL3      GHGSKANHLTYIGDADIGARVNIGAGTITCNYDG-ANKFRTVIEDDVFVGSDTQLVAPVR
GLMU_CUPPJ      AAHSKANHLAYVGDATVGARVNIGAGTITCNYDG-ANKFRTVIEDDVFIGSDTQLVAPVT
GLMU_RALSO      AAHSKANHLAYVGDATVGSRVNIGAGTITCNYDG-ANKFRTIIEDDAFIGSDTQLVAPVR
GLMU_THIDA      DAGSKINHLSYVGDTTMGQRVNIGAGTITCNYDG-ANKHRTVIEDDVFVGSDTQLVAPVT
GLMU_BORBR      QADSKANHLAYIGDADIGARVNVGAGTITCNYDG-VNKHRTVIEDDAFIGSDTQLVAPVR
GLMU_BORPA      QADSKANHLAYIGDADIGARVNVGAGTITCNYDG-VNKHRTVIEDDAFIGSDTQLVAPVR
GLMU_BORPE      QADSKANHLAYIGDADIGARVNVGAGTITCNYDG-VNKHRTVIEDDAFIGSDTQLVAPVR
GLMU_NITEU      ASESKVNHLSYVGDTEMGRRVNIGAGAITCNYDG-AFKHRTVIEDDVFIGSDTQLVAPVT
GLMU_LEGPA      DEGTKASHLSYLGDVLLGKNVNVGAGTITCNYDG-VNKHQTIIEDGVFIGSDTQLVAPVT
GLMU_LEGPH      DEGTKASHLSYLGDVLLGKNVNVGAGTITCNYDG-VNKHQTIIEDGVFIGSDTQLIAPVT
GLMU_LEGPL      DEGTKASHLSYLGDVLLGKNVNVGAGTITCNYDG-VNKHQTIIEDGVFIGSDTQLVAPVT
GLMU_COXBU      GRGSKANHLTYLGDTIIGKNVNVGAGTITCNYDG-ANKWQTKIEDGAFIGSNVALVAPLT
GLMU_METCA      AVGSKVNHLSYIGDASIGRGVNVGAGTITCNYDG-VAKHRTIIEDGAFIGSDTQLVAPVR
GLMU_NITOC      NKNSKVNHLSYIGDATIGKKVNIGAGTITCNYDG-ANKHHTLIEDNVFIGSDTQLIAPVK
GLMU_XANAC      GVGSKANHLTYLGDAVIGSKVNIGAGTITCNYDG-VNKSQTTIGDGAFIGSNSALVAPIQ
GLMU_XANC5      GVGSKANHLTYLGDAVIGSKVNIGAGTITCNYDG-VNKSQTTIGDGAFVGSNSALVAPIE
GLMU_XANOR      GVDSKANHLTYLGDAVIGSKVNIGAGTITCNYDG-VNKSQTTIGDGAFVGSNSALVAPIE
GLMU_XANC8      GAGSKANHLTYLGDAVVGSKVNIGAGTITCNYDG-VNKSQTTIGDGAFVGSNSALVAPIE
GLMU_XANCP      GAGSKANHLTYLGDAVVGSKVNIGAGTITCNYDG-VNKSQTTIGDGAFVGSNSALVAPIE
GLMU_XYLFA      GADSKANHLTYLGDAQIGTKVNIGAGTITCNYDG-INKSITLIGDGAFIGSHSALIAPVS
GLMU_XYLFT      GADSKANHLTYLGDAQIGTKVNIGAGTITCNYDG-VNKSITLIGDGAFIGSHSALIAPVS
GLMU_ACIAD      GVGSKANHFTYLGDAEVGAGSNIGAGTITCNYDG-ANKHKTVIGDAVFIGSNSSLVAPVS
GLMU_PSYA2      GHGSKVNHLSYIGDATVGTGVNVGAGVITCNYDG-VNKSQTIIEDHAFIGSNSSLVAPVT
GLMU_FRATT      GKGSKASHLTYLGDSEIGANCNIGAGVITCNYDG-VNKHKTVIGDYAFIGSDSQLIAPVN
GLMU_BUCAI      KNESKVKHLSYLGNSEIGSKVNIGAGSITCNYDG-ANKFKTIIGDNVLVGSNTQLIAPIK
GLMU_BUCAP      KKESKIKHLSYFGNSEIGSQVNIGAGSITCNYDG-VNKFKTIIGDNVLIGANTKLIAPIK
GLMU_BUCBP      GSYSKAKHLSYLGNSQIGQKVNIGAGTVTCNYNG-KKKLDTIIGDNVFIGSSTQLIAPIN
GLMU_WIGBR      GKNSKVGHLSYLGDSDIGKNVNIGAGTITCNFDG-KKKNKTIIKNNVFIGANSELIAPVI
GLMU_BLOFL      GNNSKVGHLSYLGDADVGNYVNIGAGTIICNYNG-KTKNYTCIEDNVFVGADSQLVAPIT
GLMU_BLOPB      GEQSKVKHLSYLGDAEIGNQVNIGAGTIICNYDG-MMKHQTIIGDDVFIGADSQLVAPIT
GLMU_CAMJE      -NTVKAGHLSYLGDCEIDSGTNIGCGTITCNYDG-VKKHKTIIGKNVFVGSDTQFIAPVK
GLMU_CAMJR      -NTVKAGHLSYLGDCEIDSGTNIGCGTITCNYDG-VKKYKTIIGKNVFVGSDTQFIAPVK
GLMU_HELHP      -RGVKVGHLSYLGDCEIDEGSNIGAGVITCNYDG-KAKHKTTIGKSVFVGSDVQLIAPLN
GLMU_WOLSU      -TGVKAGHLSYLGDCEVDEGSNIGAGVITCNYDG-KKKHLTKIGKNVFVGSDSQLVAPVS
GLMU_HELPJ      -QGTKAGHLSYLGDCEIGKNTNVGAGVITCNYDG-KKKHQTIIGENVFIGSDSQLVAPIN
GLMU_HELPY      -QGTKAGHLSYLGDCEIGKNTNVGAGVITCNYDG-KKKHQTIIGENVFIGSDSQLVAPIN
GLMU_GEOSL      GEGSKASHLTYLGDATIGRNVNVGCGTITCNYDG-VNKHRTVIGDDVFVGSDVQFVAPVT
GLMU_PELCD      GLGSKASHLTYIGDAELGANVNIGCGTITCNYDG-VNKHKTVIEDDVFVGSDTQFVAPVH
GLMU_BACSU      GDRSKASHLSYVGDAEVGTDVNLGCGSITVNYDG-KNKYLTKIEDGAFIGCNSNLVAPVT
GLMU_BACLD      GDRSKASHLSYIGDAEIGTDVNLGCGSITVNYDG-KHKFKTKIENGAFIGCNSNLVAPVT
GLMU_BACAN      GNRSKASHLSYIGDAQVGEDVNLGCGSITVNYDG-KNKFKTVIGNGVFIGCNSNLVAPVT
GLMU_BACC1      GNRSKASHLSYIGDAQVGEDVNLGCGSITVNYDG-KNKFKTVIGNGVFIGCNSNLVAPVT
GLMU_BACHK      GNRSKASHLSYIGDAQVGEDVNLGCGSITVNYDG-KNKFKTVIGNGVFIGCNSNLVAPVT
GLMU_BACCZ      GNRSKASHLSYIGDAQIGEDVNLGCGSITVNYDG-KNKFKTVIGNGVFIGCNSNLVAPVT
GLMU_BACCR      GNRSKASHLSYIGDAQVGEDVNLGCGSITVNYDG-KNKFKTVIGNGVFIGCNSNLVAPVT
GLMU_GEOKA      GKGSKASHLSYIGDAEVGADVNLGCGSITVNYDG-VNKHMTKIEDGAFIGCNVNLIAPVT
GLMU_ALKHC      GKESKASHLSYIGDAEVGERVNFSCGSITVNYDG-KNKFLTKIEDDAFIGCNSNLIAPVT
GLMU_OCEIH      GDHSKVSHLSYIGDADVGERVNVGCGTITVNYDG-TNKYLTTIEDDAFIGCNSNLIAPVT
GLMU_LISMF      GEGTKLPHFIYMGDAEIGKNVNVGCGSIAVNYDG-KNKAKTIIGDNVFVGCNSNLIAPVK
GLMU_LISMO      GEGTKLPHFIYMGDAEIGKNVNVGCGSIAVNYDG-KNKAKTIIGDNVFVGCNSNLIAPVK
GLMU_LISIN      GEGTKLPHFIYMGDAEIGKNVNVGCGSIAVNYDG-KNKAKTIIGDNVFVGCNSNLIAPVK
