CLUSTAL format seed alignment for MF_01635

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

COQ2_HUMAN            ------------------------------------------MLGSRA-AGFARGLRALA
F6XCH9_MACMU          --MTPFSQVRMRKASVHAAAQPGRLGLHPADATAHARWGMTAMLGSRA-AGFARGLWSVA
H0WKB3_OTOGA          ------------------------------------------MLGWRS-ARGARGLRAVA
G1T0N6_RABIT          ------------------------------------------MLGLHG-AGIARSFLAGA
G3SN39_LOXAF          ------------------------------------------MLVCRG-AGLTRGLRALT
COQ2_BOVIN            ------------------------------------------MLGSCG-AGLVRGLRAET
E2QT06_CANLF          ------------------------------------------MLAARC-AALAGGLRVLA
G1LEF8_AILME          ------------------------------------------MLGARG-AALARGLRPDA
COQ2_MOUSE            ------------------------------------------MLRWGG-AGLARGLRAVR
COQ2_RAT              ------------------------------------------MLRLGG-AGLVRGLRVVS
G1KKG5_ANOCA          ------------------------------------------MAALRCLSRLRRPLRAQG
A3KNW5_DANRE          --------------------------------------------MMSSRLLTLR------
H3AS40_LATCH          ------------------------------------------MLRKVGAFVVQRSG----
W5MV33_LEPOC          ---------------------------------------------MNGAFHTQRH-----
G3PKM8_GASAC          --------------------------------------MFQAKLAPRLALEALRRTRHGA
A7RFI6_NEMVE          ---------------------------------------------------MLQLCTNSF
B3RWH5_TRIAD          ------------------------------------------------------------
COQ2_DROME            ---------------------------------------MYALRHLRLQSARHFRS----
COQ2_DROPS            ---------------------------------------MFAVRHL-LKSRKHFPY----
Q7Q9Z4_ANOGA          -------------MIGRSVWRGGVGSSITFFHGWPWSRHSHVVRPMYPKRTICFPL---S
W5J300_ANODA          -------------MIRRLVQRSTFVVARPIWPQKDNTVPALAVFDL-SRSAECLPAAIRT
COQ2_AEDAE            --------------MLRKLTSNSSRWTTTHLGSLWQEVGGHPIRRGLILHHHCRPLAAVS
E0W2B5_PEDHC          ------------------------MMKLNQKFLVSLTKIDHKVYHKYVYCKPENYFCKIH
COQ2_CAEEL            --------------------------------------------------MITRSIGIAR
COQ2_ARATH            --------------MAFFGLSRVS--RRLLKSSVSVTPSSSSALLQSQHKSLSNPVTTHY
F6HF43_VITVI          --------------MAAIWRSRHS--RKFLQSSPSLSSSLSPFFPLSNPNPIPKPNPNPT
B9H5T1_POPTR          --------------MSFLLRRSITGTTRFLSASRYVSTTSPNTYYISHCLLLSQN-----
M1C9U9_SOLTU          --------------MALYRRLSGN--RHVFRRHSIAALYSSGDLTNPSPNVLHSPLINPF
K3YSY7_SETIT          -----------MAPPALLRATAA-ELRRRGRRSPLPLPALSSLLSSPSPQSPASSC--PD
B6T4K7_MAIZE          --------------MALLRAAVS-ELRRRGRGALTPLPALSSLLSSLSPRSPASTR--PE
Q6ZAH2_ORYSJ          --------------MALLRAAAAADLLRRHRRA--PLPLLLSALSPPPPTTPESCPDGPS
I1IFN5_BRADI          -----------MASSALLRAAAA-ALRRRARTA--PLPLVTPLTHTPS-SSPDPTRF-PN
A0A804HRS2_MUSAM      --------------MALWLLRAA---RKRHRWA--PPADLSSLFPFSSPRQNPNKP-FTG
D6RMJ5_COPC7          ------------------------MLPFSRVPTSQLGLLRGSLASRYSCRATPHVLRRPW
D0MXD0_PHYIT          --------------MAARLLLTRAGRPRASLSALQLSFRPATRSGFSRFGASPSVALQPP
H9JR35_BOMMO          --------------------------------------MKYNAHGCTACRNACSRRYNVR
COQ2_YEAST            --------------------MFIWQRKSILLGRSILGSGRVTVAGIIGSSRKRYTSSSSS
Q751D7_ASHGO          ---------------------------------MLLSSGLCGLRSTGSGAGLRWGTAALS
C4R445_KOMPG          ---------------------MNNHSRYLLLGRHRLGLKWLAQKSVNQKFRLISSSTKKL
A0A1D8PU83_CANAL      --------------------------------------MLVFRRPVYQLFTRGFAYSRII
Q6C2S2_YARLI          ------------------MLALRLARVVRPTGASIRHLTWSHPARLYSSVDKVNLPKAPS
COQ2_SCHPO            --------------------MEMALLPQPSPARYFLRTPSWSAVAIFQAVKIKPLQLRTN
E3L3S4_PUCGT          ---MASEAWRKTCSIPLRTSSLVYRSTTKPNPAHLSKIPQHSNHTLGMLHRRLFQATVCS
UBIA_ECOLI            ------------------------------------------------------------
UBIA_SALCH            ------------------------------------------------------------
UBIA_SODGM            ------------------------------------------------------------
UBIA_YERPS            ------------------------------------------------------------
UBIA_PHOLL            ------------------------------------------------------------
UBIA_PROST            ------------------------------------------------------------
UBIA_PECAS            ------------------------------------------------------------
UBIA_HAES1            ------------------------------------------------------------
UBIA_PASMU            ------------------------------------------------------------
UBIA_HAEDU            ------------------------------------------------------------
UBIA_PHOPR            ------------------------------------------------------------
UBIA_ALIF1            ------------------------------------------------------------
UBIA_VIBPA            ------------------------------------------------------------
UBIA_VIBVY            ------------------------------------------------------------
UBIA_VIBCH            ------------------------------------------------------------
UBIA_PSEA6            ------------------------------------------------------------
UBIA_PSET1            ------------------------------------------------------------
UBIA_COLP3            ------------------------------------------------------------
UBIA_ACIAD            ------------------------------------------------------------
UBIA_PSYCK            ------------------------------------------------------------
UBIA_ALCBS            ------------------------------------------------------------
UBIA_IDILO            ------------------------------------------------------------
UBIA_PSEF5            ------------------------------------------------------------
UBIA_PSEPF            ------------------------------------------------------------
UBIA_PSEPK            ------------------------------------------------------------
UBIA_PSESM            ------------------------------------------------------------
UBIA_PSEAE            ------------------------------------------------------------
