CLUSTAL format seed alignment for MF_01632

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

UBIC_BARHE       --------MSDPKDSILPPLKWLSD---QDPPVPTHIKDWLMEL-GSMTRRFENH-CTYI
UBIC_BARQU       -------MISDLRSSILPPLKWLSD---QDPPVPAGVSDWLMEL-GSMTRRFENH-CTCI
UBIC_BARBK       --------MFRTEDSILPPLEWLSD---NNSSVPPAIYDWLMEL-GSMTLRFERY-CTRV
UBIC_YERPE       --------MFIGDASILKPIQWCAT---EHPELPADIADWLMEL-GSMTRRFEQH-CQRV
UBIC_YERPS       --------MFIGDASILKPIQWCAT---EHPELPADIADWLMEL-GSMTRRFEQH-CQRV
UBIC_YERE8       --------MSTSDASIIKPIQWCAI---EPPNLPAAIADWLMEL-GSMTRRFELH-CQQV
UBIC_PHOLL       --------MSTDSILTTVPIQWLSV---DSPVLPDEVLDWLMEL-GSMTRRFEQY-CNSV
UBIC_PECAS       --------MSDDASTLLRTISWFTE---PPSVLPEHIGDWLMET-SSMTQRLEKY-CAQL
UBIC_ECOK1       --------MSHPALTQLRALRYFT----EIPALEPQLLDWLLLE-DSMTKRFEQQ-GKTV
UBIC_ECOL6       --------MSHPALTQLRALRYFT----EIPALEPQLLDWLLLE-DSMTKRFEQQ-GKTV
UBIC_SHIDS       --------MSHPALTQLRALRYFK----EIPALEPQLLDWLLLE-DSMTKRFEQQ-GKTV
UBIC_ECOLI       --------MSHPALTQLRALRYCK----EIPALDPQLLDWLLLE-DSMTKRFEQQ-GKTV
UBIC_ECO57       --------MSHPALTQLRALRYCK----EIPALEPQLLDWLLLE-DSMTKRFEQQ-GKTV
UBIC_SHIBS       --------MSHPALTQLRALRYFK----EIPALDPQLLDWLLLE-DSMTKRFEQQ-GKTV
UBIC_SHIFL       --------MSHPALTQLRALRYFK----EIPALDPQLLDWLLLE-DSMTKRFEQQ-GKTV
UBIC_SHIF8       --------MSHPALTQLRALRYFK----EIPALDPQLLDWLLLE-DSMTKRFEQQ-GKTV
UBIC_SHISS       --------MSHPALTQLRALRYFK----EIPALDSQLLDWLLLE-DSMTKRFEQQ-GKTV
UBIC_SALPA       --------MSHPALTQLRALRYFD----AIPALEPHLLDWLLLE-DSMTKRFEQQ-GKRV
UBIC_SALTY       --------MSHPALTQLRALRYFD----AIPALEPHLLDWLLLE-DSMTKRFEQQ-GKRV
UBIC_SALTI       --------MSHPALTQLRALRYFD----AIPALEPHLLDWLLLE-DSVTKRFEQQ-GKRV
UBIC_SALCH       --------MSHPALTRLRALRYFD----AIPALEPHLLDWLLLE-DSMTKRFEQQ-GKRV
UBIC_SODGM       -------MQDQAIVAILDGIRWLQE---PPVWPDDATRSWLTER-GSMTQRLEKH-CGKI
UBIC_VIBVU       -----MNQPNSLYLALLIEAKWQNPE--DFHFSSDFAKHWLLEQ-GSLSRRLARH-CQHL
UBIC_VIBVY       -----MNQPNSLYLALLIEAKWQNPE--DFHFSSDFAKHWLLEQ-GSLSRRLARH-CQHL
UBIC_VIBPA       -----MNQPTSLYLASLLEVEWQKPE--EFEFPNEFAKHWLEEQ-GSLSRRLKQH-CQEL
UBIC_VIBCH       -----MNQLTSLYLAALNRVTWQQPD--DIEFPAPLAQQWLLEQ-GSLSRRMATQ-CEHL
UBIC_ALIF1       -----MSDINSWCASVLKRVQWQEAD--TFECSNDLQRYWLLGL-DSLSRRLEQH-CNVL
UBIC_PHOPR       -----MSKFKQLYKPLLDNAQWETPL--SLAIEGTAFGHWLLEP-NSLSRRLQRH-CDEF
UBIC_COLP3       --MKQQIVNFPITFPITLSGQWQSPSAVSFSSLSTPLKDWLLDE-GSLTARLKKH-CDNF
UBIC_PSET1       ----------MITFPVSLSADWQ--CASLFSDLSSAEQEWLFEP-HSLTAKLKSR-SQCF
UBIC_PSYIN       --------MDITITPLASSTLWS--ADITPTTCSENLLDWLLDQ-NSLTRKLQAL-SADF
UBIC_SHEDO       ------MKVTSLSFPYGESIQWFS-PERADSIQNAQLKDWLLAT-GSLTLKLKNL-CNDF
UBIC_SHEFN       ------MNVTSISFPYGESIHWFS-PQKIDSLPHSQLKEWLLAT-GSLTQRLKTH-CKHF
UBIC_SHESA       ------MNVTSLSFPYGESIQWFC-ADNAKNLPSSPLKEWLLAP-GSLTQKLKGC-CDKF
UBIC_SHESR       ------MSVTSLSFPYGESIQWFC-ADNAKNLPSSPLKEWLLAP-GSLTQKLKGC-CDKF
UBIC_SHESM       ------MSVTSLSFPYGESIQWFC-ADNAKNLPSSPLKEWLLAP-GSLTQKLKGC-CDKF
UBIC_SHEON       ------MNVTSLSFPYGESIQWFC-ADNTKNLPASPLKEWLLAP-GSLTQKLKGC-CNEF
UBIC_SHESW       ------MNVTSLSFPYGESIQWFC-ADRTDKLPPSPLKEWLLAP-GSLTKKLKTC-CNQF
UBIC_SHELP       ------MSVTRLSFPYGESIQWHS-PDQIPQLPPSPFREWLLAS-GSLTQKLKSH-CNQF
UBIC_SHEAM       ------MSVTSLSFPYGESICWYS-PDELDRLPDGALADWLLAS-GSLTARLRAH-CSQF
UBIC_IDILO       ---MTTEFYATPAFPVSKALQWTP---PEQLELTPTQADWLLYE-GSLTERLKQI-GQQF
UBIC_ALKEH       -------------MYRNKEASWWPRRHPSRRRVPRGLEAWLDEP-GSLTARLRRSVPGGL