GLMU_BACSK      GTGSKVSHLTYVGDAEVGSDVNVGCGVVTVNYDG-KNKHKTIIKDGAFVGSGSNLIAPVE
GLMU_LACPL      GNRTKVGHLTYVGDATLGQDINVGCGVVFVNYDG-VNKHHTNVGDSAFIGSNSNIIAPVE
GLMU_LACSS      GDRTKIGHLSYVGDATLGTDINVGCGVVFVNYDG-VAKHHANVGSHVFIGSNSNIVAPVE
GLMU_ENTFA      DEGTKVGHLTYVGDATLGKDINVGCGVVFVNYDG-KNKHQTIVGDHAFIGSATNIVAPVT
GLMU_LACAC      GENTKVGHLTYVGDATLGKDINIGCGTIFSNYDG-VKKFHTNVGDHAFIGAGSTLIAPIN
GLMU_LACJO      GENTKVGHLTYVGDATLGKDINIGCGTIFSNYDG-VKKFHTNVGDHSFIGAGATIIAPVN
GLMU_STAAC      KDGAKVSHLSYIGDAVIGERTNIGCGTITVNYDG-ENKFKTIVGKDSFVGCNVNLVAPVT
GLMU_STAAS      KDGAKVSHLSYIGDAVIGERTNIGCGTITVNYDG-ENKFKTIVGKDSFVGCNVNLVAPVT
GLMU_STAAW      KDGAKVSHLSYIGDAVIGERTNIGCGTITVNYDG-ENKFKTIVGKDSFVGCNVNLVAPVT
GLMU_STAAR      KDGAKVSHLSYIGDAVIGERTNIGCGTITVNYDG-ENKFKTIVGKDSFVGCNVNLVAPVT
GLMU_STAAM      KDGAKVSHLSYIGDAVIGERTNIGCGTITVNYDG-ENKFKTIVGKDSFVGCNVNLVAPVT
GLMU_STAAN      KDGAKVSHLSYIGDAVIGERTNIGCGTITVNYDG-ENKFKTIVGKDSFVGCNVNLVAPVT
GLMU_STAEQ      KDGAKVSHLSYIGDAEIGERTNIGCGSITVNYDG-ANKFKTIVGKDAFIGCNTNLIAPVT
GLMU_STAES      KDGAKVSHLSYIGDAEIGERTNIGCGSITVNYDG-ANKFKTIVGKDAFIGCNTNLIAPVT
GLMU_STAEP      KDGAKVSHLSYIGDAEIGERTNIGCGSITVNYDG-ANKFKTIVGKDAFIGCNTNLIAPVT
GLMU_STAHJ      KDGAKVSHLSYIGDAEIGERTNIGCGSITVNYDG-VNKFKTVVGKDAFIGCNTNLVAPVT
GLMU_STAS1      KAGAKLPHLSYIGDAEIGERTNVGCGSITVNYDG-INKFKTVIGDDSFIGCNTNLVAPIT
GLMU_STRA1      GENTKAGHLTYIGNAEVGCDVNFGAGTITVNYDG-QNKFKTEIGSNVFIGSNSTLIAPLE
GLMU_STRA5      GENTKAGHLTYIGNAEVGCDVNFGAGTITVNYDG-QNKFKTEIGSNVFIGSNSTLIAPLE
GLMU_STRA3      GENTKAGHLTYIGNAEVGCDVNFGAGTITVNYDG-QNKFKTEIGSNVFIGSNSTLIAPLE
GLMU_STRT1      GENTKAGHLTYIGNAEVGSDVNFGAGTITVNYDG-QHKFKTQIANNAFIGSNSTLIAPLE
GLMU_STRT2      GENTKAGHLTYIGNAEVGSDVNFGAGTITVNYDG-QHKFKTQIANNAFIGSNSTLIAPLE
GLMU_STRPN      GENTKAGHLTYIGNCEVGSNVNFGAGTITVNYDG-KNKYKTVIGNNVFVGSNSTIIAPVE
GLMU_STRR6      GENTKAGHLTYIGNCEVGSNVNFGAGTITVNYDG-KNKYKTVIGDNVFVGSNSTIIAPVE
GLMU_STRMU      GKETKAGHLTYIGNAEVGHDVNFGAGTITVNYDG-QNKYKTIIGNHVFVGSNSTIIAPLT
GLMU_STRP1      GEKTKAGHLTYIGNAQVGSSVNVGAGTITVNYDG-QNKYETVIGDHAFIGSNSTLIAPLE
GLMU_STRPM      GEKTKAGHLTYIGNAQVGSSVNVGAGTITVNYDG-QNKYETVIGDHAFIGSNSTLIAPLE
GLMU_STRP6      GEKTKAGHLTYIGNAQVGSSVNVGAGTITVNYDG-QNKYETVIGDHAFIGSNSTLIAPLE
GLMU_STRP3      GEKTKAGHLTYIGNAQVGSSVNVGAGTITVNYDG-QNKYETVVGDHAFIGSNSTLIAPLE
GLMU_STRP8      GEKTKAGHLTYIGNAQVGSSVNVGAGTITVNYDG-QNKYETVIGDHAFIGSNSTLIAPLE
GLMU_STREC      GANTKAGHLTYLGNAEIGSEVNIGAGSITVNYDG-QRKYQTVIGDHAFIGSHSTLIAPVE
GLMU_LACLA      GKGTKAGHLTYIGNATVGEKVNFGAGTITANFDG-KNKFNTEIDDFAFIGSNSTIIAPLH
GLMU_CLOPE      GNNTKVSHLTYIGDAEVGERCNFGCGTVVVNYDG-KKKHKTIIGDDSFIGCNTNLVSPVE
GLMU_CLOTE      GNNTKVSHLTYIGDAEVGERCNFGCGTVVVNYDG-KEKHKTIVGDDVFIGCNANLVSPVE
GLMU_CLOAB      GNNTKVSHLTYIGDAEVGEGCNFGCGTVVVNYDG-KDKHKTVIGNKSFIGCNTNLVSPVT
GLMU_CALS4      DEGSKVPHLTYVGDAELGKNVNMGCGSITVNYDG-KQKHKTIIGDNVFVGCNVNLVAPVK
GLMU_CARHZ      GEGSKVPHLSYIGDAVVGKGVNIGAGTITCNYDG-KNKWETVIEDGAFIGSNTNLVAPIK
GLMU_SYMTH      GRGVKCHHHSYLGDATIGAGANIGAGTITANYNG-VEKFRTEIGSGAFIGTNVNLIAPIT
GLMU_NOSS1      GDRTNVAHLSYLGDATAGTQVNIGAGTITANYDG-VKKHRTKIGDRTKTGSNSVLVAPVT
GLMU_THEEB      GSDTKASHLSYLGDATLGDRVNIGAGTITANYDG-VRKHPTHIGSGTKTGANSVLVAPVT
GLMU_SYNP6      GDRTNVAHLSYLGDATLGQRVNVGAGTITANYDG-VSKHPTVIGDRSKTGANSVLVAPVT
GLMU_SYNY3      GAQSNVAHLSYLGDAMLGQRVNVGAGTITANYDG-VSKHATVIGSGTKTGANSVFVAPVQ
GLMU_GLOVI      GDHTNAAHLSYVGDASVGERVNFGAGTIVVNYDG-KHKHRTEIGDGVRTGANSCLVAPLK
GLMU_PROMA      SEDSKINHLSYIGDSEIGKDVNIGAGTITANYDG-TNKHKTIIGAHSKTGANSVLIAPIV
GLMU_PROMT      GEGTKINHLSYVGDSALGKNINIGAGTITANFDG-KNKHRTIIDDYSKTGANSVLVAPIK
GLMU_PROMM      GEGSKVNHLSYIGDAQLGRHVNVGAGTITANYDG-VRKHLTVVGDNSKTGANSVLVAPIV
GLMU_SYNPX      GAGSKINHLSYIGDASLGENVNVGAGTITANYDG-VRKHRTVIGDGSKTGANSVLVAPVT
GLMU_PROMP      DQEVKVNHLSYIGDSKVGKYTNIGAGTITANFDG-AKKYQTNIGKNSSIGANTVLIAPIN
GLMU_COREF      GRGSKVPHLTYVGDATIGEYSNIGASSVFVNYDG-VNKNHTTIGSHVRTGSDTMFIAPVT
GLMU_CORGL      GRGSKVPHLTYVGDATIGEESNIGASSVFVNYDG-ENKHHTTIGSHVRTGSDTMFIAPVT