UBIA_CHRSD            ------------------------------------------------------------
UBIA_HAHCH            ------------------------------------------------------------
UBIA_SACD2            ------------------------------------------------------------
UBIA_METCA            ------------------------------------------------------------
UBIA_NITOC            ------------------------------------------------------------
UBIA_ALKEH            ------------------------------------------------------------
UBIA_XANCP            ------------------------------------------------------------
UBIA_XANOR            ------------------------------------------------------------
UBIA_XYLFT            ------------------------------------------------------------
UBIA_SHEDO            ------------------------------------------------------------
UBIA_SHEFN            ------------------------------------------------------------
UBIA_SHEON            ------------------------------------------------------------
UBIA_COXBU            ------------------------------------------------------------
UBIA_BLOFL            ------------------------------------------------------------
UBIA_BLOPB            ------------------------------------------------------------
UBIA_FRATO            ------------------------------------------------------------
UBIA_HYDCU            ------------------------------------------------------------
UBIA_AROAE            ------------------------------------------------------------
UBIA_DECAR            ------------------------------------------------------------
UBIA_THIDA            ------------------------------------------------------------
UBIA_NITEU            ------------------------------------------------------------
UBIA_NITMU            ------------------------------------------------------------
UBIA_METFK            ------------------------------------------------------------
UBIA_BURL3            ------------------------------------------------------------
UBIA_BURTA            ------------------------------------------------------------
UBIA_PARXL            ------------------------------------------------------------
UBIA_CUPMC            ------------------------------------------------------------
UBIA_CUPPJ            ------------------------------------------------------------
UBIA_RALSO            ------------------------------------------------------------
UBIA_POLSJ            ------------------------------------------------------------
UBIA_RHOFT            ------------------------------------------------------------
UBIA_NEIG1            ------------------------------------------------------------
UBIA_LEGPL            ------------------------------------------------------------
PLQA_SYNY3            ------------------------------------------------------------
Q8DLS6_THEVB          ------------------------------------------------------------
Q7NFU6_GLOVI          ------------------------------------------------------------
A5GMW7_SYNPW          ------------------------------------------------------------
Q7VDC5_PROMA          ------------------------------------------------------------
A3PBH9_PROM0          ------------------------------------------------------------
Q3YRN9_EHRCJ          ------------------------------------------------------------
S5PJB2_ANAPH          ------------------------------------------------------------
Q4UAZ7_THEAN          ------------------------------------------------------------
Q4MYN9_THEPA          ------------------------------------------------------------
A7AM23_BABBO          ------------------------------------------------------------
C6V5S7_NEORI          ------------------------------------------------------------
A8F2H7_RICM5          ------------------------------------------------------------
Q9ZCN7_RICPR          ------------------------------------------------------------
W7X633_TETTS          ------------------------------------------------------------
A0A2D7AM03_9PROT      ------------------------------------------------------------
Q383Z3_TRYB2          ------------------------------------------------------------
V5BFC2_TRYCR          ------------------------------------------------------------
Q4Q8D4_LEIMA          ------------------------------------------------------------
A4HGH9_LEIBR          ------------------------------------------------------------
COQ2_DICDI            MIKSILSLQNFKFIKPCTNSSILKYNNNNNTNNNNNNNGINKYNSTFNNNNSNFSNKNLF
D3BQE1_POLPP          MKRATTTLFN---VVPSSTSRLFTSNQS-----------------------FNFINHGVL
Q3IZ43_CERS4          ------------------------------------------------------------
Q9A2Y5_CAUVC          ------------------------------------------------------------
I1S1K6_GIBZE          ------------------------------------------------------------
M2UDD4_COCH5          ------------------------------------------------------------
C0NID8_AJECG          ---------------------------------------------------------MRI
A0A0D8JX01_COCIM      ---------------------------------------------------------MRS
Q1K4Y3_NEUCR          --------------------------------------------------------MSSH
G2WTU9_VERDV          ---------------------------------------------------------MSG
Q0USG0_PHANO          ------------------------------------------------------------
Q4WNJ5_ASPFU          -----------------------------------------------------MRLQFSY
D5GD53_TUBMM          ------------------------------------------------------------
                                                                                  

COQ2_HUMAN            LA--------------------------WLPGWRGRSFALARAAGAPHGGDLQPPACPEP
F6XCH9_MACMU          LA--------------------------SLPGWRGRSFALARATGAPHGGDLQPSACPGP
H0WKB3_OTOGA          QA--------------------------WLWGSPGRPPALTRAAGAPCPGNWQPPAWPEP
G1T0N6_RABIT          QA--------------------------WLRGSCSRPLALARAVGAPRAGDGQPASRPGA