UBIC_HALHL       --------MREHAAWQPQAAAWRPGVAVVPGRPAPAVQRLLTER-GSLTARLER--LGPV
UBIC_AZOSB       -----------MQHPASGESWLAR---PPR-TAERRLRPWLTDP-ASLTARIRMR-CGMF
UBIC_AROAE       -----------MRIRPHSETWLKR---PPRPRVPARLRPWLTDP-GSLTARIRSR-CSLF
UBIC_THIDA       --------MIATRDDVCRQAGLQYGWLPHAFQAPRTLRGWLSDR-GSLTQRLRSR-YRDF
UBIC_NITEC       -----------MKANPP----LAWH--PVPVSAPVNLRWWLMHQ-ESLTRLLQAH-CEHF
UBIC_NITEU       -----------MKVNPP----LAWH--PAPVSAPVDLHWWLTHR-GSLTRLIQDR-CEHF
UBIC_CUPNH       -----------MSAQSARRCSWSPH-LAFDAAITPNLRRWVTGDDGSLTARLVAA-SERF
UBIC_CUPPJ       -----------MSAQYARRCGWTCH-LPFDPTIPPNLRHWVTGE-GSLTARLVAA-SERF
UBIC_RALSO       ---------MSGAAMSYPRSPWRGA-LPPMAVYGQHWARWAVGV-NSLTARLRAA-SSSF
UBIC_BURCH       ---------------MRFDGAQAGWRETPRPGCTLDQRDWLTRG-GSLTAHLARL--GRV
UBIC_BURL3       ---------------MRFDGGQAGWRETPRPGCTLDQRDWLTRG-GSLTAHLARL--GRV
UBIC_BURCM       -----------MSKRIRFDGAQAGWRATPRPGCTLDQRDWLTRG-GSLTAHLARL--GSV
UBIC2_BURP1      ---------------MRFDAADAHWRETPRPGASSAQKDWLTRG-GSLTAHLARL--GRV
UBIC_BURPS       ---------------MRFDAADAHWRETPRPGASSAQKDWLTRG-GSLTAHLARL--GRV
UBIC_BURMA       ---------------MRFDAADAHWRETPRPGASSAQKDWLTRG-GSLTAHLARL--GRV
UBIC_BURTA       ---------------MRFDAADAHWRETPRPGASGAQKDWLTRG-GSLTAHLARL--GRV
UBIC_XANAL       -------------------------MHPPSP-LNTQQKDWLTRG-GSLTAHLRLL--GQV
UBIC_BORA1       ------------MTTKYQAPLAAGWLIRAPSLLSPTQRHWLFRP-GALTAGLRQL--GKV
UBIC1_BURP1      ------------------MNTSSGWSRQPPASLSELEIHWLFAP-GSLTERLSAL--GEY
UBIC1_PSEPF      ------------------MDTSHYWSSRPLSELTGSEHHWLFLP-GALTPRLKAM--GDY
UBIC1_PSEE4      --------------------MDNLWTSLPLPGLSDDQRHWLFAP-GSLTLRLKAL--GRF
UBIC_MARHV       MPLKDCDQPPELSIPPTFWYRSLVAAGLYCPEVHGPARYWLTVE-GSFTRALQQKCQERF
UBIC_METCA       ------------------------------------MESWVFER-GSLTRRLKAACGADF
UBIC_COXBU       -MKKQLFWAPQNEIPSTLWTAN--------------ERSWLTHP-GSLTQRLRKTTDGQI
UBIC_PSEAB       ------------MPSNALWLRA----DQLSSV-SPTVLDWLFDE-GSLTRRLTALADGAF
UBIC_PSEAE       ------------MPSNALWLRA----DQLSSV-SPAVLDWLFDE-GSLTRRLTALADGAF
UBIC2_PSEE4      ------MPYETPQAAAVAWLPY----SQLATTLDQPTLDWLFDE-GSLTRRLTRLSHDHF
UBIC_PSEPK       ------MSYESPQAAAVAWLPY----SQLATDIDQPTLDWLFDE-GSLTRRLTRLSIDHF
UBIC_PSEF5       ------MPHSMPPAPAPIWLVQ----SRLSPFPGTAVANWLFDE-GSLTRRLTRLSHNAF
UBIC2_PSEPF      ----------MQHTNAPLWRPQ----SELTPLPDTSTLDWLFDE-GSLTRRLTHLSDDGF
UBIC_PSE14       ------MTQQSPAFISPIWLKR----EQLIDVPEPIMLDWLFNQ-DSLTRRLDRLSDGGF
UBIC_PSEU2       ------MTQQSPAFIGPAWLER----EQLIDAPDPVMLDWLFNQ-DSLTRRLDRLSDGRF
UBIC_PSESM       ------MTQHSPAFVTPDWLER----EQLTDTPTPVFFGWLFNQ-QSLTRRLDRLSDGGF
UBIC_PSEPU       -----MQVVYNFSQPGLQWKQS----DHLRSLMTVTSRDWLLDR-GSLTRRLRVLSDDDL
UBIC_ACIBT       -------------------MRKRQPVLKQEKTLNPELKTWLYAS-GSLTQQLTELGGGKF
UBIC_ACIAD       -------------------MQKIQSNQIQEQDLTPELKKWLYAS-GSLTQQLTDLADGLF
UBIC_PSYA2       --------------------MTSHLCCSNYSSPLPELLVCLHTE-GSLTALLEVKAGQPL
UBIC_PSYCK       --------------------MISHLSCITNSLPPTELLPWLNIE-GSLTALLEVKAGRPL
UBIC_AERS4       ----------MKSELTVPLIQLAPWRVPADCELPEALRPWLLEA-DSMTRRLRHH-NRHF
UBIC_PSEA6       ------MQKTISHAFPLGDVTWSN--QGRLSIPNAHLESWLLNT-GSLTQRLQTR-CNDF
UBIC_PASMU       ------------MSNYSQLLQNATWQPSTDMQLPLSISSWLELS-TSLTTQLKQA-FGEV
UBIC_HYDCU       -----MLKPSRTHLTLRHEPHWIPAGLIHRLKSPRQLHDWLLDS-SSLTAKIRIG-CPEM