GLMU_CORDI      GRGSKVPHLTYIGDATVGEESNIGASSVFVNYDG-VNKHHTTIGSHVRTGSDTMFIAPVT
GLMU_CORJK      GRGSKVPHLTYVGDATIGEYSNIGASSVFVNYDG-VNKHHTTVGSHVRTGSDSMFIAPVV
GLMU_MYCBO      GTGTKVPHLTYVGDADIGEYSNIGASSVFVNYDG-TSKRRTTVGSHVRTGSDTMFVAPVT
GLMU_MYCTU      GTGTKVPHLTYVGDADIGEYSNIGASSVFVNYDG-TSKRRTTVGSHVRTGSDTMFVAPVT
GLMU_MYCPA      GTGTKVPHLTYVGDADIGEHSNIGASSVFVNYDG-ESKRRTTVGSHVRTGSDTMFVAPVT
GLMU_MYCLE      GTGAKVPHLTYVGDADIGEHSNIGASSVFVNYDG-TAKQRTTIGSHVRTGSDTKFVAPVT
GLMU_NOCFA      GAHSKVPHLTYVGDATIGEHSNIGASSVFVNYDG-VKKHHTVVGSHVRTGSDTMFVAPVT
GLMU_STRAW      GEGTKVPHLSYVGDATIGEYSNIGAASVFVNYDG-QDKHHTTVGSHCRTGSDNMFVAPVT
GLMU_STRCO      GEGTKVPHLSYMGDATVGDFTNIGAASVFVNYDG-QDKHHTTIGSHCRTGSDNMFVAPVT
GLMU_THEFY      GEGSKVPHLTYVGDADIGKGVNIGASSVFVNYDG-VNKHRTVIGDYARTGSDTMFVAPVR
GLMU_LEIXX      GAGAKLAHFNYVGDAEVGEKSNLGAGVITANYDG-VNKHRTEIGSHVRVATNTVFVAPVR
GLMU_BIFLO      GNGTKVPHLSYVGDAQLGDHTNIGGGTITANYDG-VHKNRTTIGSGCHVGAGNLFVAPVE
GLMU_BDEBA      GKKSKAGHLTYLGDAEIGEEVNVGCGTITCNYAADKKKYKTKIGNRVFVGSDTQFVAPIE
GLMU_FUSNN      EKGVKAGHLTYLGDAHIGEKTNIGAGTITCNYDG-KNKFKTEIGKDVFIGSDTMLVAPVN
GLMU_THEMA      GEGTKAQHLSYIGDAFVGKNVNVGAGTITCNYDG-KKKNPTFIEDGAFIGSNSSLVAPVR
GLMU_THET2      HKGVKAGHLAYLGDAEVGEGTNIGAGVITANYDG-KRKHKTEIGKKAFIGSNSVLVAPVR
GLMU_THET8      HKGVKAGHLAYLGDAEVGEGTNIGAGVITANYDG-KRKHKTEIGKKAFIGSNSVLVAPVR
GLMU_DEIRA      DAGVKAGHLAYLGDVEIGAETNVGAGTIVANFDG-LNKHQSKVGAGVFIGSNTTLIAPRV
GLMU_AQUAE      GKGVKAKHLAYIGDATVGENTNIGAGTVFANYDG-KRKYESYVGKSAFIGSNSLLIAPIR
GLMU_DESAG      RKGAKASHLTYLGDADIGSEANIGAGTITCNYDG-VNKHRTVIGEKAFIGSNTALVAPVS
GLMU_DESVH      HKGAKAGHLTYLGDADVGAGANIGAGTITCNYDG-KNKHRTVIGAGAFIGSNTALVAPVT
GLMU_AGRFC      GEGAKVNHLTYIGDAFVGAGSNIGAGAITCNYDG-YNKSETRIGANSFIGSNSSLVAPVT
GLMU_RHIME      GAGAKVNHLTYIGDAFVGAGSNIGAGTITCNYDG-VNKHVTRIGANAFVGSNSSLVAPVS
GLMU_BRUAB      GKGAKINHLAYIGDAVIGASSNIGAGTITCNYDG-YNKFKTIIGDNAFIGSNSSLVAPVE
GLMU_BRUME      GKGAKINHLAYIGDAVIGASSNIGAGTITCNYDG-YNKFKTIIGDNAFIGSNSSLVAPVE
GLMU_BRUSU      GKGAKINHLTYIGDAVIGASSNIGAGTITCNYDG-YNKFKTIIGDNAFIGSNSSLVAPVE
GLMU_RHILO      EEGAKVNHLTYIGDARVGAGANIGAGTITCNYDG-FSKFFTDIGEGAFVGSNSSLVAPVS
GLMU_BARHE      GKASKINHLSYIGDAEIGAQVNIGAGTITCNYDG-FHKHKIMIGDHAFIGSNSALVSPLM
GLMU_BARQU      GEASKINHLSYIGDAEIGAQTNIGAGTITCNYDG-FHKYKIVIGDHAFIGSNSALVSPLM
GLMU_BRADU      EAGVKVNHLSYIGDATVGANSNIGAGTITCNYDG-FKKHKTIIGQGAFVGTNSSLVAPVK
GLMU_NITWN      EAGAKVNHLTYIGDAHVGAKANIGAGTITCNYDG-FNKHRTEIGEGAFVGSNSSLVAPLR
GLMU_RHOPA      DAGAKVNHLTYIGDAHIGASANIGAGTITCNYDG-FDKHKTEIGAGAFIGSNSSLVAPVK
GLMU_CAUVC      GAGAKANHLSYLGDGSVGEKANIGAGTIFCNYDG-FEKFETHVGKGAFIGSNSALVAPVR
GLMU_CERS4      DEGVKVGHLTYLGDAHVGEHTNIGAGTVTCNYDG-VMKHRTEIGAHAFIGSDTMLVAPVT
GLMU_RUEPO      GEGAKVNHLTYIGDASIGAGSNIGAGTITCNYDG-VMKHRTTIGANVFIGSNTMLVAPVT
GLMU_GLUOX      GEGAKANHLTYLGDASIGSGTNVGAGTITCNYDG-VFKHRTTIGERVFVGSDSILVAPVT
GLMU_ZYMMO      EKGAKVNHLTYIGDATIGAGSNIGGGTITCNYDG-FNKSRTEIGEKAFIGSNSALVAPVR
GLMU_WOLPM      GQNTRIKHLSYIGNAKVGQESNIGAGTIVCNYDG-KNKHETNIGSNCFVGANSSLIAPLN
GLMU_WOLTR      GTNTKIKHLSYIGNTEVGRESNIGAGTVVCNYDG-KKKHRTNIGSNCFVGANSSLIAPLN
GLMU_ANAMM      GEMSKVKHLSYLGNSTIGKNTNVGAGTVICNYDG-RNKQHSDIGNNCFVGANSTIVSPIK
                    .  *  *.*:   .   *.. . :  *: .   *    :      .    :::*  

GLMU_ECOLI      VGKGATIAAGTTVTR--NVGENALAISRVPQTQKEGWRRPVKKK----------------
GLMU_ECO57      VGKGATIAAGTTVTR--NVGENALAISRVPQTQKEGWRRPVKKK----------------
GLMU_SHIFL      VGKGATIAAGTTVTR--NVGENALAISRVPQTQKEGWRRPVKKK----------------
GLMU_SHIDS      VGKGATIAAGTTVTR--NVGENALAISRVPQTQKEGWRRPVKKK----------------
GLMU_SHISS      VGKGATIAAGTTVTR--NVGENALAISRVPQTQKEGWRRPVKKK----------------
GLMU_SHIBS      VGKGATIAAGTTVTR--NVGENALAISRVPQTQKEGWRRPVKKK----------------
GLMU_ECOL6      VGKGATIAAGTTVTR--NVGENALAISRVPQTQKEGWRRPIKKK----------------
GLMU_SALPA      VGKGATIAAGTTVTR--NVADNELVLSRVPQVHKQGWQRPVKKK----------------
GLMU_SALTY      VGKGATIAAGTTVTR--NVADNELVLSRVPQVHKQGWQRPVKKK----------------
GLMU_SALCH      VGKGATIAAGTTVTR--NVADNELVLSRVPQVHKQGWQRPVKKK----------------