G3SN39_LOXAF          RP--------------------------WPRGSGGRSLALVRAAGAPPTGDWWP------
COQ2_BOVIN            QA--------------------------WLWGTRGRSLALVHAARGLHAANWQPSPGQGP
E2QT06_CANLF          RP--------------------------WLRGFG--ALAQARAAGSLGVGHPRPSVGPEP
G1LEF8_AILME          ------------------------------------LMAAGLPRPGPGAWCGRAPRGALA
COQ2_MOUSE            SA--------------------------WLRGPRGLPLALVRSAGVPGARDRRAPAPGTQ
COQ2_RAT              PA--------------------------WLRGPGGLPLALARTTGTSGARDRRAPASGTQ
G1KKG5_ANOCA          -------------------------------GSLRFSPATLWILSDPNIGHGPFCPSKSR
A3KNW5_DANRE          -----------------------------PQICSARFAVLTRRHENITAAFCRPGSCFNT
H3AS40_LATCH          ----------------------------ARACCAGPFPCVSGESGPPGAWDRKSNTAMVE
W5MV33_LEPOC          ------------------------------------CQILQSEMHTLTSW----------
G3PKM8_GASAC          PH--------------------------HCRRSLSGLFLLAEGRRTGDASLRSDPSASAG
A7RFI6_NEMVE          QN--------------------------DKRHNCVSTTRLFHSSNPSRHRSQSVQQRP--
B3RWH5_TRIAD          ----------------------------------------MEQYNKPKSRTFTTK-----
COQ2_DROME            -----------------------------SYAAAATTKHMLPRQ--PARVLIGDWSTWDK
COQ2_DROPS            -----------------------------AYAAATTTKSTLPMPAVPARVLIGLHTDSDC
Q7Q9Z4_ANOGA          RN--------------------------ITLFPIRLPARPVAGRRFPYTTNLGHKLMLHP
W5J300_ANODA          RR--------------------------CVYTSSALPAWQLVASNTPTVAN-GARLKHAS
COQ2_AEDAE            SG--------------------------VILRQKEESRWSPNSGGKLANLRCWPEYRLHS
E0W2B5_PEDHC          RL--------------------------RSHLNGCAFYKLIPLVDDVRYYHATKDSFFKK
COQ2_CAEEL            RS--------------------------NSINCIVGSNTSTSYSLDESTKRWISTSTKQP
COQ2_ARATH            TNPFTKCYPSWNDNYQVWSKGRELHQE--KFFGVGWNYRLICGMSSSSSVLEGKPKKDDK
F6HF43_VITVI          SSPIKSFERTYFDYQFSRENLSCFSRENFKFGQCGSICRFGAGISTSSSGVAEK-DDEDR
B9H5T1_POPTR          -----------------------------QIPTFPSNLSFMREISTFSS-------SKDK
M1C9U9_SOLTU          QFSSSDDHNHTLNSR--------------KLLTFYSPHSSRIELSGFRQVLHFSTLANSE
K3YSY7_SETIT          PS-PLAYRRHLITLRRC----PRPASASAFATEFPYSRILLPSHFSPASPLSTSSSSS--
B6T4K7_MAIZE          PNNPHADRRHVIALRRC----PPLPASAVLAPELLHARGLLPRHWSHASPLSTSSSSS--
Q6ZAH2_ORYSJ          PVAPYFAPPPPPLCRRRRSWPPPPPPPRVSSSSYVGRGILLPATFSIYSPLSTSSSASPD
I1IFN5_BRADI          PD----ARRHLITLSRR-GCPHPPSTASAAASSYHYPAKVLLLPTTFPHPLSTSSQSTD-
A0A804HRS2_MUSAM      PR----ELGAPIPPRRH-----PRSWPPRPPTLLDGLPRSLSLASIYGASGSTPEDGGP-
D6RMJ5_COPC7          PT-------------------------TSVYKAFGVVR--LSSTTSTGIEPVKK------
D0MXD0_PHYIT          TR-------------------------CEAFASSGNQRSWLSTSPSPSLPHIKQSNEKDK
H9JR35_BOMMO          VH---------------------------STQSDHHRQKVVIETSQPKIVIDKLSEVLP-
COQ2_YEAST            SS-----------------------------SPSSKESAPVFTSKELEVARKERLDGLGP
Q751D7_ASHGO          SG-----------------------------AATRQ---AVFSAEQLAKAREDRQRALGP
C4R445_KOMPG          NT-----------------------------VVQET---PIFDADKLAAARQARLDGLG-
A0A1D8PU83_CANAL      RN-----------------------------EAKVP----KFSPVELEAARLAREAGLG-
Q6C2S2_YARLI          KEELKTPVPDELLEEVK-------VLENTPLEPVDPEKATIDLKTQFQAAREAELAAMTL
COQ2_SCHPO            SS-------------------------------------NSVTPNLISPSKKS-------
E3L3S4_PUCGT          IGHQPSANKSASLFRSL-------VPHRDSLRSSRPLKGWILRYQSNSACDHDAPNVPAV
UBIA_ECOLI            ------------------------------------------------------------
UBIA_SALCH            ------------------------------------------------------------
UBIA_SODGM            ------------------------------------------------------------
UBIA_YERPS            ------------------------------------------------------------
UBIA_PHOLL            ------------------------------------------------------------
UBIA_PROST            ------------------------------------------------------------
UBIA_PECAS            ------------------------------------------------------------
UBIA_HAES1            ------------------------------------------------------------
UBIA_PASMU            ------------------------------------------------------------
UBIA_HAEDU            ------------------------------------------------------------
UBIA_PHOPR            ------------------------------------------------------------
UBIA_ALIF1            ------------------------------------------------------------
UBIA_VIBPA            ------------------------------------------------------------
UBIA_VIBVY            ------------------------------------------------------------
UBIA_VIBCH            ------------------------------------------------------------
UBIA_PSEA6            ------------------------------------------------------------
UBIA_PSET1            ------------------------------------------------------------
UBIA_COLP3            ------------------------------------------------------------
UBIA_ACIAD            ------------------------------------------------------------
UBIA_PSYCK            ------------------------------------------------------------
UBIA_ALCBS            ------------------------------------------------------------
UBIA_IDILO            ------------------------------------------------------------
UBIA_PSEF5            ------------------------------------------------------------
UBIA_PSEPF            ------------------------------------------------------------
UBIA_PSEPK            ------------------------------------------------------------
UBIA_PSESM            ------------------------------------------------------------
UBIA_PSEAE            ------------------------------------------------------------
UBIA_CHRSD            ------------------------------------------------------------
UBIA_HAHCH            ------------------------------------------------------------
UBIA_SACD2            ------------------------------------------------------------
UBIA_METCA            ------------------------------------------------------------
UBIA_NITOC            ------------------------------------------------------------