                                                               :.:  :        

UBIC_BARHE       HIKPQRECFITRDKLKEEAAHLPKSTR-----YWLREVILMG-DNQPWLLGRTVIPQETL
UBIC_BARQU       RIEPQRECFITRDNLKEEAAHLPNSTC-----YWLREVILMG-DNQPWLLGRTVIPQETL
UBIC_BARBK       HVEPRHEYFIARNELKEEAEHLPESSL-----YWLREVVLMG-DNQPWLLGRTVIPQETL
UBIC_YERPE       HVEPQRECFITRDALGEEAEHLPVSQR-----YWLREIVLFG-DNVPWLLGRTVIPEETL
UBIC_YERPS       HVEPQRECFITRDALGEEAEHLPVSQR-----YWLREIVLFG-DNVPWLLGRTVIPEETL
UBIC_YERE8       HVEPQRECFISRDELGEEAEHLPISER-----YWLREIVLCG-DNQPWLLGRTVIPEGTL
UBIC_PHOLL       RIIPFRECFITEEQLSDENERLLTGQR-----YWLREIVLCG-DNIPWLLGRTLIPETTL
UBIC_PECAS       RVTLCREGFITPQMLGEERDQLPADER-----YWLREVVLYG-DDRPWLFGRTIVPQQTL
UBIC_ECOK1       SVTMIREGFVEQNEIPEELPLLPKESR-----YWLREILLCA-DGEPWLAGRTVVPVSTL
UBIC_ECOL6       SVTMIREGFVEQNEIPEELPLLPKESR-----YWLREILLCA-DGEPWLAGRTVVPVSTL
UBIC_SHIDS       SVTMIREGFVEQNEIPEELPLLPKESR-----YWLREILLCA-DGEPWLAGRTVVPVSTL
UBIC_ECOLI       SVTMIREGFVEQNEIPEELPLLPKESR-----YWLREILLCA-DGEPWLAGRTVVPVSTL
UBIC_ECO57       SVTMIREGFVEQNEIPEELPLLPKESR-----YWLREILLCA-DGEPWLAGRTVVPVSTL
UBIC_SHIBS       SVTMIREGFVEQNEIPEELPLLPKESR-----YWLREILLCA-DGEPWLAGRTVVPVSTL
UBIC_SHIFL       SVTMIREGFVEQNEIPEELPLLPKESR-----YWLREILLCA-DGEPWLAGRTVVPVSTL
UBIC_SHIF8       SVTMIREGFVEQNEIPEELPLLPKESR-----YWLREILLCA-DGEPWLAGRTVVPVSTL
UBIC_SHISS       SVTMIREGFVEQNEIPEELPLLPKESR-----YWLREILLCA-DGEPWLAGRTVVPVSTL
UBIC_SALPA       SVTLIREAFVGQSEVEEASGLLPSESR-----YWLREILLCA-DGEPWLAGRTVVPESTL
UBIC_SALTY       SVTLIREAFVGQSEVEEASGLLPSESR-----YWLREILLCA-DGEPWLAGRTVVPESTL
UBIC_SALTI       SVTLIREAFVGQSEVEEASGLLPSESR-----YWLREILLCA-DGEPWLAGRTVVPESTL
UBIC_SALCH       SVTLIREAFVGQSEVEEASGLLPSESR-----YWLREILLCA-DGEPWLAGRTVVPESTL
UBIC_SODGM       RVRRYREGFVTACIEAWEAALLPDCGR-----FWLREVVLYG-HDRPWLTARTLVPAAAE
UBIC_VIBVU       TVELMRNEKSGMGQLTRQETQGLSPEI-----CLIREVVLSG-DQTPWVLGRTLIPETTL
UBIC_VIBVY       TVELMRNEKSGVGQLTMQETQGLSPEI-----CLIREVVLSG-DQTPWVLGRTLIPETTL
UBIC_VIBPA       TVELLQNHIVTAKTLKSDESQLLSEQD-----CLLREVVLCG-DDCPWVVGRTLIPRTTL
UBIC_VIBCH       TVDLLSNQIMLADTLSYDETQLLASEE-----YLLRQVIIYG-DQQPWVFGHTLIPRSSM
UBIC_ALIF1       SVSVLDNTHVNPDKLTVEEEALLSGEV-----CLRRKVILKG-DQQSWVYGRTLIPLSSL
UBIC_PHOPR       TVSLIEQKKIDSTMLSADERELIGDVD-----CLLRKVVLMG-DGQPWVFARTLIPLSTL
UBIC_COLP3       QVKVIGEQQQ-PCSAAESCDLIKVGEP-----VLVREVILYC-DDVPQVFARSLLPIASL
UBIC_PSET1       SVKVLSEQEF-ELSAEQQQLLGCTQTT-----ALNREVLLLC-DNKPVVYAQSWLP-ASV
UBIC_PSYIN       KVKVRQQVTL-SHSKDLLSPYFSEENK-----VLVREVLLVC-DNKPVVFAQTEIPFSTL
UBIC_SHEDO       EVKVLGEQLT-SPLATD-TMIEET--------VWMREVLLCL-DGTPWVFARTLVPQSLL
UBIC_SHEFN       EVKVLGEHLL-EPLADEFPAQTNP--------VWIREVLLCL-DGTPWVFARTLIPQTIL
UBIC_SHESA       EVKILGEGQC-APLEGEYPKQNA---------VWVREVLLCL-DSVPWVFARTLIPQSLL
UBIC_SHESR       EVKILGEGQC-VPLEGEYPKQNA---------VWVREVLLCL-DSVPWVFARTLIPQSLL
UBIC_SHESM       EVKILGEGQC-VPLEGEYPKQNA---------VWVREVLLCL-DSVPWVFARTLIPQSLL
UBIC_SHEON       EVRILGEGQC-PPLDGEYPNQSA---------VWVREVLLCL-DDVPWVFARTLIPQSLL
UBIC_SHESW       EVKVLGEGQL-APFKDEYPQQGS---------VWVREVLLCL-DNVPWVFARTLIPLSLL
UBIC_SHELP       EVKVLGEAML-PPFPGELPHQGQ---------AWIREVLLCL-DGIPWVFARTLVPGAMM
UBIC_SHEAM       EVRVLGEAML-PGLPGE-PQLPH---------TWVREVLLIL-DGTPWVFARTLVPEALL
UBIC_IDILO       SVKLLGQQLL-APNTEEKQRLKGK-DQ-----AVIREVLLYC-NEKPWVFARSLFSPSAE
UBIC_ALKEH       EVTVLVERWGRPSIDEARAVELSDGRH-----ARIREVLLGS-RDQAWIYARTIMPPEAL