GLMU_SALTI      VGKGATIAAGTTVTR--NVADNELVLSRVPQVHKQGWQRPVKKK----------------
GLMU_YERPE      VANGATIGAGTTVTR--DVAENELVISRVKQVHIQGWKRPVKKK----------------
GLMU_YERPS      VANGATIGAGTTVTR--DVAENELVISRVKQVHIQGWKRPVKKK----------------
GLMU_PECAS      VASGATIGAGTTVTR--DVAENELVISRVKQRHISGWQRPVKKK----------------
GLMU_PHOLL      VAKGATIGAGTTVTK--NIAENELVVSRTKQTHIQGWKRPVKEKK---------------
GLMU_HAEIN      VANGATIGAGTTITR--DVGENELVITRVAQRHIQGWQRPIKKK----------------
GLMU_HAEI8      VANGATIGAGTTITR--DVGENELVITRVAQRHIQGWQRPIKKK----------------
GLMU_MANSM      VANGATIGAGTTVTK--DIGENELVISRVPQRHIAGWQRPTKKK----------------
GLMU_PASMU      IETGATIGAGTTVTK--DVACDELVISRVPQRHIQGWQRPTKQTKK--------------
GLMU_HAEDU      IADGATIGAGATITK--NIAENELVISRVPQRHIQGWQRPTKKK----------------
GLMU_VIBVU      IADGATIGAGTTLTK--DVAEGELVITRAKERKVTGWQRPVKKK----------------
GLMU_VIBVY      IADGATIGAGTTLTK--DVAEGELVITRAKERKITGWQRPVKKK----------------
GLMU_VIBPA      IADGATIGAGTTLTK--DVEEGELVITRVKERKITGWQRPVKQK----------------
GLMU_VIBCH      IGNGATIGAGTTLTK--NVAEGELVITRAPERKIAGWQRPAKKK----------------
GLMU_ALIF1      VANGATVGAGSTVTK--DVNENELYISRAKERRIANWQRPTKK-----------------
GLMU_PHOPR      IGKGATIGAGATINR--DIGEGELVITRAPARTIKGWKRPVKQK----------------
GLMU_COLP3      IGNSATVGAGSVISK--EVEDNDLALTRAKQRNIAGWQRPVKKS----------------
GLMU_PSET1      IGAMATIGAGSVITN--TVADEQLAIARGKQRNLDGWKRPVKK-----------------
GLMU_SHEON      IGKGATLGAGSTITR--DVGEDELVITRVKQKHLTGWQRPVKIKK---------------
GLMU_IDILO      IGKNATVGAGSVITR--AVADEELAVARGKQRNISGWQRPQSKKGT--------------
GLMU_PSESM      ILDGATTAAGSTITQ--NVPAEQLGVARARQRNIEGWKRPVKITKD--------------
GLMU_PSEU2      ILDGATTAAGSTITQ--NVPAEQLGVARARQRNIEGWKRPVKISKD--------------
GLMU_PSE14      IFDGATTAAGSTITQ--NVPTEQLGVARARQRNIEGWKRPVKIRKD--------------
GLMU_PSEPK      IKAGATTAAGSTITQ--AVEAGDLAVARARQRNISGWKRPEKIKKS--------------
GLMU_PSEF5      ISSGATTAAGSTITQ--DVAPAQLAVGRARQKNIDGWKRPEKIKKD--------------
GLMU_PSEPF      ISAGATTAAGSTITQ--NVENSQLAVGRARQKNIDGWKRPEKIKKN--------------
GLMU_PSEAE      IGDGATTAAGSTITH--EVPAKNLAFGRARQKNLENWKRPEKIKK---------------
GLMU_NEIGO      LGNKVTTGAGSAITR--NIEDNKLALARARQTVIEGWVRPEKNKQ---------------
GLMU_NEIG1      LGNKVTTGAGSTITR--NIEDNKLALARARQTVIEGWMRPEKDKQ---------------
GLMU_NEIMA      IGNKVTTGAGSTITR--NVEDGKLALARSRQTIIDGWVRPEKNKQ---------------
GLMU_NEIMB      LGNKVTTGAGSTITR--NVEDNKLALARARQTVIEGWVRPEKDKQ---------------
GLMU_CHRVO      LERDSTIGAGSVISK--DTPAGELTVARARQVTVPGWKRPQKKSG---------------
GLMU_AROAE      VGRGATLGAGTTLTK--DAPEDQLTVSRARQISIPGWKRPVKKKAGE-------------
GLMU_DECAR      VGRGATLGAGTTLTK--DAPPDALTFSRPRQMTLPGWERPKKVKK---------------
GLMU_BURMA      VGRGVTVAAGTTVWK--DVAADMLVLNDKTQTAKSGYVRPVKKKS---------------
GLMU_BURP1      VGRGVTVAAGTTVWK--DVAADMLVLNDKTQTAKSGYVRPVKKKS---------------
GLMU_BURPS      VGRGVTVAAGTTVWK--DVAADMLVLNDKTQTAKSGYVRPVKKKS---------------
GLMU_BURL3      VGRGVTIAAGTTIWK--DVADGLLALNEKTQTAKSGYVRPVKKKS---------------
GLMU_CUPPJ      VRRGATIGAGTTLTK--EAPADKLTLSRAKQMTLDAWQRPVKKAKQ--------------
GLMU_RALSO      VGRGATLGAGTTLTK--DAPEGQLTVSRARQTTVNGWQRPVKQKKDA-------------
GLMU_THIDA      VGQGATLGAGTTLTR--DAPPGELTLSRAKQQTISGWKRPIKPKKEG-------------
GLMU_BORBR      VGKGATLGAGTTLTK--DAPAGQLTISRARQSTIEGWKRPVKKS----------------
GLMU_BORPA      VGKGATLGAGTTLTK--DAPAGQLTISRARQSTIEGWKRPVKKS----------------
GLMU_BORPE      VGKGATLGAGTTLTK--DAPAGQLTISRARQSTIEGWKRPVKKS----------------
GLMU_NITEU      VARGSTIGAGSTITR--DTPEGQLTLSRTKQTSIANWKRPRKDRN---------------
GLMU_LEGPA      VGANATIGAGSTIRR--NVPPDELTLTESRQKTIYGWKRPVKRERD--------------
GLMU_LEGPH      VGANATIGAGSTIRR--NVPPDELTLTESRQKTIYGWKRPVKRERD--------------
GLMU_LEGPL      VGANATIGAGSTIRR--NVPPDELTLTESRQKTIYGWKRPAKRERD--------------
GLMU_COXBU      VGKNATIGAGSTLSQ--DAPPDQLTVARERQRTIKGWHRPTKKE----------------
GLMU_METCA      VGRNATIGAGSTITR--DTPEDCLTLSRARQLSVEGWKRPEKARKESCAE----------