UBIA_ALKEH            ------------------------------------------------------------
UBIA_XANCP            ------------------------------------------------------------
UBIA_XANOR            ------------------------------------------------------------
UBIA_XYLFT            ------------------------------------------------------------
UBIA_SHEDO            ------------------------------------------------------------
UBIA_SHEFN            ------------------------------------------------------------
UBIA_SHEON            ------------------------------------------------------------
UBIA_COXBU            ------------------------------------------------------------
UBIA_BLOFL            ------------------------------------------------------------
UBIA_BLOPB            ------------------------------------------------------------
UBIA_FRATO            ------------------------------------------------------------
UBIA_HYDCU            ------------------------------------------------------------
UBIA_AROAE            ------------------------------------------------------------
UBIA_DECAR            ------------------------------------------------------------
UBIA_THIDA            ------------------------------------------------------------
UBIA_NITEU            ------------------------------------------------------------
UBIA_NITMU            ------------------------------------------------------------
UBIA_METFK            ------------------------------------------------------------
UBIA_BURL3            ------------------------------------------------------------
UBIA_BURTA            ------------------------------------------------------------
UBIA_PARXL            ------------------------------------------------------------
UBIA_CUPMC            ------------------------------------------------------------
UBIA_CUPPJ            ------------------------------------------------------------
UBIA_RALSO            ------------------------------------------------------------
UBIA_POLSJ            ------------------------------------------------------------
UBIA_RHOFT            ------------------------------------------------------------
UBIA_NEIG1            ------------------------------------------------------------
UBIA_LEGPL            ------------------------------------------------------------
PLQA_SYNY3            ------------------------------------------------------------
Q8DLS6_THEVB          ------------------------------------------------------------
Q7NFU6_GLOVI          ------------------------------------------------------------
A5GMW7_SYNPW          ------------------------------------------------------------
Q7VDC5_PROMA          ------------------------------------------------------------
A3PBH9_PROM0          ------------------------------------------------------------
Q3YRN9_EHRCJ          ------------------------------------------------------------
S5PJB2_ANAPH          ------------------------------------------------------------
Q4UAZ7_THEAN          --------------MFGHRILFNISNVKYSLDSVVTYRSIAPKFSKNTFGYNFINQLYIT
Q4MYN9_THEPA          --------------MFSRRILFNVSNIKNSLESTVIYRSFVPKLSKDTFGYNFINKLYIT
A7AM23_BABBO          -------MYNVKSPGLTRRLLPTLSS--NFFEQHILHQRRFLYLYNPTRNHRHIWSLYMY
C6V5S7_NEORI          ------------------------------------------------------------
A8F2H7_RICM5          ---------------------------------------------------MIYNIHIYL
Q9ZCN7_RICPR          ------------------------------------------------------------
W7X633_TETTS          ---------------------------------MILSNLIKQQSFLLKKTANLPYQYSIN
A0A2D7AM03_9PROT      ------------------------------------------------------------
Q383Z3_TRYB2          ---------------------------------MLRRTIFLGRVTRSWTKGSIVKASAHF
V5BFC2_TRYCR          ---------------------------------MLRRAFFFRRITRSWTKGSITASMAHF
Q4Q8D4_LEIMA          ---------------------------------MFRRTPFWPKVTRSWTKSSISAATAHF
A4HGH9_LEIBR          ---------------------------------MFRRTPLYPKVTRSWTKASISAATAHF
COQ2_DICDI            SSKQYQQQSICNIPILSTISYHNKNNTNINTIINNNNSSNNNLINLNDKFNNLNNKTSPI
D3BQE1_POLPP          SS-SSSRTSIRSYSMINN-NNNNSNNNNTQSITIDLNINRSSSRSVNRLLNSKSCKSSSL
Q3IZ43_CERS4          ------------------------------------------------------------
Q9A2Y5_CAUVC          ------------------------------------------------------------
I1S1K6_GIBZE          ------------------------------------------------------------
M2UDD4_COCH5          ------------------------------------------------------------
C0NID8_AJECG          FSSVQFPLHLSSYKIKTRLCCGYYILPHHWLPPRASHCKSYKRVTNTTIDLITSRKYALL
A0A0D8JX01_COCIM      LTFVSPLLQPIS-----EIRYGYGFRRSLRCFSSASKLRGTHGMRRSFVLPVSSQ-----
Q1K4Y3_NEUCR          RLLTRLVPRQTFSHTTTRFFTKPSCSSPPCLGIRPSRQSKALTKPRLLSLEILHNYHTTK
G2WTU9_VERDV          RILVEFQELLKEPNLVKELNV-----------LKVPRFTRYLDSLKPQTSIVQRTPNCPP
Q0USG0_PHANO          -----------------------------------------------------MHTITRA
Q4WNJ5_ASPFU          LPPVRLDQLSRRYGSGSSLLNDKRHRLLCNRNSLTTSSRVNSTGRQSAYTAKPRSAITKR
D5GD53_TUBMM          -MAVRFPRLGMRSLSQAIYQI--------------NRTPSRLSPRNLTTVTRPSSILRHK
                                                                                  

COQ2_HUMAN            R----------------------------GRQLSLSAAAVVDSAPRPLQPYLRLMRLDKP
F6XCH9_MACMU          R----------------------------GRQLSLSAAAVVNSAPRPLQPYLRLMRLDKP
H0WKB3_OTOGA          R----------------------------RRPLSLSAAAVVDWAPRPLQPYLRLMRLDKP
G1T0N6_RABIT          P----------------------------GRRLSLSAAAVVNSAPRPLQPYLRLMRLDKP
G3SN39_LOXAF          --------------------------------LSLSAAAVVASAPRPLQPYLRLMRLDKP
COQ2_BOVIN            R----------------------------GRPLSLSAAAVVNSAPRPLQPYLRLMRLDKP
E2QT06_CANLF          R----------------------------RRRLGLSAAAVVNSAPRPLQPYLRLMRLDKP
G1LEF8_AILME          A----------------------------ICRAGTAQASAQPVGPRPLQPYLRLMRLDKP
COQ2_MOUSE            R----------------------------GRALSLSAAAVVNSAPRPLQPYLRLMRLDKP