UBIC_HALHL       RVHVLREAWQRPAPDEGVALELPVGRH-----AWLREVVLDC-EGGPTIYARSIVP-DRL
UBIC_AZOSB       GVRVLRQSAGALTPDERRLLGLRAGER-----ALLREVLLIA-DGRPVVFARSVLAQREQ
UBIC_AROAE       SVNVLAQRLAVPHPDEAALLGLRRGEL-----AWLREVLLVA-DGVPVVFARSILPRHDV
UBIC_THIDA       RVLPVLRGVAAPFPDESGALGLARDAS-----AYVRDVLLLG-DGKARVFAHSVLPRAAL
UBIC_NITEC       RVEPVFQTLATACIDELEVMNLRRQNQ-----VLVREVYLRC-NETPVVFAHSIVKKEHL
UBIC_NITEU       RVEPIFQALATACIDELEVMNLRRQTR-----ALVREVYLRC-NETPVVFAHSIVRKEHL
UBIC_CUPNH       RVARLLQRPQRPLADEWQVLGQHDRTP-----ALTREVLLIC-DDIPAIFAHTVVRQRHA
UBIC_CUPPJ       RVRRLFQASARPFLDEWQVLGQCGREP-----ALTREVLLIC-DEQPAIYAHTVVRERHA
UBIC_RALSO       RVELLGQGRALPLRDEWRCLGLPRAAE-----TLAREVLLIC-DEAPVVYAHTIVHPRSV
UBIC_BURCH       NVRVTREAVDRPWFDEPDALASSPRAP-----MWVREVILSV-DGMPYVAAHSIAPLAAS
UBIC_BURL3       NVRVTREAVDCPWFDEPDAVASAPRAP-----MWVREVILSV-DGTPYVAAHSIAPLAAS
UBIC_BURCM       SVRVTREAVDCPWFDEPDALDSAPRAP-----MWVREVILSV-DGTPYVAAHSIAPLAAS
UBIC2_BURP1      TVRVTRETVAAPWADEHRALSCASRAP-----VWVREVVLAV-DGAPFVAAHSIAPLAAS
UBIC_BURPS       TVRVTRETVAAPWADEHRALSCASRAP-----VWVREVVLAV-DGAPFVAAHSIAPLAAS
UBIC_BURMA       TVRVTRETVAAPWADEHRALSCASRAP-----VWVREVVLAV-DGAPFVAAHSIAPLAAS
UBIC_BURTA       TVRVTREAVATPWADERGALACAPRAP-----VWVREVVLAV-DGTPFVAAHSIAPLAAS
UBIC_XANAL       QVQVQREHKAMAWLDEYRVLGLSRCLL-----VWVREVVLVV-DAKPYVYARSLTPLTAS
UBIC_BORA1       QLRVVSEHAEGASLDEARAMLIAPGSP-----VWVREVLMSV-DGIDSVPARSLTPLAAS
UBIC1_BURP1      SLEPVDQRHAAACAADASLLGVEPDSP-----IWVREVVMRL-DAQPCVTARSIASAHAL
UBIC1_PSEPF      SIEVVEQSHGPLNPEEAQALNVSPNTI-----GWVREVVMKL-DGEACVTARSLTSVPAL
UBIC1_PSEE4      SLEVTQQRIDFPEPGEAHALGCTTDSP-----AWIREVALKI-DDQVMVCARSLTPMRER
UBIC_MARHV       HVEILREGFSTPTPEEAKRLNLAPRQL-----AWVREVRLCG-DGRPWVLARTVIPQTCL
UBIC_METCA       NVRVIRQGFAHPFPDEALLLKLRSGRR-----ALVREVELRS-RERRLVLARSVLPAQTL
UBIC_COXBU       QHHLLREVFDAPVDEETQLLGISQPEL-----ALIREIEWRY-FESLWVAGRVVIPKKTL
UBIC_PSEAB       RVEPLLEGWQTLRDDECQGLDVPPGSS-----GWVREVYLHG-HDRPWVFARSVAARSAL
UBIC_PSEAE       RVEPLLEGWQTLRDDECQGLDVPTGSS-----GWVREVYLHG-HDRPWVFARSVAARSAL
UBIC2_PSEE4      SVTPLFEGWQPLRDDECAALGLAPGEE-----GWVREVYLRG-HDQPWVFARSVAGRSVL
UBIC_PSEPK       SVTPLFEGWQPLRDDECQALGIAAGAE-----GWVREVYLRG-HGQPWVFARSVASRSAL
UBIC_PSEF5       SVTPLVQEWQTLRNDECAALGLPEQSE-----GWVREVYLRG-HGQAWVFARSVAARSAL
UBIC2_PSEPF      SVTPLFEGWQTLRDDECAALDLAEGSE-----GWVREVYLRG-HGQAWVFARSVASRSAL
UBIC_PSE14       SVFPQFEGWQALRRDECLALGLPLASE-----GWVREVYLCG-NDSNWVFARSVAARSAL
UBIC_PSEU2       SVFPQFEGWQPLRPDECLALGLPEAGE-----GWVREVYLRG-NGNNWVFARSVAARSAL
UBIC_PSESM       DIVPLSEGWQALRDDECAALGLPAASE-----GWVREVYLRG-NGENWVFARSVAARDAL
UBIC_PSEPU       EVVPLREEVGVILPHEADVLGLQLGAI-----GGVREVYLVG-FGRPWVFARSIIVNSGS
UBIC_ACIBT       SVKPFKEHFQRLTFADSQWMNMPHTHT-----SWVRETYLYGSDVEPWVKAKSIFPIQSL
UBIC_ACIAD       TVEPIQEKYQRMSFMDSRWMRMPAYHV-----AWVRESLLYGCEQQPWVKAKSIFPVLSL
UBIC_PSYA2       RVERSFEGYRLLSLAQKKQLGMQGAALSRPRLAWVREVQLYGNDELPWVQAQSLFPLSSL
UBIC_PSYCK       LVERRFEGYRLLSLAQKKQLGIKGAALSHPRLAWVREVYLYGNDELPWVQAQSLFPLSSL
UBIC_AERS4       SVQLLGNRSVTLCADEQQLVAAEQPMG------LCREVILHG-DRGPAVLGWTLFAEAAL
UBIC_PSEA6       KVQLVSQRQELATPAEYIQLGVSKMSQQKEN-WQVREVILHG-DNQPWVFARSIIPQALC
UBIC_PASMU       NVCVLAESWITTLNENERQFFPKQACP-----CWCREVILKS-QDIPLIFARTLIPASLL
UBIC_HYDCU       DVRILSETYEKPLISEAHHLKIPLSQK-----TWIRCVFLMC-NGQPIVYARTVIPYWKT
                       .                            *            : .         