GLMU_NITOC      IGAGATIGAGATITH--DVPPGELTLSRTPQKSWPGWKRPSKK-----------------
GLMU_XANAC      IGANSTIGAGSVITS--DAPAGQLSVTRARQTVVEGWKRPTKKSP---------------
GLMU_XANC5      IGANSTIGAGSVITS--DAPAGQLSVTRARQTVIEGWKRPTKK-----------------
GLMU_XANOR      IGANSTIGAGSVVTR--DAPAGQLTVTRARQTVIEGWERPTKK-----------------
GLMU_XANC8      IGTGATIGAGSVITR--DAPPHQLSVARPRQTVIEGWERPKKK-----------------
GLMU_XANCP      IGTGATIGAGSVITR--DAPPHQLSVARPRQTVIEGWERPKKK-----------------
GLMU_XYLFA      VGAGATLGAGTVLTH--DAPAHQLTVARSRQTTLDSWQRPKKKT----------------
GLMU_XYLFT      VGAGATLGAGTVLTH--DAPAHQLTVARARQTTLDGWQRPKKKT----------------
GLMU_ACIAD      IGDGATVGAGSVITR--NVPENTLAFERAQQIEKANYQRPQKLKK---------------
GLMU_PSYA2      IGDTATIAAGSVITK--DVDASALAFGRARQTQKDNFQRPTKK-----------------
GLMU_FRATT      IGQGATVGAGSTIVK--DVPADNLAISRARQRHIDTWQRSVKKTDK--------------
GLMU_BUCAI      IAKNTTIAAGTTVTK--DVNTPCLVYNTKEQKYKKNWMRSKKIIKKN-------------
GLMU_BUCAP      ITKNATIAAGTTLTQ--DVNTPCLIYNNKEQKQKKNWKRPQKIIKKTDQ-----------
GLMU_BUCBP      IKKGTIIAAGTTVMK--NIHEPSLVYNEKKQIHKKL------------------------
GLMU_WIGBR      INSGAVVGAGTTVTK--NINRKDKIISRIRQFSILRKENNSK------------------
GLMU_BLOFL      IGKNAVIGAGTTVTQ--NVDKDDVIISRVRQFSIVNDKVDKNKKN---------------
GLMU_BLOPB      IGKNVTIGAGTTVTR--DVAANETIISRIRQFSILNWKRLKNKK----------------
GLMU_CAMJE      IEDEVIIAAGSTVSI--NVEKGALFINRAGHKMIKDYYYKKFQK----------------
GLMU_CAMJR      IEDEVIIAAGSTVSV--NVEKGALFINRAGHKMIKDYYYKKFQK----------------
GLMU_HELHP      IESNVLIGAGSTITK--DIEYGDLALSRVAQQNIKDGFFKFFSDKNEEKKEQ--------
GLMU_WOLSU      IEDDSIIGAGSTITK--NVKSGELALSRAKQENIAGFFARYFSSSK--------------
GLMU_HELPJ      IGSNVLIGSGTTITK--DIPSGSLSLSRTPQTNIENGYFKFFKKP---------------
GLMU_HELPY      IGSNVLIGSGTTITK--DIPSGSLSLSRAPQTNIENGYFKFFKKP---------------
GLMU_GEOSL      IGSNTLIAAGTTVTR--DVPADSLAIARTPQINKEGWKLRKRDQ----------------
GLMU_PELCD      IGRNSLIGAGSTITK--DVPPNALALSRSQQRVVADWRLRHDPKCKNKD-----------
GLMU_BACSU      VGEGAYVAAGSTVTE--DVPGKALAIARARQVNKDDYVKNIHKK----------------
GLMU_BACLD      IGEGAYVAAGSTITD--DVPGRALSIARARQVNKEDYAENIHKK----------------
GLMU_BACAN      VEDGAYVAAGSTITE--NVPSKALSVARARQVNKEDYVDQLLNKKKS-------------
GLMU_BACC1      VEDGAYVAAGSTITE--NVPSKALSVARARQVNKEDYVDQLLNKKKS-------------
GLMU_BACHK      VEDGAYVAAGSTITE--NVPSKALSVARARQVNKEDYVDQLLNKKKS-------------
GLMU_BACCZ      VEDGAYVAAGSTITE--NVPSKALSVARARQVNKEDYVDQLLNKKKS-------------
GLMU_BACCR      VEDGAYVAAGSTITE--NVPSKALSVARARQVNKEDYVDQLLNKKKS-------------
GLMU_GEOKA      VGQGAYVAAGSTITD--DVPGRALAIARARQVNKEHYVDRLPGKKKS-------------
GLMU_ALKHC      IGKGALIAAGSTITE--DVPSDALSIARARQTNKEHYVTKKNN-----------------
GLMU_OCEIH      VGKGSYVAAGSTITK--NVPENALSIARARQTNKEEYASKFKK-----------------
GLMU_LISMF      VGDRAFIAAGSTITK--DVPDDALGIARAKQDNKLGYAKHLNHGK---------------
GLMU_LISMO      VGDRAFIAAGSTITK--DVPEDALGIARAKQDNKLGYAKHLNHSK---------------
GLMU_LISIN      VGDRAFIAAGSTITK--DVPEDALGIARAKQDNKLGYAKHLNHGK---------------
GLMU_BACSK      IGERAFVAAGSTITD--DVPSQALSIARSRQVNKDNYVKKDV------------------
GLMU_LACPL      VADHSFIAAGSTITD--DVNFHDMAIARARQTNKPDFWGRLPHEPENM------------
GLMU_LACSS      IADHTFIAAGSTITD--DVPEKAMAIARARQTNKENYWAKLPVAKDEEWQ----------
GLMU_ENTFA      IGDHAVTAAGSTITE--DVPSEDLAIARARQVNKEGYAKKLPYMKD--------------
GLMU_LACAC      VADHAFIAADSTITK--DVDKYDMAIARGRQVNKPDYWHKLPLSKNED------------
GLMU_LACJO      IADHAFVAADSTITK--DVEKYDMAIARGRQTNKPDYWHKLPLAKDKEWE----------
GLMU_STAAC      IGDDVLVAAGSTITD--DVPNDSLAVARARQTTKEGYRK---------------------
GLMU_STAAS      IGDDVLVAAGSTITD--DVPNDSLAVARARQTTKEGYRK---------------------
GLMU_STAAW      IGDDVLVAAGSTITD--DVPNDSLAVARARQTTKEGYRK---------------------
GLMU_STAAR      IGDDVLVAAGSTITD--DVPNDSLAVARARQTTKEGYRK---------------------
GLMU_STAAM      IGDDVLVAAGSTITD--DVPNDSLAVARARQTTKEGYRK---------------------
GLMU_STAAN      IGDDVLVAAGSTITD--DVPNDSLAVARARQTTKEGYRK---------------------
GLMU_STAEQ      VGNHTLIAAGSTITD--NIPEDSLALARARQVNKEGYLKK--------------------