COQ2_RAT              R----------------------------GRALSLSAAAVVNSAPRPLQPYLRLMRLDKP
G1KKG5_ANOCA          A----------------------------RPTGTLSAAALVRAAPGPIQPYLRLMRLDKP
A3KNW5_DANRE          SDEHK----------CRSRTPLVAGHCYGRRFFSLTPAGIVNAAPASVQPYLRLMRLDKP
H3AS40_LATCH          G----------------------------RRAFSLTAAGIVESTPKSMQPYLRLMRLDKP
W5MV33_LEPOC          -----------------------------RRQFSLSAAGIVNSAPVSVQPYLRLMRLDKP
G3PKM8_GASAC          GPRGH----------RVSRPSLGPR---GTRSISLSAATVVNSAPAPVQPYLRLMRLDKP
A7RFI6_NEMVE          ---------------------------------PITAAEFVDSSPKAIQPYLKLARIDRP
B3RWH5_TRIAD          ---------------------------------------IVQHFPNNFQPYLRLIRFDRP
COQ2_DROME            -------SRLQDVCSRSSS----------TATEPVKQQTPLQELVSAAKPYAQLMRIDRP
COQ2_DROPS            RNKRL--PQIQELSFRKMS----------SLPTSKKPGSLLEELYAATKPYAQLMRIDRP
Q7Q9Z4_ANOGA          REVESIPNNFSVLNVRSIASDNSDK----TRTTRLERK-EARTWQQQISPYARLMRIDRP
W5J300_ANODA          RCLQTIPKTVSTIGIRGVASDNSRKRHGRSTESNVERQSVASSWKQAISPYARLMRIDRP
COQ2_AEDAE            ATKR---RTLGELVLRDYSS---------NNISDKKPEPKSLLQSIVQNPYARLMRIDRP
E0W2B5_PEDHC          L-----------------------------TKSDSLPEFLVKNSSEKIKPYLKLMRLHQP
COQ2_CAEEL            M------------------------------SLIPTASSLVASSPPNLKPYLQLMRVDKP
COQ2_ARATH            E----------------------KSDG----VVVKEASWIDLYLPEEVRGYAKLARLDKP
F6HF43_VITVI          G----------------------RDDGGGERPKVQDLSWIDLYLPKQARPYARLARLDKP
B9H5T1_POPTR          K----------------------QQDG--ELSMGGKVSWVDVYLPRQVRPYAHLARIDKQ
M1C9U9_SOLTU          E----------------------KKKN-----EQQKPSWVDTYLPQKIRPYAHLARLDKP
K3YSY7_SETIT          ------------------------EPADKASPPPAPLTWVDKWIPEAARPYAMLARLDKP
B6T4K7_MAIZE          ------------------------RPADKAQ-----LTWVDKWIPEAARPYAMLARLDKP
Q6ZAH2_ORYSJ          GSPDE-----------------DSSPPHPSPAAAPPSSWVDRWLPQAARPYAMLARLDKP
I1IFN5_BRADI          ----K-----------------DNKEDNLPPPPPPPVSWVERLLPAAAHPYAMLARIDKP
A0A804HRS2_MUSAM      ------------------------RSPDGEAGTAAPPSWVDAYLPVSVRPYALLARLDKP
D6RMJ5_COPC7          -------------------------------------TWIDSLPPK-VRPYLYLTRIDKP
D0MXD0_PHYIT          SGVLQ---------------------PKEDAFRMEKDTWAERHAPEWMLPYIQIARINRP
H9JR35_BOMMO          ------------------------------------DSQRKQIWKDKVLPYVRLARWDRP
COQ2_YEAST            ---------------------------------------FVSRLPKKWIPYAELMRLEKP
Q751D7_ASHGO          ---------------------------------------YLSRLPARVVPYAELMRLEKP
C4R445_KOMPG          ---------------------------------------VIGKLPEKWIPYAELMRLEKP
A0A1D8PU83_CANAL      ---------------------------------------WLKHFPRKVIPYLELMRLEKP
Q6C2S2_YARLI          P------------------------------------ERFVYSLPKSMIPYARLMRMEKP
COQ2_SCHPO            ---------------------------------------WKDLFSKRWQYYAEISRAGSP
E3L3S4_PUCGT          KLKRI------------------------------EKEPKLNNLIKRIEPYLALSRVRAP
UBIA_ECOLI            --------------------------------------MEWSLTQNKLLAFHRLMRTDKP
UBIA_SALCH            --------------------------------------MEWSLTQSKLLAFHRLMRTDKP
UBIA_SODGM            --------------------------------------MDHSLTQDRWQAWCRLMRIDKP
UBIA_YERPS            --------------------------------------MKGSTVHTKWQAYCRLMRIDKP
UBIA_PHOLL            --------------------------------------MAGSMAQSKWLAYCRLMRINKP
UBIA_PROST            --------------------------------------MEGSMALSKWHAYSRLMRIDRP
UBIA_PECAS            --------------------------------------MERSVTAGKWLAYCRLMRIDKP
UBIA_HAES1            ---------------------------------------MTIFAKDKLIAYGQLMRLDKP
UBIA_PASMU            ----------------------------------------MPISKQKWIAYAQLMRFDKP
UBIA_HAEDU            ---------------------------------------------------MQLMRFDKP
UBIA_PHOPR            -----------------------------------------MLAMTKAKAFCQLARFDRP
UBIA_ALIF1            ------------------------------------------MNMSKAEAFWQLTRMNRP
UBIA_VIBPA            ------------------------------------------MSAEKAKAYWQLMRMDRP
UBIA_VIBVY            ------------------------------------------MSVEKAKAYWQLMRMDRP
UBIA_VIBCH            ------------------------------------------MTAVKARAYWQLMRMDRP
UBIA_PSEA6            ------------------------------------------MSRSVLQGFWLLMRADKP
UBIA_PSET1            -------------------------------------MKLARLTPSHIPYYIALMRIDKP
UBIA_COLP3            --------------------------------------MLKRIQQKWLAIKL-ITRMDKP
UBIA_ACIAD            --------------------------------------MQPISWRERLQAYYYLCRFDKP
UBIA_PSYCK            -----------------------------------------MTFNDKLQAYIQLTRFDKP
UBIA_ALCBS            ------------------------------------MFAFVEQRYPTLWPYIQLMRLDRP
UBIA_IDILO            --------------------------------------------MQKLVAFWQLMRADRP
UBIA_PSEF5            --------------------------------MYLSLLKSLNRLHPRAWDFLQLARMDKP
UBIA_PSEPF            --------------------------------MYQSLLKSLNRLNPRAWDFIQLTRMDKP
UBIA_PSEPK            --------------------------------MYLQLLKSLNRLHPRAWDFVQLSRMDRP
UBIA_PSESM            --------------------------------MYLSLLKSLNRLSPRAWDFVQLTRIDKP
UBIA_PSEAE            --------------------------------MFVTLIKPLARLHPRAWDFVQLVRLDRP
UBIA_CHRSD            -------------------------------MSADSSDAAHPSGLARVPDFLRLTRLDRP
UBIA_HAHCH            -----------------------------MKSQGRPLPSVAEQFKARLPVYIGLTRLNRP
UBIA_SACD2            ------------------------------MTATRKSTRPSKPLKATLVAYAKLMRLDRP
UBIA_METCA            -------------------------------------MNVPHSVKSRADAYWRLMRFDKP
UBIA_NITOC            -------------------------------------------MKQRLIIYAQLMRLDRP
UBIA_ALKEH            ------------------------------------MEMTADYLRDRAWQYAQLTRLNRP
UBIA_XANCP            ---------------------------MSKQGFKNVPMAPALTWPERLGQYWKLVRGDRP
UBIA_XANOR            ---------------------------MSKHDVERLPAACGLTCPQRLGQYWQLVRGDRP
UBIA_XYLFT            ---------------------------MAYERFTS-AITLLLHWRNRLDPYWKLARGDRP
UBIA_SHEDO            -----------------------------------MTAQTQQSIMAKLALYAQLSRIDRP