UBIC_BARHE       FEHN---------------EALINLGDVPLGRYLFSIDKLTRDYIHIGRKDT--------
UBIC_BARQU       FEHN---------------EALINLGTVPLGRYLFSSGNLTRDYIYIGRQGA--------
UBIC_BARBK       AHHS---------------NALMNLGTLPLGRYLFSNGELTRDYIHIGRKDS--------
UBIC_YERPE       SGPD---------------RALVDLGTLPLGRYLFSGDALTRDYIHVGRQDN--------
UBIC_YERPS       SGPD---------------RALVDLGTLPLGRYLFSGDALTRDYIHVGRQDN--------
UBIC_YERE8       SGPD---------------RALVDLGTLPLGRYLFGGNNLTRDYIQVGRQDE--------
UBIC_PHOLL       TGPD---------------ESLVDLGTVPLGRYLFSGNKLTRDYIHVGQQGN--------
UBIC_PECAS       EGSG---------------AALTKIGNQPLGRYLFEQKSLTRDYIHTGCCEG--------
UBIC_ECOK1       SGPE---------------LALQKLGKTPLGRYLFTSSTLTRDFIEIGRDAG--------
UBIC_ECOL6       SGPE---------------LALQKLGKTPLGRYLFTSSTLTRDFIEIGRDAG--------
UBIC_SHIDS       SGPE---------------LALQKLGKTPLGRYLFTSSTLTRDFIEIGRDAG--------
UBIC_ECOLI       SGPE---------------LALQKLGKTPLGRYLFTSSTLTRDFIEIGRDAG--------
UBIC_ECO57       SGPE---------------LALQKLGKTPLGRYLFTSSTLTRDFIEIGRDAG--------
UBIC_SHIBS       SGPE---------------LALQKLGKTPLGRYLFTSSTLTRDFIEIGRDAG--------
UBIC_SHIFL       SGPE---------------LALQKLGKTPLGRYLFTSSTLTRDFIEIGRDAG--------
UBIC_SHIF8       SGPE---------------LALQKLGKTPLGRYLFTSSTLTRDFIEIGRDAG--------
UBIC_SHISS       SGPE---------------LALQKLGKTPLGRYLFTSSTLTRDFIEIGRDAG--------
UBIC_SALPA       CGPE---------------QVLQHLGKTPLGRYLFTSSTLTRDFIEIGRDAT--------
UBIC_SALTY       CGPE---------------QVLQHLGKTPLGRYLFTSSTLTRDFIEIGRDAT--------
UBIC_SALTI       CGPE---------------QVLQHLGKTPLGRYLFTSSTLTRDFIEIGRDAT--------
UBIC_SALCH       CGPE---------------QVLQHLGKTPLGRYLFTSSTLTRDFIEIGRDAT--------
UBIC_SODGM       AGPA---------------QQVLSLGDVPLGQWLFRHRPPARDVIQFGRVGT--------
UBIC_VIBVU       ADQP---------------YDLATLGDIPLGLTVFSAEQVERDALQVAWIETP-------
UBIC_VIBVY       ADQP---------------YDLATLGDIPLGLTVFSAEQVERDALQVAWIETP-------
UBIC_VIBPA       VDQQ---------------YDLAQQGDIPLGLTVFSADNVERDSLQMGWVHLP-------
UBIC_VIBCH       HNQP---------------FDFTQQGKIPLGLTVFSADNVKRDALQVGWVETE-------
UBIC_ALIF1       QDQP---------------HDLTRQGHTPLGITVFSAQSAHRDKLQVGTIMTE-------
UBIC_PHOPR       TGQE---------------SDLEQLGEMPLGFRVFTDRSARRDALEVANTGTQ-------
UBIC_COLP3       TGEE---------------QILANLGEQPLGQVLFNNPSLQRLRLELSPFVNDSSVVALA
UBIC_PSET1       NAAN---------------NKLHNMGERPLGDVIFQDPQLTRTDIEIARFNTQHSLQQLV
UBIC_PSYIN       TDQQ---------------AKLAEIGTDSLGTFLFQDPSMRRDKIEVAQFPVYSAVHQLC
UBIC_SHEDO       DFKS---------------QAFTQLGNKPLGELLYTSPEIIPGKIELAKFDTCSRLAKLA
UBIC_SHEFN       GSQTPNYQNADDKQIREQQNDFTRLGTRPLGELLFSSPDITPGNIEVAQFETCGRLAALA
UBIC_SHESA       STRQ---------------ADFLGLGTRPLGELLFSQDSFVPGRIEIARFTTDSRLAQLA
UBIC_SHESR       STRQ---------------ADFLGLGTRPLGELLFSQDSFVPGRIEIARFTTDSRLAQLA
UBIC_SHESM       STRQ---------------ADFLGLGTRPLGELLFSQDSFVPGRIEIARFTTESRLAQLA
UBIC_SHEON       STRQ---------------ADFLGLGTRPLGELLFSQDSFVPGRIEIARFATNSRLAHLA
UBIC_SHESW       SERE---------------ADFLGLGSRPLGELLFSQDNFIPGRIEVASFDTGSRLAHLA
UBIC_SHELP       DSAQ---------------DNFLSLGTRPLGELLFTSGDFTPGKIEVGEFTACDSLAKLI
UBIC_SHEAM       TRCG---------------DELTALGDRPLGELLFSSNLFTPGRIEIAGFHSCGTLARLA
UBIC_IDILO       NANT---------------LNLQQLGNQSLGESLFARSDLYCGDIEVAKVALEHPVARLN
UBIC_ALKEH       AGDGR---------------RLARLGRTPLGGALFRGRTVARGPLSIARLGPRDPLAARV
UBIC_HALHL       LGPLA---------------RLPRLGERPLGRLLFSAADVQRGPLAVARLRGREPLVRWL
UBIC_AZOSB       RGGWLR--------------LWRGIGSRPLGAALFSDPRIRRQPLACARIGAADARYHLA
UBIC_AROAE       RGAWI---------------LFQGLGSRPLGAALFADPRIGRKPLACACLDRRDARYHRA
UBIC_THIDA       RGGWN---------------GIARLGTRPLGEALFRTPRVRRLAMTMRRVDARHPLYCAA
UBIC_NITEC       RGAWR---------------GLSRLGNRSLGTMLFTNPLIQRTPLAFKKLKPHHPLFERA
UBIC_NITEU       RGAWR---------------GLSRLGNQSLGTMLFTNPLIQRTPLAFKKLKPHHPLFERA
UBIC_CUPNH       RRDWP---------------FLRGLGERPLGGRLFVDPAVAREPFQFARLLPHHPLRQAL
UBIC_CUPPJ       RRDWP---------------FLRGLGERPLGGRLFVDPAVRRDPFQFARLLPHHPLRQAL
UBIC_RALSO       AADWP---------------FLRALGTQPLGHALFADPRVARGAFEFALLDGRHPLVKRA
UBIC_BURCH       KGVWQ---------------AMRRLRTRPLAELLYSDPQVERSALVSRRVIAGHPLYALA
UBIC_BURL3       KGVWQ---------------AMRRLRTRPLAELLYSDPQVERSALVSRRVIAGHPLYALA
UBIC_BURCM       KGGWQ---------------AMRRLRTRPLAELLYSDPQVERSALVSRRVIAGHPLYALA