GLMU_STAES      VGNHTLIAAGSTITD--NIPEDSLALARARQVNKEGYLKK--------------------
GLMU_STAEP      VGNHTLIAAGSTITD--NIPEDSLALARARQVNKEGYLKK--------------------
GLMU_STAHJ      VGDGVLIAAGSTITD--NVPNESLALARARQITKEGYLKK--------------------
GLMU_STAS1      LGNRSFIAAGSTITD--NVPEDSLALARARQTTKEGYLKK--------------------
GLMU_STRA1      IGDNALTAAGSTITD--NVPIDSIAIGRGRQVNKEGYANKKPHHPSQK------------
GLMU_STRA5      IGDNALTAAGSTITD--NVPIDSIAIGRGRQVNKEGYANKKPHHPSQK------------
GLMU_STRA3      IGDNALTAAGSTITD--NVPIDSIAIGRGRQVNKEGYANKKPHHPSQK------------
GLMU_STRT1      IGDNALTAAGSTITD--NVPADSVAIGRSRQVNKEGYAIKKPHHPSQQK-----------
GLMU_STRT2      IGDNALTAAGSTITD--NVPADSVAIGRSRQVNKEGYAIKKPHHPSQQK-----------
GLMU_STRPN      LGDNSLVGAGSTITK--DVPADAIAIGRGRQINKDEYATRLPHHPKNQ------------
GLMU_STRR6      LGDNSLVGAGSTITK--DVPADAIAIGRGRQINKDEYATRLPHHPKNQ------------
GLMU_STRMU      IGDNALTAAGSTIHK--DVPVDSIAIGRGRQVNKEGYAKKKPHHPNNK------------
GLMU_STRP1      VGDHALTAAGSTISK--TVPIDSIAIGRSRQVTKEGYAKRLAHHPSRSK-----------
GLMU_STRPM      VGDHALTAAGSTISK--TVPIDSIAIGRSRQVTKEGYAKRLAHHPSRSK-----------
GLMU_STRP6      IGDHALTAAGSTISK--TVPIDSIAIGRSRQVTKEGYAKRLAHHPSRSK-----------
GLMU_STRP3      IGDNALTAAGSTISK--TVPADSIVIGRSRQVTKEGYAKRLAHHPSRSK-----------
GLMU_STRP8      VGDNALTAAGSTISK--TVPADSIVIGRSRQVTKEGYAKRLAHHPSRSK-----------
GLMU_STREC      VGENALTAAGSTIAQ--SVPADSVAIGRSRQVVKEGYAKRLPHHPDQPQ-----------
GLMU_LACLA      IGKNALTAAGSVVTE--DVPDEAVEIGRGKQVNKLGRAKKMPHYRGQ-------------
GLMU_CLOPE      VKDNTYIAAGSTITK--EVPEGSLAIARAKQQNIEGWVERKKLK----------------
GLMU_CLOTE      VKDNSYIAAGSTITD--EVPRGALAIARSKQINKEDWVKKKDEK----------------
GLMU_CLOAB      VEDNTYIAAGSTITN--KVPEGSLAIARAKQVVKEGWVDKKGLLK---------------
GLMU_CALS4      IGNNAYIAAGSTITE--DVPEGALAIARSRQTNKEGWVEERIKKGRL-------------
GLMU_CARHZ      IGKNAVVGAGSTLTE--DVPEKALAIARSRQVNKEDYVK---------------------
GLMU_SYMTH      VGDGALIAAGSTVGPRLEIPADALVVERAQAVIKEGRAASLKEAWRQRKMNREGT-----
GLMU_NOSS1      LGDDVYVAAGSTVTE--DVPNDSLVIARTRQVIKLGWRRKSGES----------------
GLMU_THEEB      LGNNVTVAAGSTVTA--DVPDNALVIARCRQVVKPNWEPEA-------------------
GLMU_SYNP6      IGQDVTIAAGSTINK--DVPDGALAIARSRQTIHENWSTPTTEQ----------------
GLMU_SYNY3      VGEGVTVAAGSVINR--DVPAGSLAIARPRQRIIDNWQVPPAPQSGQP------------
GLMU_GLOVI      LGDGVTVAAGSTVTE--DVPCG-LVIARSRQVVKPDWKAPYERTEDG-------------
GLMU_PROMA      IGENVTIGAGSAISK--DVSDNSLAIARSKQSIKDNWSKKLKGT----------------
GLMU_PROMT      IGAHVTIGAGSTISK--DIPDKSLVVERSKAIIRTKAD----------------------
GLMU_PROMM      LGSDVTVGAGSTLTK--DVPNGALALGRSKQLIKNGWQ----------------------
GLMU_SYNPX      LGAKVTVGAGSTITK--DVPDGALAIGRAKQLSKEGWADRPA------------------
GLMU_PROMP      LGDSVTTGAGSVITE--DSKNNSLAIARSKQINIENWKKNKS------------------
GLMU_COREF      VGDGAYSGAGTVIKD--DVPPGALAVSGGRQRNIEGWVQKKRPGTAAADAAAAAQNSVPN
GLMU_CORGL      VGDGAYSGAGTVIKD--DVPPGALAVSGGRQRNIEGWVQKKRPGTAAAQAAEAAQN-VHN
GLMU_CORDI      VGDGAYSGAGTVIKE--DVPAGALVVSGGKQRNIEGWVEKNRPGTPAADAARQAHA-HET
GLMU_CORJK      VGDGAYSGAGTVIKE--DVPPGALVVSGGKQRNVEGWVAKKRPGTPAAEAGEAAAKRVAE
GLMU_MYCBO      IGDGAYTGAGTVVRE--DVPPGALAVSAGPQRNIENWVQRKRPGSPAAQASKRASEMACQ
GLMU_MYCTU      IGDGAYTGAGTVVRE--DVPPGALAVSAGPQRNIENWVQRKRPGSPAAQASKRASEMACQ
GLMU_MYCPA      VGDGAYTGAGTVVRE--DVPPGALAVSAGPQRNIEGWVRRKRPGSAAARAAEAAEKAAGG
GLMU_MYCLE      VGDGAYTGAGTVVRN--DVPPGALAVSVSPQRNIENWVQRKRPGSAAAQAAEKASTRTGK
GLMU_NOCFA      VGDGAYTAAGTVLRR--NVPPGALAVSGGPQKNIENWVQRHRPGTAAATAAAQALAADEK
GLMU_STRAW      VGDGAYTAAGSVITK--DVPPGSLAVARGQQRNIEGWVARKRPGSAAAKAAEVASRKPEG
GLMU_STRCO      VGDGAYTAAGSVITK--DVPPGSLAVARGQQRNIEGWVARKRPGSAAAKAAEAVSREADG
GLMU_THEFY      VGDGAYTGAGTVVRE--DVPPGALAVSAGPQRTIEGWVERKRPGTPAAQAAERARARSEE
GLMU_LEIXX      MGDGAYTGAGTVVRK--DVPAGSLAVTVAPQRNIEGWVAQRRPGTDAARAAQRNGAAEAS
GLMU_BIFLO      VGDNVTTGAGSVVRH--AVPSDTMVYSENTQHNVEGWKPAWER-----------------
GLMU_BDEBA      VGDDAIIGSGSTITK--NVPAKALAVARGKQFIKENYSAKTAETEEKEQV----------