UBIA_SHEFN            -----------------------------------------MSLQDKLRAYARLMRIDRP
UBIA_SHEON            -----------------------------------------MNLKHKWDVYSRLTRLDRP
UBIA_COXBU            ----------------------------------------MINLRQQMPHYLRLMRFDKP
UBIA_BLOFL            -------------------------------------------MYKRCIGFIKLMRVHQP
UBIA_BLOPB            -------------------------------------MSNRLFFIKKCYNLAQLMRINQP
UBIA_FRATO            ------------------------------------------MNKQQLKAYFMLMRLHRP
UBIA_HYDCU            -----------------------------------------MIHKQQLQAYLQLTRIDRP
UBIA_AROAE            -------------------------------------MIAPATLSSRLPLYLRLMRLDKP
UBIA_DECAR            --------------------------------------MNWPALKERINLYEKLMRLDKP
UBIA_THIDA            -----------------------------------------MTLTERLSLYEKLARLDKP
UBIA_NITEU            -----------------------------------------MTFADRLSAYTRLIRLDKP
UBIA_NITMU            -----------------------------------------MTLTQRLVHYEKLMRLDKP
UBIA_METFK            --------------------------------------MKNPSLRQKLEAYYRLTRLDKP
UBIA_BURL3            -------------------------------------------MLARFPLYLRLVRMDKP
UBIA_BURTA            -------------------------------------------MLARFPLYLRLIRMDKP
UBIA_PARXL            -------------------------------------------MFARLPLYLRLVRMDKP
UBIA_CUPMC            ----------------------------------MSHPSTAPAHPSRLALYARLVRIDKP
UBIA_CUPPJ            -------------------------------------------MSERLALYARLVRIDKP
UBIA_RALSO            -------------------------------------MQSSTAHPSRLALYARLVRIDKP
UBIA_POLSJ            ------------------------------------------MLRRKLGLYLALIRWNRP
UBIA_RHOFT            --------------------------------MKSAPSRPRSPLQSRLALYLDLIRWNRP
UBIA_NEIG1            ---------------------------------MNLKSPLFLRLSDRLDVYIRLMRADKP
UBIA_LEGPL            --------------------------------------------MIPWNAYVRLLRLNKP
PLQA_SYNY3            -----------------------------------MVAQTP-SSPPLWLTIIYLLRWHKP
Q8DLS6_THEVB          -----------------------------------MNSQVSRTSVSTWVAIAQLLRWHKP
Q7NFU6_GLOVI          ------------------------------------MSTAPTDWRAKADAVFRLLRWDKP
A5GMW7_SYNPW          --------------------------------------MTGTLPSRLMSPWVALLRWNKP
Q7VDC5_PROMA          --------------------------------------MKSFLLTKKLLNIFHLLRWNKP
A3PBH9_PROM0          -------------------------------MKYTIDHMQNKNRQIKLSTFFELLRWNKP
Q3YRN9_EHRCJ          ------------------------------------MLCKLKDIVPNFDKYIELLGLHMV
S5PJB2_ANAPH          ------------------------------------MFSRVKKVFGALVPYSQLIRLHSC
Q4UAZ7_THEAN          TLKNDKINSNNKFSTDIINNTLNHSLLTIRYITINNSILKENGLYDKLISCGRLMRVHTL
Q4MYN9_THEPA          TLKNDKIISNNKSPTDIINNTLNHSLLTGRYITINNAVSKDNGLYDKIISCGRLMRVHTL
A7AM23_BABBO          GRSCPSTVSSSQPTKNVIPVVALRSMSVKSDCTPTNAD-RGRSINESITIYGNLMRLQNL
C6V5S7_NEORI          ---------------------------------------------MKIKKYASLIRFQSL
A8F2H7_RICM5          NLTFNMLILNKLLLTL------------------------------------KLMRADKL
Q9ZCN7_RICPR          -----MLMLNKLLIIF------------------------------------KLMRADKP
W7X633_TETTS          KNALHTYNIKKYFSSNQSQNQDQIQQEIQTTQTTPQLHWLEKNLPEKYLPYVRLGRYEKP
A0A2D7AM03_9PROT      -----MSNIKKFFLTS---------------------------------------RYNKP
Q383Z3_TRYB2          PDSVRADPAERRNEDSSPKESRTWSLHDGPCSEPLHVPKHIQWATQKVRVWGQLMRVDKA
V5BFC2_TRYCR          PDAVRADPAALRGVDCSAREKRQWTIDDVSRSNGRKVPKHIEWLTNRMRLWARLVRADRP
Q4Q8D4_LEIMA          PDAVRADPASSRTGSTSAKESRSWKLGDDTV-KAEALPKHLQLAVRKLQLYGDIVRFTRP
A4HGH9_LEIBR          PDAVLADPAASRSGTISAKEERSWRLDDNTV-KVEKLPKHFQFVVRKLQLYGNLVRFDRP
COQ2_DICDI            IFNKNYSTTVSTLLDDNNSNSNNNNNSNNNKPSTTFVNDWISKFPNSVQPYLRLSRVDKP
D3BQE1_POLPP          VIPCRFNTTSTPSAPKDQSIDDNDSNANS---LPIHTESWVDKAPARLQPYLRLSRLDKP
Q3IZ43_CERS4          -------MQQPRQAPEAPAGGPAAGTTQGTVADAPPGNWVDRLAPAATRPYLRLSRADRP
Q9A2Y5_CAUVC          -------MRRARRSQVKPRRMTAAQSPPGVLPDAAATNWVDRHAPQRLRPWLKLGRFDRP
I1S1K6_GIBZE          -MSATTTIALTARTSPSKGTRASKKKSLSKQYGGIHAGSWVDVLPKSWIPYVQLSRLSPP
M2UDD4_COCH5          ------MINIATKRAKGASSQESKD-YLSKQYGGVHSEGWVNRLPSSWIAYVQLSRLSPP
C0NID8_AJECG          PVRHITSSLRTLAPSSPLAPEPSPTPPLPNVTYSPPETGLISLLPRPWIPYAELIRLDKP
A0A0D8JX01_COCIM      PVLTSSVIFRRAVTS---ASPVNPASEQPIVKYTPPTRGLIASLPKSWIPYAELVRLDKP
Q1K4Y3_NEUCR          PLLSQPEIPTTPTSATL-PTSAVPSSDPPLPEYVPPTTGLLSRLPPSWVPYAELARLDKP
G2WTU9_VERDV          ALVSLTPARCATTAVTP-DSSPVPLAEP---VYTPPTTGILSVLPKSWVPYAELIRIDKP
Q0USG0_PHANO          ESAAIESIHFNITTANI-ASRAIT--------------------PAGIVPYAELMRIDKP
Q4WNJ5_ASPFU          TSLMRCQPHSSQSPSSTDRPAAITDNNP-ATHYIPPQKGFIASLPGSWIPYAELIRLDKP
D5GD53_TUBMM          PLPNVISRINTTTATTTPPTSQIPPE-----IYEPPKSGLLSHFPRKTIPYAELIRLDKP
                                                                                  

COQ2_HUMAN            IGTWLLYLPCTWSIGLAAEPGC----------FPD---WYMLSLFGTGAILMRGAGCTIN
F6XCH9_MACMU          IGTWLLYLPCTWSIGLAAEPGC----------FPD---WYMLSLFGTGAILMRGAGCTIN
H0WKB3_OTOGA          IGTWLLYLPCTWSIGLAAEPGC----------FPD---WYMLSLFGTGAVLMRGAGCTIN
G1T0N6_RABIT          IGTWLLYLPCTWSISLAAEPGC----------FPD---WYLLSLFGTGAVLMRGAGCTIN
G3SN39_LOXAF          IGTWLLYLPCTWSISLAAEPGC----------FPD---WYMLSLFGTGAVLMRGAGCTIN
COQ2_BOVIN            IGTWLLYLPCTWSIGLAADPGC----------LPD---WYMLSLFGTGAVLMRGAGCTIN
E2QT06_CANLF          IGTWLLYLPCTWSIGLAAEPGC----------FPD---WYMLSLFGTGAVLMRGAGCTIN
G1LEF8_AILME          IGTWLLYLPCTWSIGLAAEPGC----------FPD---WYMLSLFGTGAVLMRGAGCTIN
COQ2_MOUSE            IGTWLLYLPCTWSIGLAADPGC----------FPD---WYMLSLFGTGAILMRGAGCTIN
COQ2_RAT              IGTWLLYLPCTWSIGLAADPGC----------FPD---WYMLSLFGTGAILMRGAGCTIN
G1KKG5_ANOCA          IGTWLLYLPCTWSIALAAEPGC----------LPA---WDMLLLFGTGAVLMRGAGCTIN
A3KNW5_DANRE          IGTWLLYLPCTWSIGLAADPGC----------LPD---LRMLTLFGVGALLMRGAGCTIN
H3AS40_LATCH          IGTWLLYLPCTWSIALAADPGF----------LPD---LCMLTLFGTGAVLMRGAGCTIN
W5MV33_LEPOC          IGTWLLYLPCTWSIALAADPGC----------LPD---LFMLALFGTGALMMRGAGCTIN