UBIC2_BURP1      KGVWQ---------------AMRRLRTRPLAELLYSDPEVTRSALVSRRVLAGHPLFSLA
UBIC_BURPS       KGVWQ---------------AMRRLRTRPLAELLYSDPEVTRSALVSRRVLAGHPLFSLA
UBIC_BURMA       KGVWQ---------------AMRRLRTRPLAELLYSDPEVTRSALVSRRVLAGHPLFSLA
UBIC_BURTA       KGVWQ---------------AMRRLRTRPLAELLYSDPEVTRSALVSRRVIAGHPLFALA
UBIC_XANAL       YNAWQ---------------AVRSIGSRPLADLLFRDRSVLRSALASRRITAQHPLHRRA
UBIC_BORA1       HGSWQ---------------GMRRLLTRPLADMLYHDRGVTRSPFVCRRLSSPLPFYRMA
UBIC1_BURP1      ETQWK---------------PLTGYGSLPLGHILYDDPAIVRAPFECALLMPDDPLDAIS
UBIC1_PSEPF      NGDWA---------------DLNGYGRRPLAEILYTSEQTLREPFQCALLPPGAPLAALS
UBIC1_PSEE4      RPAWP---------------ELAGYGGEPLGSMLYNTPDIHRGAFECQRPQADDPLSRLA
UBIC_MARHV       HGHGR---------------RLRNLGNKPLGAYLFSSPEWQRGPLETGLCKAR-------
UBIC_METCA       KGAGR---------------RLAHLGNRPLGEILFASRRPRRHGFEAALAEDRHWRPAV-
UBIC_COXBU       EREGS---------------PLNHIGERSLGDILFANAKFTRGDLEFRQITADHPYYFY-
UBIC_PSEAB       EGSGF---------------DLALLGTRSLGELLFSDSAFERGPIEVCRYPAAGLP----
UBIC_PSEAE       EGSGF---------------DLALLGTRSLGELLFSDSAFERGPIEVCRYPAAGLP----
UBIC2_PSEE4      ERGGL---------------DLETLGTRSLGELLFCDQAFIRHPLEACRYPQTWLP----
UBIC_PSEPK       ERGGL---------------DLETLGSRSLGELLFCDQAFIRHPLEVCTYPQAWLP----
UBIC_PSEF5       LEGGL---------------NIDELGSRSLGELLFCDQAFTRQPIEVCRYPRHWLP----
UBIC2_PSEPF      QGDGL---------------HMDELGSRSLGELLFCDHAFQRRAIEVCHYPEHWLP----
UBIC_PSE14       QDGGL---------------NMDELGTRSLGELLFSDPAFARGTLEVCHYPEAWLP----
UBIC_PSEU2       QDGGL---------------DMDELGTRSLGELLFSDPAFVRGTLEVCHYPEAWLP----
UBIC_PSESM       QHGGL---------------HMDELGTRSLGALLFSDPAFDRGTLQVCHYPQSWLP----
UBIC_PSEPU       IEEGS---------------ALLQLGNMPLGDLLFGDGSFQRSEIEVCRYHDACNA----
UBIC_ACIBT       QKKAR---------------IFQHIGSKPIGLFLFQRTTPLCDRR-VIRLPEG-------
UBIC_ACIAD       QKKAR---------------IFKHIGKKPIGRFLFQRTTPLCERR-VIRLEEG-------
UBIC_PSYA2       QGSAR---------------RLQQLKSTPIGYVLFKRSRTLPNQRFIKHTVDG-------
UBIC_PSYCK       KGSAR---------------RLQQLKSTPIGYVLFNRSRTLPNQRSIKHTADG-------
UBIC_AERS4       QESG-----------------LRELGEQPLGERIFGDEPARRDHLQLACFEIASNPWC--
UBIC_PSEA6       EADFL------------------ELGDKPLGHLIFNDDRFKRQPFQLMCLQPDEAFLHEY
UBIC_PASMU       TQHSE----------------LQQLGNRALGEWLFMQSDRIRQKLELTHDKNTA------
UBIC_HYDCU       GNPWY---------------ALKHLGNRPLGEVLFQLPNLKRTPFQITQTHAQNWPHLDL
                                             .:.  ::                         

UBIC_BARHE       -----------------------LWARRSRLRLT-GKPLLLTELFLAASPLYTTNPI---
UBIC_BARQU       -----------------------LWARRSRLRLA-GKPLLLTELFLAASPLYTTNSI---
UBIC_BARBK       -----------------------LWARRSRLRLS-GKPLLLTELFLADSPLYTEDPS---
UBIC_YERPE       -----------------------LWARRSLLRLS-GNPLLLTEVFLPASPLYTHCDSIPK
UBIC_YERPS       -----------------------LWARRSLLRLS-GNPLLLTEVFLPASPLYTHCDSIPK
UBIC_YERE8       -----------------------LWARRSLLRLS-GKPLLLTEVFLPASPLYSI------
UBIC_PHOLL       -----------------------RWARRSLLRLS-GKPLLLTEVFLPESPVYKR------
UBIC_PECAS       -----------------------LWARRSRLCLS-GHPLLLTELFLPESPVYYTPGDEGW
UBIC_ECOK1       -----------------------LWGRRSRLRLS-GKPLLLTELFLPASPLY--------
UBIC_ECOL6       -----------------------LWGRRSRLRLS-GKPLLLTELFLPASPLY--------
UBIC_SHIDS       -----------------------LWGRRSRLRLS-GKPLLLTELFLPASPLY--------
UBIC_ECOLI       -----------------------LWGRRSRLRLS-GKPLLLTELFLPASPLY--------
UBIC_ECO57       -----------------------LWGRRSRLRLS-GKPLLLTELFLPASPLY--------
UBIC_SHIBS       -----------------------LWGRRSRLRLS-GKPLLLTELFLPASPLY--------
UBIC_SHIFL       -----------------------LWGRRSRLRLS-GKPLLLTELFLPASPLY--------
UBIC_SHIF8       -----------------------LWGRRSRLRLS-GKPLLLTELFLPASPLY--------
UBIC_SHISS       -----------------------LWGRRSRLRLS-GKPLLLTELFLPASPLY--------
UBIC_SALPA       -----------------------LWGRRSRLRLS-GKPLLLTELFLPASPLY--------
UBIC_SALTY       -----------------------LWGRRSRLRLS-GKPLLLTELFLPASPLY--------
UBIC_SALTI       -----------------------LWGRRSRLRLS-GKPLLLTELFLPASPLY--------
UBIC_SALCH       -----------------------LWGRRSRLRLS-GKPLLLTELFLPASPLY--------
UBIC_SODGM       -----------------------LWARRARLRLTEGQPLLLTEAFLPDCPLYISGGDAPQ
UBIC_VIBVU       --------------------QGRLLARRSRLWMN-HKPMLVAELFLPDAPIYSRESV---
UBIC_VIBVY       --------------------QGRLLARRSRLWMN-HKPMLVAELFLPDAPIYSRESV---