GLMU_FUSNN      IGDNSLIGAGSVITK--DVPSDSLSVERSKQIIKEGWKK---------------------
GLMU_THEMA      IGKGALIGAGSVITE--DVPPYSLGLGRARQVVKEGWVLKKRKEE---------------
GLMU_THET2      VGDRALVGAGSVITQ--DVPEGALAVARERQKNLEGYALRKLGEG---------------
GLMU_THET8      VGDRALVGAGSVITQ--DVPEGALAVARERQKNLEGYALRKLGEG---------------
GLMU_DEIRA      VGDAAFIAGGSAIHD--DVPEGAMAVARGKQRNIEGWARRYWAAPERREKLAKKLPWLAG
GLMU_AQUAE      VGDWAYIAGGSVVNK--DIPEGALAVSRPELKIFEGRGKKKLQKD---------------
GLMU_DESAG      IGKQALVGAGSVITK--DVEDGELAIARGRQKNLRKTRHS--------------------
GLMU_DESVH      VGDGSLVGAGSVITK--DVPEASLAIARGRQTNLPRKPKA--------------------
GLMU_AGRFC      IGERAYIASGSVITD--DVPADALAFGRARQEVKPGRAVALRERAKAQKEAKKKSS----
GLMU_RHIME      IGDGALVASGSVITE--DVPADAVAFGRARQDVKPGRAPILRERYEAEKAARKRAKAAE-
GLMU_BRUAB      IGDNAYIASGSVITA--DVPADALALGRARQETKEGRAKILREKYAAIKAAKSVSK----
GLMU_BRUME      IGDNAYIASGSVITA--DVPADALALGRARQETKEGRAKILREKYAAIKAAKSVSK----
GLMU_BRUSU      IGDNAYIASGSVITA--DVPADALALGRARQETKEGRAKILREKYAAIKAAKSVSK----
GLMU_RHILO      IGKGGYIASGSVITE--SVPDDALAFGRARQKTIPGKGKELRERFASAAAAKKKAAGADH
GLMU_BARHE      IGDGSYIASGSVITE--DVPMNSIALGRARQVTKKDYAMKLRARLSANQQKK--------
GLMU_BARQU      IGNGSYIASGSVITE--DVPINSMAFGRARQVTKKDYAAKLRVRLSGNQQKK--------
GLMU_BRADU      IGNGAYIGSGSVITR--DVPDDAMALERNQQTIREGGAARYREMKTRGKKPEK-------
GLMU_NITWN      IGAGAYIGSGSVVTK--NVPDDALAVGRGQQTLREGWAKRFREMKLLARKQKTG------
GLMU_RHOPA      IGTGAYVGSGSVITK--DVPDGALAVERNVQTAKDGWAKRFRDAKSRHRKPKAH------
GLMU_CAUVC      VGDGAMTGSGSVITK--DVEDGALALSRADQTSKAGWATKFRAIKQAQKDKKKDKKA---
GLMU_CERS4      VGARAMTASGSVITE--NVPAEALALGRARQVTKPGMATRLMEMFRAAKAAKKKEAP---
GLMU_RUEPO      LGDGAMTATGTVVTR--DVEPDALAKARVKQENKPDRARKLFEMLRAKKASKQKET----
GLMU_GLUOX      VGDDALIAAGSVITS--DVPPGDLALGRARQTLKSGQGLQIKQSLKARKEQG--------
GLMU_ZYMMO      IGAGAIIAAGSTITH--NVPDDSLAIARSEQENKALWAKKFRQRKKKK------------
GLMU_WOLPM      IHDESVIAAGSVIVE--DVPEKSLAIAREKQVTKRIK-----------------------
GLMU_WOLTR      VHDESVIAAGSIIVK--DVPKKRLVITRRKQMVKKIK-----------------------
GLMU_ANAMM      VGDNAAIAAGSVITE--DLPPRSLGIARSRQTTKPEYKTRR-------------------
                :      . .: :                                               

GLMU_ECOLI      -------------
GLMU_ECO57      -------------
GLMU_SHIFL      -------------
GLMU_SHIDS      -------------
GLMU_SHISS      -------------
GLMU_SHIBS      -------------
GLMU_ECOL6      -------------
GLMU_SALPA      -------------
GLMU_SALTY      -------------
GLMU_SALCH      -------------
GLMU_SALTI      -------------
GLMU_YERPE      -------------
GLMU_YERPS      -------------
GLMU_PECAS      -------------
GLMU_PHOLL      -------------
GLMU_HAEIN      -------------
GLMU_HAEI8      -------------
GLMU_MANSM      -------------
GLMU_PASMU      -------------
GLMU_HAEDU      -------------
GLMU_VIBVU      -------------
GLMU_VIBVY      -------------
GLMU_VIBPA      -------------
GLMU_VIBCH      -------------
GLMU_ALIF1      -------------
GLMU_PHOPR      -------------
GLMU_COLP3      -------------
GLMU_PSET1      -------------
GLMU_SHEON      -------------
GLMU_IDILO      -------------
GLMU_PSESM      -------------
GLMU_PSEU2      -------------
GLMU_PSE14      -------------
GLMU_PSEPK      -------------
GLMU_PSEF5      -------------
GLMU_PSEPF      -------------
GLMU_PSEAE      -------------
GLMU_NEIGO      -------------
GLMU_NEIG1      -------------
GLMU_NEIMA      -------------
GLMU_NEIMB      -------------
GLMU_CHRVO      -------------
GLMU_AROAE      -------------
GLMU_DECAR      -------------
GLMU_BURMA      -------------
GLMU_BURP1      -------------
GLMU_BURPS      -------------
GLMU_BURL3      -------------
GLMU_CUPPJ      -------------
GLMU_RALSO      -------------
GLMU_THIDA      -------------
GLMU_BORBR      -------------
GLMU_BORPA      -------------
GLMU_BORPE      -------------
GLMU_NITEU      -------------
GLMU_LEGPA      -------------
GLMU_LEGPH      -------------
GLMU_LEGPL      -------------