G3PKM8_GASAC          IGTWLLYLPSTWSIALAADPGC----------LPH---LDVLTLFGVGALLMRGAGCTIN
A7RFI6_NEMVE          IGTWLLYLPCTWSIAMAAPPGV----------FPD---MKMMALFGLGAVIMRGAGCTIN
B3RWH5_TRIAD          IGTYLLYLPCTWSISMAATPGH----------LPD---LKTLAVFGIGALVMRGAGCTIN
COQ2_DROME            IGTYLLFWPCAWSIALSADAGC----------WPD---LTMLGLFGTGALIMRGAGCTIN
COQ2_DROPS            IGTYLLFWPCAWSIALSADAGC----------WPD---LTMLGLFGTGALIMRGAGCTIN
Q7Q9Z4_ANOGA          IGSWLLFWPCGWSIALSAPAGC----------WPD---AMMLGLFGVGAFVMRGAGCTIN
W5J300_ANODA          IGSWLLFWPCGWSIALSAPAGC----------WPD---PLMLGLFGVGAFVMRGAGCTIN
COQ2_AEDAE            IGSWLLFWPCGWSIALSAPAGC----------WPD---LWTLTLFGAGAFIMRGAGCTIN
E0W2B5_PEDHC          AGSWLLFWPCSWSIGMAAENGE----------LPN---LSMLALFGAGALIMRGAGCTIN
COQ2_CAEEL            IGTWLLYWPCTWSIAMATPAGQ----------LPS---IYMLSLFGAGAFLMRSAGCVIN
COQ2_ARATH            IGTWLLAWPCMWSIALAADPGS----------LPS---FKYMALFGCGALLLRGAGCTIN
F6HF43_VITVI          IGTWLLAWPCMWSITLAANPGH----------FPD---IKMLALFGTGALLLRGAGCTIN
B9H5T1_POPTR          IGTWLLAWPTMWSITLAAAPGN----------LPD---YKMIGLFALGSLLVRSIACTIN
M1C9U9_SOLTU          IGTWLLAWPCMWSIALAAPPGS----------LPD---LKMMTLFGCGALLLRGAGCTVN
K3YSY7_SETIT          IGTWLLAWPCMWSITIAAMPGQ----------LPD---LKMLALFGCGAVLLRGAGCTVN
B6T4K7_MAIZE          IGTWLLAWPCMWSITIAAMPGD----------LPD---LKMLALFGCGAVLLRGAGCTVN
Q6ZAH2_ORYSJ          IGTWLLAWPCFWSISMAAMPGE----------LPD---MRMLALFGCGAVLLRGAGCTVN
I1IFN5_BRADI          IGTWLLAWPCMWSITIAAMPGE----------LPD---LKMLALFGCGAVLLRGAGCTVN
A0A804HRS2_MUSAM      IGTWLLAWPCGWSITLAATPGN----------LPD---IKMLALFGCGAVLLRGAGCTVN
D6RMJ5_COPC7          IGTLLLFWPCTWSIAMASYALH----------LPPSVPLTYISLCGIGALVMRGAGCTIN
D0MXD0_PHYIT          GPTFMLLWPCFWSIAMAAPAGQ----------LPD---LKLLALFGTGSFIMRGAGCTIN
H9JR35_BOMMO          IGVYLLYWPCTWSIALASIPGV----------PIQTT-LQTAALFLVGAGLMRGAGCTIN
COQ2_YEAST            VGTWLLYLPCSWSILMGAMMQG----------ATLSATAGMLGIFGVGALVMRGAGCTIN
Q751D7_ASHGO          VGTWLLYMPCSWAITMAATQTA----------APLASTAAMLGLFGAGALIMRGAGCTIN
C4R445_KOMPG          IGSWLLYSPCTWSITMAAYSTT----------APLSSTLWMLGVFGVGALIMRGAGCTIN
A0A1D8PU83_CANAL      VGTWLLLLPCYWGITMASYSIA----------APLWVTTKAIALFSVGALVMRGAGCTIN
Q6C2S2_YARLI          VGTWLLFNPGVWSIGMAAYMSH----------AAVAPTLYTLSLFGIGAFIMRSAGCTIN
COQ2_SCHPO            TGTYLLYSPCTWSILMAAYAYD----------SSLVNVTKMLALFGVGSFLMRSAGCVIN
E3L3S4_PUCGT          IGAALLFLPCGSSLALAASSAA----------VSPQFLIAQTCLFGLGAFVMRGAGCTIN
UBIA_ECOLI            IGALLLLWPTLWALWVA---------------TPGVPQLWILAVFVAGVWLMRAAGCVVN
UBIA_SALCH            IGALLLLWPTLWALWVA---------------TPGMPQLWILAVFVAGVWLMRAAGCVVN
UBIA_SODGM            IGSLLLLWPTLWALWLA---------------GMAIPALGTLTVFILGVFFMRAAGCVIN
UBIA_YERPS            IGSLLLLWPTLWALWLA---------------GRGIPEAKILVVFVLGVFFMRAAGCVVN
UBIA_PHOLL            IGALLLLWPTFWALWMA---------------GKGIPDMHILLVFTAGVFLMRAAGCAIN
UBIA_PROST            IGSLLLLWPTYWALWIA---------------AQSIPSLHILIVFTAGVFLMRAAGCVIN
UBIA_PECAS            IGSLLLLWPTLWALWLA---------------GGGAPAPWTLFVFVAGVFLMRAAGCVIN
UBIA_HAES1            IGTLLLLWPTLWALYLA---------------EKAMPTLSVLAIFICGVFLMRSAGCVIN
UBIA_PASMU            IGTLLLLWPTLWALFLS---------------VKGMPDLSILSIFVLGVIFMRAAGCVIN
UBIA_HAEDU            IGTLLLLHPTLWALFAA---------------AGGIPSSSILIIFILGVIVMRAAGCVIN
UBIA_PHOPR            IGSLLLLWPTLWALFLA---------------ADGLPNMHVLVVFVLGVVFMRAAGCVIN
UBIA_ALIF1            IGSLLLLWPTLWALFLA---------------ADGLPDWHVLIVFVLGVVFMRSAGCVIN
UBIA_VIBPA            IGSLLLLWPTVWALVIA---------------AQGIPSWDVLIVFVLGVFLMRSAGCVIN
UBIA_VIBVY            IGTLLLLWPTLWALIIA---------------AEGTPDWHVLLVFVLGVVLMRSAGCVIN
UBIA_VIBCH            IGSLLLLWPTLWALLLA---------------AQGLPDLRVLVVFVLGVFLMRSAGCVIN
UBIA_PSEA6            VGSYLLLWPTLWALMIA---------------AQGLPPWHITGIFMAGVFVMRSAGCVIN
UBIA_PSET1            IGTLLLLWPTYWALWLA---------------NAGMPSLTNFIVFTLGVVIMRSAGCVIN
UBIA_COLP3            IGTYLLLWPTYWALWIA---------------SDGWPNLQLLLVFSLGVFIMRSAGCVIN
UBIA_ACIAD            IGTELVFWPTMWALWIA---------------SDGYPDLKMFVVMTLGVLFMRAAGCAIN
UBIA_PSYCK            VGIELLLWPTLWGVLFAAMGQAQQQGAGI---TAGLPSLSIFVIFALGAILMRAAGCAIN
UBIA_ALCBS            IGTLLLLWPTLWAVWIA---------------GAGTPSLTVIVVFFLGVVIMRAAGCVIN
UBIA_IDILO            IGTYLLAWPTIWALMIA---------------GAGEPPLRIVVIFLLGTFVMRSAGCVIN
UBIA_PSEF5            IGIYLLLWPTLVALWIA---------------AEGQPSLSHVLIFTFGVVLTRAGGCAIN
UBIA_PSEPF            IGIYLLLWPTLWALWIA---------------GKGSPSLANIVIFVLGVVLTRAGGCVIN
UBIA_PSEPK            IGIYLLLWPTLSAVWIA---------------GNGSPTLANVLIFGLGVVLMRAAGCCIN
UBIA_PSESM            IGIYLLLWPTLWAVWIA---------------GKGSPSLNTVFIFVAGVFLMRAAGCVIN
UBIA_PSEAE            IGIYLLLWPTLWSLWIA---------------ADGVPELKNLLIFVLGVILMRAAGCVIN
UBIA_CHRSD            IGTWLLMWPTLWALWLA---------------AEGIPERGTLLIFVIGVYVMRAAGCVVN
UBIA_HAHCH            IGTYLLLWPTLWALWLA---------------SEGAPSLKNLFIFVFGVLLMRSAGCVIN
UBIA_SACD2            IGIYLVLWPTLWSLWIA---------------ADGLPDWDVLVIFVLGVVLMRSAGCVIN
UBIA_METCA            IGIFLLLWPALWALWIA---------------GEGRPDPGVAAVIVFGVVLMRAAGCVIN
UBIA_NITOC            VGIFLLLWPTLWALWIA---------------GAGQPDPKVLLVFVAGVALMRSAGCVIN
UBIA_ALKEH            IGNFLLLWPMLWGLWIA---------------AKGLPDLKVLVVFVLGVLIMRAAGCVIN
UBIA_XANCP            IGSLLLLWPTWWALWLA---------------AGGLPPLWTLFVFTAGVWLTRSAGCVIN
UBIA_XANOR            IGSLLLLWPTWWALWLA---------------ADGLPPLWTLFVFTAGVWLTRSAGCVIN
UBIA_XYLFT            VGFLLLLWPTWWALWLA---------------ADGVPPWWTLCVFTTGIWLTRSAGCVIN
UBIA_SHEDO            IGTLLLLWPCLMALLFA---------------AKGMPDIKVLLIFILGVVIMRACGCIIN
UBIA_SHEFN            IGTLLLLWPCLMALVLA---------------AQGLPDIKVLLIFIVGVVIMRANGCIIN
UBIA_SHEON            IGTLLLLWPCLMALVLA---------------AGGMPDLKVLIIFIIGVVIMRACGCIIN
UBIA_COXBU            VGIFLLLWPTLWAVWIA---------------AKGAPSFKIAVIFIAGSVVMRAAGCIVN
UBIA_BLOFL            VGFFLLLWPTLWALWIT---------------NRGIPDFIVLSLFIVGVMCMRSAGCVIN
UBIA_BLOPB            IGFFLLLWPTLWGLWLS---------------HKGIPDKVVLIVFVAGALCMRSAGCIIN