UBIC_VIBPA       --------------------QGRFLARRSRLWMN-HKPMLVAELFLSNSPIYAKERV---
UBIC_VIBCH       --------------------LGRLLARRSRLWMN-NKPMLVTELFLATSPIYSKERV---
UBIC_ALIF1       --------------------RGELFARRSRLWMN-NKPMLVAELFLPEAPIYSKEVES--
UBIC_PHOPR       --------------------AQPLWARRSRLWIN-NKPLLVAELFLAQAPVYSKEKQC--
UBIC_COLP3       AKLTAQHASNSPLVKASVIPKQELWGRRSIFMLE-NKPLMVAEVFLPDAFAYQ-------
UBIC_PSET1       AQLK--------------LPSQSLLGRRSLFSLK-DYKFLVCEVFLPGAYLY--------
UBIC_PSYIN       IDLNQ-------------EVDFPLWGRRSLFYVN-NKPLLVSEVFLPASGIYLP------
UBIC_SHEDO       TSLKQ-------------EISDPLWGRRRHFSID-TRHLTVSEIFLPAAVAHMKLHNK--
UBIC_SHEFN       TSLNQ-------------QVNSSLWGRRRYFNLH-GSQLIVSEIFLPAAVEYINQSI---
UBIC_SHESA       QSLAQ-------------NVEHELWGRRRYFHHD-EEEMFVSEMFLPAAVQAMARL----
UBIC_SHESR       QSLAQ-------------NVEHELWGRRRYFHHD-EEEMFVSEMFLPAAVQAMARLQP--
UBIC_SHESM       QSLAQ-------------NVEHELWGRRRYFHHD-QEEMFVSEMFLPAAVQAMAKLKLD-
UBIC_SHEON       QSLAQ-------------NVEHELWGRRRYFHHN-EEEMFVSEMFLPAAEQAIARLCP--
UBIC_SHESW       ASLDQ-------------RVEHLLWGRRRYFHHG-QDEMIVSEIFLPAAERAICQ-----
UBIC_SHELP       DSLEQ-------------ESHHPLWGRRRYFSHG-DQQLIVSEIFLPKARQLIDRLA---
UBIC_SHEAM       ESLGQ-------------NVHGRLWGRRRYFERE-GDELIVSEIFLPAAMDYILGPQ---
UBIC_IDILO       QQWFG--------------INQRLLSRRRIFSTG-GEQLLVSEVFLQPSPLYSSPNNRS-
UBIC_ALKEH       PGGG-----------------AGCWARRSRLWYG-NAGLLVTEVFLPPLLQSLED-----
UBIC_HALHL       RGHGL-------------PSPAGGWARRSTLSVA-GRRLLVTEVFFPEGVEGER------
UBIC_AZOSB       RRALA---------GAATLPPA-LWARRSVFRLH-GRSLLVSEFFLPAILGLPDDPL---
UBIC_AROAE       SAA-A---------APRRLPLA-LWARRSLFGLR-GRTLLVSEVFLPTILELPT------
UBIC_THIDA       RRH------------AEVAERA-LWARRSVFCLD-GHPLLVSEVFLPALLTP--------
UBIC_NITEC       CKQ------------LQMRPIN-LWARRSLFILL-RQPILVTEVFLPAIHQL--------
UBIC_NITEU       CKR------------LQNRPAD-LWARRSLFILQ-HQPILVTEVFLPAIRRL--------
UBIC_CUPNH       QRVLP---------AMAPLPM--LPARRSVFRRG-DGVMLVTEVFLPDLLSRPSPGTEAI
UBIC_CUPPJ       LRILP---------AMAPVPM--LPARRSVFRRG-AGVMLVTEVFLPDLLTRPSRG----
UBIC_RALSO       HAALG---------GTPPGAMARLPARRSVFRRG-VSAMLVTEVFLPALAVFDPPPMM--
UBIC_BURCH       SHALL---------GARA-PHA-FVARRSVFQRH-GKPLMVTECMLPALWRHLDAHGDGP
UBIC_BURL3       THALG---------GARA-PHS-FAARRSVFQRH-GKPLMVTECMLPALWRHLDAHGDGP
UBIC_BURCM       SHALQ---------GARA-PHA-FVARRSVFQRH-GTPLMVTECMLPALWRHLDAHGDGP
UBIC2_BURP1      SLALA---------RAYATEHA-FAARRSVFERR-GTPLMVTECMLPALWRHLDAHG-ER
UBIC_BURPS       SLALA---------RAYATEHA-FAARRSVFERR-GTPLMVTECMLPALWRHLDAHG-ER
UBIC_BURMA       SLALA---------RAYATEHA-FAARRSVFERR-GTPLMVTECMLPALWRHLDAHG-ER
UBIC_BURTA       SHALS---------PGHATPHA-FAARRSVFERR-GTPLMVTECMLPALWRHLDAHG-ER
UBIC_XANAL       CNFVA---------QSHA-TQA-LLARRSVFTRQ-GAPLLITECMLPALWATLEPVAAPR
UBIC_BORA1       LPPNH---------DGSA-----IWARRSVFWRH-GQPLLVAECFLPDFWRKVTLGRAIP
UBIC1_BURP1      RRYAR---------AAAP-----PRARRSAFVRN-GATLVVSECFLPQFWSGFAQARLAG
UBIC1_PSEPF      YRYAP---------QAER-----LLARRSRFTRN-GSALLVSECFLPAFWARVEYAQALK
UBIC1_PSEE4      TSLGQ---------PSGK-----LLARRSRFLRD-GQPLLIAECFVEGFWALLQERSAPL
UBIC_MARHV       ------------------SNGHPRLARRSLFHRG-SCALLVGEYLLPRLYQSPNRG----
UBIC_METCA       --------------RAGSGSAGPVWGRRSLYSIA-GRPLLVAEFFLPAVLSVPESA----
UBIC_COXBU       --------------VKEIANGSCIWARRSLFYFE-RDPLLVSEIFSPALFLESSVSND--
UBIC_PSEAB       ----------------AEVRAEGLWGRRSRFSRG-ALGVLVAEVFLPSLWDQAGIADV--
UBIC_PSEAE       ----------------AEVRAEGLWGRRSRFSRG-ALGVLVAEVYLPRLWDQAGIADV--
UBIC2_PSEE4      ----------------TKVAHEGLWGRRSRFERS-GLDLLVAEVFLPALWQAAKEETR--
UBIC_PSEPK       ----------------SEAAHAALWGRRSRFERN-GLDLLVAEVFLPALWQAAKEENR--
UBIC_PSEF5       ----------------AAVADNGLWGRRSRFDRG-PLSLLVAEIFLPSLWTAIDARPEAC
UBIC2_PSEPF      ----------------EGSRAAGLWGRRSRFDRG-ALSVLVAEIFLPTLWEAVRARPENC
UBIC_PSE14       ----------------DAVAARGLWARRSRFSRG-ALSVLVAEVFLPALCNTIHDKDPV-
UBIC_PSEU2       ----------------AADAARGLWARRSRFDRD-ALSVLVAEVFLPALCTAIHDKDHV-
UBIC_PSESM       ----------------DADAVSGLWARRSQFSRG-ALSVLVAEVFLPALWNAIHNKDHA-
UBIC_PSEPU       ----------------SARSTYPLWARRSVFKRE-KMHVLVQEMFLPALWEEMS------
UBIC_ACIBT       ------------------------WTRQSCYTWH-GCKFIVQETFLPAFEAFLYQQHDKE
UBIC_ACIAD       ------------------------WTRQSCYTWH-GCKFIVQETFLASFEQYI-QHHSHS