GLMU_COXBU      -------------
GLMU_METCA      -------------
GLMU_NITOC      -------------
GLMU_XANAC      -------------
GLMU_XANC5      -------------
GLMU_XANOR      -------------
GLMU_XANC8      -------------
GLMU_XANCP      -------------
GLMU_XYLFA      -------------
GLMU_XYLFT      -------------
GLMU_ACIAD      -------------
GLMU_PSYA2      -------------
GLMU_FRATT      -------------
GLMU_BUCAI      -------------
GLMU_BUCAP      -------------
GLMU_BUCBP      -------------
GLMU_WIGBR      -------------
GLMU_BLOFL      -------------
GLMU_BLOPB      -------------
GLMU_CAMJE      -------------
GLMU_CAMJR      -------------
GLMU_HELHP      -------------
GLMU_WOLSU      -------------
GLMU_HELPJ      -------------
GLMU_HELPY      -------------
GLMU_GEOSL      -------------
GLMU_PELCD      -------------
GLMU_BACSU      -------------
GLMU_BACLD      -------------
GLMU_BACAN      -------------
GLMU_BACC1      -------------
GLMU_BACHK      -------------
GLMU_BACCZ      -------------
GLMU_BACCR      -------------
GLMU_GEOKA      -------------
GLMU_ALKHC      -------------
GLMU_OCEIH      -------------
GLMU_LISMF      -------------
GLMU_LISMO      -------------
GLMU_LISIN      -------------
GLMU_BACSK      -------------
GLMU_LACPL      -------------
GLMU_LACSS      -------------
GLMU_ENTFA      -------------
GLMU_LACAC      -------------
GLMU_LACJO      -------------
GLMU_STAAC      -------------
GLMU_STAAS      -------------
GLMU_STAAW      -------------
GLMU_STAAR      -------------
GLMU_STAAM      -------------
GLMU_STAAN      -------------
GLMU_STAEQ      -------------
GLMU_STAES      -------------
GLMU_STAEP      -------------
GLMU_STAHJ      -------------
GLMU_STAS1      -------------
GLMU_STRA1      -------------
GLMU_STRA5      -------------
GLMU_STRA3      -------------
GLMU_STRT1      -------------
GLMU_STRT2      -------------
GLMU_STRPN      -------------
GLMU_STRR6      -------------
GLMU_STRMU      -------------
GLMU_STRP1      -------------
GLMU_STRPM      -------------
GLMU_STRP6      -------------
GLMU_STRP3      -------------
GLMU_STRP8      -------------
GLMU_STREC      -------------
GLMU_LACLA      -------------
GLMU_CLOPE      -------------
GLMU_CLOTE      -------------
GLMU_CLOAB      -------------
GLMU_CALS4      -------------
GLMU_CARHZ      -------------
GLMU_SYMTH      -------------
GLMU_NOSS1      -------------
GLMU_THEEB      -------------
GLMU_SYNP6      -------------
GLMU_SYNY3      -------------
GLMU_GLOVI      -------------
GLMU_PROMA      -------------
GLMU_PROMT      -------------
GLMU_PROMM      -------------
GLMU_SYNPX      -------------
GLMU_PROMP      -------------
GLMU_COREF      QEG----------
GLMU_CORGL      QEG----------
GLMU_CORDI      KEG----------
GLMU_CORJK      GGSPTSTPQADQE
GLMU_MYCBO      QPTQPPDADQTP-
GLMU_MYCTU      QPTQPPDADQTP-
GLMU_MYCPA      RPAGEAE------
GLMU_MYCLE      QSQQKSEPD----
GLMU_NOCFA      SSQATEQKDGEQ-
GLMU_STRAW      ED-----------
GLMU_STRCO      ED-----------
GLMU_THEFY      DR-----------
GLMU_LEIXX      NAAEESGE-----
GLMU_BIFLO      -------------
GLMU_BDEBA      -------------
GLMU_FUSNN      -------------
GLMU_THEMA      -------------
GLMU_THET2      -------------
GLMU_THET8      -------------
GLMU_DEIRA      WLSRTQG------
GLMU_AQUAE      -------------
GLMU_DESAG      -------------
GLMU_DESVH      -------------
GLMU_AGRFC      -------------
GLMU_RHIME      -------------
GLMU_BRUAB      -------------
GLMU_BRUME      -------------
GLMU_BRUSU      -------------
GLMU_RHILO      -------------
GLMU_BARHE      -------------
GLMU_BARQU      -------------
GLMU_BRADU      -------------
GLMU_NITWN      -------------
GLMU_RHOPA      -------------
GLMU_CAUVC      -------------
GLMU_CERS4      -------------
GLMU_RUEPO      -------------
GLMU_GLUOX      -------------
GLMU_ZYMMO      -------------
GLMU_WOLPM      -------------
GLMU_WOLTR      -------------
GLMU_ANAMM      -------------