UBIC_PSYA2       ------------------------WQRQTLYNWY-GRPLLISETFLPQFCEKQLDI----
UBIC_PSYCK       ------------------------WQRQTLYDWH-GRSLLISETFLPRFCEKQLDI----
UBIC_AERS4       -------------------PAATVWGRRSRLFLG-QWPLLVHELFLPSLSCNKELE----
UBIC_PSEA6       GLPPL----------------TEIWGRRSVFCYQ-QYAMMVAELFLPKAPAYRDSNFDR-
UBIC_PASMU       -----------------------LYARRALMSIG-AENMMVAELFLTPQIFTRVVK----
UBIC_HYDCU       EDSKQ----------------IKTFARKSTFIQG-KYPLLLTEAFIESSL----------
                                           *:          . : *                 

UBIC_BARHE       --------------------------
UBIC_BARQU       --------------------------
UBIC_BARBK       --------------------------
UBIC_YERPE       --------------------------
UBIC_YERPS       --------------------------
UBIC_YERE8       --------------------------
UBIC_PHOLL       --------------------------
UBIC_PECAS       QVI-----------------------
UBIC_ECOK1       --------------------------
UBIC_ECOL6       --------------------------
UBIC_SHIDS       --------------------------
UBIC_ECOLI       --------------------------
UBIC_ECO57       --------------------------
UBIC_SHIBS       --------------------------
UBIC_SHIFL       --------------------------
UBIC_SHIF8       --------------------------
UBIC_SHISS       --------------------------
UBIC_SALPA       --------------------------
UBIC_SALTY       --------------------------
UBIC_SALTI       --------------------------
UBIC_SALCH       --------------------------
UBIC_SODGM       Q-------------------------
UBIC_VIBVU       --------------------------
UBIC_VIBVY       --------------------------
UBIC_VIBPA       --------------------------
UBIC_VIBCH       --------------------------
UBIC_ALIF1       --------------------------
UBIC_PHOPR       --------------------------
UBIC_COLP3       --------------------------
UBIC_PSET1       --------------------------
UBIC_PSYIN       --------------------------
UBIC_SHEDO       --------------------------
UBIC_SHEFN       --------------------------
UBIC_SHESA       --------------------------
UBIC_SHESR       --------------------------
UBIC_SHESM       --------------------------
UBIC_SHEON       --------------------------
UBIC_SHESW       --------------------------
UBIC_SHELP       --------------------------
UBIC_SHEAM       --------------------------
UBIC_IDILO       --------------------------
UBIC_ALKEH       --------------------------
UBIC_HALHL       --------------------------
UBIC_AZOSB       --------------------------
UBIC_AROAE       --------------------------
UBIC_THIDA       --------------------------
UBIC_NITEC       --------------------------
UBIC_NITEU       --------------------------
UBIC_CUPNH       PYPRYLRTTDRSPSTHTTETKKETTR
UBIC_CUPPJ       LGQRY---------------------
UBIC_RALSO       --------------------------
UBIC_BURCH       RSVGSHGGA-----------------
UBIC_BURL3       RSGGPGGGA-----------------
UBIC_BURCM       R-----GAA-----------------
UBIC2_BURP1      RARGLEQT------------------
UBIC_BURPS       RARGLEQT------------------
UBIC_BURMA       RARGLEQT------------------
UBIC_BURTA       RARDFEGA------------------
UBIC_XANAL       QASLSADGPCRHSAQIVSPESMLE--
UBIC_BORA1       PLKAHDRRA-----------------
UBIC1_BURP1      A-------------------------
UBIC1_PSEPF      SA------------------------
UBIC1_PSEE4      KLAI----------------------
UBIC_MARHV       --------------------------
UBIC_METCA       --------------------------
UBIC_COXBU       --------------------------
UBIC_PSEAB       --------------------------
UBIC_PSEAE       --------------------------
UBIC2_PSEE4      --------------------------
UBIC_PSEPK       --------------------------
UBIC_PSEF5       --------------------------
UBIC2_PSEPF      --------------------------
UBIC_PSE14       --------------------------
UBIC_PSEU2       --------------------------
UBIC_PSESM       --------------------------
UBIC_PSEPU       --------------------------
UBIC_ACIBT       LL------------------------
UBIC_ACIAD       I-------------------------
UBIC_PSYA2       --------------------------
UBIC_PSYCK       --------------------------
UBIC_AERS4       --------------------------
UBIC_PSEA6       --------------------------
UBIC_PASMU       --------------------------
UBIC_HYDCU       --------------------------