UBIA_FRATO            IPILLILWPTLTALVLA---------------SHGLPDISYLVIFTIGVVVMRTVGCIIN
UBIA_HYDCU            IGIYLVLWPALWALWLA---------------ADGMPPMSILIIFILGAVIMRSAGCVIN
UBIA_AROAE            IGILLLMWPTLWALWLA---------------ADGFPPLHLIVIFALGTVLMRSAGCVIN
UBIA_DECAR            IGILLLLWPTLWALWLS---------------ALGRPNWIVVWIFILGTVLMRSAGCVIN
UBIA_THIDA            IGILLLLWPTLWAQWLA---------------SNGDPDWLILWIFVMGVVLMRSAGCVVN
UBIA_NITEU            IGILLLLWPTLWGLWLA---------------ADGMPDPMILVIFILGTILMRSAGCAIN
UBIA_NITMU            IGILLLLWPTLWGLWLA---------------AEGVPRLDILLIFVLGTVLMRSAGCVVN
UBIA_METFK            IGILLLLWPTLWGIWLA---------------SPGWPDGLVLFVFIAGTVLMRSAGCVMN
UBIA_BURL3            IGSLLLLWPTLNALWIA---------------SDGHPRWPLLVIFSLGTLLMRSAGCAMN
UBIA_BURTA            IGSLLLLWPTLNALWIA---------------SDGHPAPSLVVIFVLGTLLMRSAGCAIN
UBIA_PARXL            IGSLLLLWPTLNALWIA---------------SDGRPSLPLLVIFTVGTVLMRSAGCAIN
UBIA_CUPMC            IGTLLLLWPTLWAMWMA---------------AGGPPGWTLFWIFFAGTFLMRSAGCAMN
UBIA_CUPPJ            IGTLLLLWPTLWALWMA---------------AGGPPALSVFCIFFAGTFLMRSAGCAIN
UBIA_RALSO            IGTLLLLWPTLWAMWMA---------------ADGHPPPALVAIFVVGTVLMRSAGCAIN
UBIA_POLSJ            AGWLLLLWPTLSALWVA---------------SHGFPGWHLLTVFTLGTILMRSAGCCVN
UBIA_RHOFT            AGWLLLLWPTLSALWVA---------------AGGFPGWHLLSVFTLGTILMRSAGCCIN
UBIA_NEIG1            IGTLLLLWPTYWALWLA---------------SDGIPDLAVLAAFTIGTFLMRSAGCVIN
UBIA_LEGPL            IGILLLWYPTAWALWMA---------------NQGFPSIDLLMIFLLGTVFMRSAGCVIN
PLQA_SYNY3            AGRLILMIPALWAVCLA---------------AQGLPPLPLLGTIALGTLATSGLGCVVN
Q8DLS6_THEVB          AGRLILLIPALWSLTLA---------------SEGLPSLKLLLIITMGAIATSAAGCIVN
Q7NFU6_GLOVI          AGRLILMIPALWGVFAA---------------AGGSPSPLLVLVMVVGTIATSAAGCVIN
A5GMW7_SYNPW          SGRLILLIPAGWSLWLN---------------PAGPPSLQLILQILIGGLSVSAAGCVAN
Q7VDC5_PROMA          TGRLILLIPAGWSLWLT---------------PNAPPSKELVTLIIAGAISVSGAGCIAN
A3PBH9_PROM0          TGRMILLIPAGWSLYLT---------------PEANPKFLMLLRIILGGLLVSGLGCVVN
Q3YRN9_EHRCJ          ETFFLALFPGLVSVVLVSHD------------VLSAC--WYMLLCIVGTSIVKPAGCVIN
S5PJB2_ANAPH          EISLLATFPTCASIVLASNS------------LYSVL--KLFVLVAIGALVVRSAGCIIN
Q4UAZ7_THEAN          MPVVIFALPAMWSAAIALPP------------VVTFLELKKIALLCLGAFFARSAGCCVN
Q4MYN9_THEPA          MPVVIFALPAMWSAALALPP------------VVTFLELKKIALLCLGAFSARSAGCCVN
A7AM23_BABBO          APVGIFAFPALWSSFMAISS------------TWGYEELKKMVLFCLGAFFGRNAGCCIN
C6V5S7_NEORI          GGMWLCFFPALFVVALLGSS------------FYSFL---WIPFFLLGAFLVRSAGCIAN
A8F2H7_RICM5          VAYLLVFFPALFGLLLANP--------------SRMELIHLLPLFILGSITARSSGCIIN
Q9ZCN7_RICPR          VAYLLVFFPALFGLLLANP--------------SNMELAYLLPLFIFGSITARSSGCIIN
W7X633_TETTS          IGYKLLFWPCVWGAALGQPI------------LSPLALAHLFGTFYFGSAVMRAAGCIVN
A0A2D7AM03_9PROT      HGILLLFFPCIWGIYLNKTN------------ISEEILLCII--FFIGACGMRALGCIWN
Q383Z3_TRYB2          AAINLLLQPCYWGASLAVTRAIVWEGADPVVLFAPFIPVHLIVLFGAGAFLARGAGCIIN
V5BFC2_TRYCR          VGTVLLMLPCYWGSSLAVTKAIVWEGADPVALFAPFIPVHLAVLFTAGAFLMRNSGCVVN
Q4Q8D4_LEIMA          VGWQLLLIPCYWGSSLAVTRALVWEGADPVVLCAPFIPLHLCVQFLLGAYLMRSVGCIVN
A4HGH9_LEIBR          VGWQLLLIPCYWGSSLAVTRALVWEGADPVVLCAPFIPFHLAVQFLVGAYLMRSVGCIVN
COQ2_DICDI            IGVWLLLYPCCWSISLAAP-------------AGSFPDLKTMLVFGIGAYVMRSAGCVIN
D3BQE1_POLPP          IGTLLLLYPCLWSTAIAAT-------------PGQLPNFTLMMMFGAGAFLMRSAGCVIN
Q3IZ43_CERS4          IGTWLLLIPCFWAVALAALADPG---------GYRPLDLWLVIGSSVGAFLMRGAGCTWN
Q9A2Y5_CAUVC          VGIWLLMLPGWQGIALAAAEQG------------RWPNPLLLLAVFVGAALMRAAGCAFN
I1S1K6_GIBZE          VGLILIYFPHLFGVVHAASVQSS----------SISEVLYISSILAIGSFFCNNGSHAWN
M2UDD4_COCH5          AAFFLILFPHLFGVILAANTLKV----------PATEVARACLLLFGGSFFCSNASHAWN
C0NID8_AJECG          TGTYYLFFPCAFSTLLAAPLASPI--------THALEIASVCGMFFVGALVMRGAGCTIN
A0A0D8JX01_COCIM      TGTYYLFFPCLFSTLLAAPLATPM--------ATPLEVVSYSGLFFLGALIMRGAGCAIN
Q1K4Y3_NEUCR          TGSYYLFFPCLFSTLLAAPLAGP---------ASPVSVVGTSLLFISGAIIMRGAGCAIN
G2WTU9_VERDV          TGTYYLFFPCLFSTLMAAPMAMPM--------ASPLSVLGTTFLFFSGALIMRGAGCTIN
Q0USG0_PHANO          TGSYYLFFPCLFSTFIAATMATPI--------AAPSALLSTVALFFTGAVVMRGAGCTIN
Q4WNJ5_ASPFU          TGTYYLFFPCVFSTLIAAPMASA----------TPMQILGTTGLFFTGALIMRGAGCAIN
D5GD53_TUBMM          TGTIYLFLPCLWSTLLAGTLTDPV--------TPLPTVLGTTFLFATGALIMRGAGCTIN
                              *                                      *       .   *

COQ2_HUMAN            DMWDQDYDKKVTRTANRPIAAGDISTFQSFVFLGGQLTLALGVLLCLNY----YSIALGA
F6XCH9_MACMU          DMWDQDYDKKVTRTASRPIAAGDISTFQSFVFLGGQLTLALGVLLCLNY----YSIALGA
H0WKB3_OTOGA          DMWDREYDKKVTRTANRPIAAGDISTFQSFVFLGGQLTLALGVLLCLNY----YSIALGA
G1T0N6_RABIT          DMWDQDYDKKVTRTANRPIAAGDISTFQSFVFLGGQLTLALGVLLCLNY----YSIALGA
G3SN39_LOXAF          DMWDHEYDKKVTRTANRPIAAGDISTFQSFVFLGGQLTLALGVLLSLNY----YSIALGA
COQ2_BOVIN            DMWDRDYDKKVTRTASRPIAAGDISTFRSFVFLGGQLTLALGVLLCLNY----YSIALGA
E2QT06_CANLF          DMWDRDYDKKVIRTANRPIAAGDISTFQSFIFLGGQLTLALGILLCLNY----YSIALGA
G1LEF8_AILME          DMWDRDYDKKVIRTASRPIASGDISIFRSFIFLGGQLTLALGVLLCLNY----YSIALGA
COQ2_MOUSE            DMWDRDFDKKVTRTANRPIAAGDISTFQSFVFLGGQLTLALGVLLCLNY----YSIAMGA
COQ2_RAT              DMWDRDFDKKVERTANRPIAAGDISAFQSFVFLGAQLTLALGVLLHLNY----YSIAMGA
G1KKG5_ANOCA          DMWDRDYDKKVERTASRPLAAGEISSFHSLVFLGGQLSLALCVLLCLNY----YSIALGA
A3KNW5_DANRE          DMWDKDFDKKVSRTATRPIASGDITRFQALVFLGGQLSLALGVLLSLNY----YSIALGA
H3AS40_LATCH          DMWDRDFDKKVARTANRPIAAGEITHFQALLFLGGQLSLALGILLCLNY----YSIALGA
W5MV33_LEPOC          DMWDKDFDKKVSRTVSRPIASGEITQLQAFMFLGAQLSAALGILLCLNF----YSIALGA
G3PKM8_GASAC          DMWDKDFDRKVSRTASRPIASGQISQMQALVFLGGQLSLALGVLLCLNY----YSIALGA
A7RFI6_NEMVE          DMWDCKYDKKVTRTLCRPLPSGEVSHLQALGFLAVQLSAGLAVLLSLNT----YSILLGV
B3RWH5_TRIAD          DMWDSDFDKKVFRTRDRPIASGTIAHKQALGFLAAQLTVGLSILLSLNQ----YSIILGA
COQ2_DROME            DLWDKDIDAKVERTRLRPLASGQISQFDAIVFLSAQLSLGLLVLVQLNW----QSILLGA
COQ2_DROPS            DLWDKDIDAKVERTRTRPLASGQISQFDAIVFLSAQLSLGLLVLVQLNW----QSILLGA
Q7Q9Z4_ANOGA          DLWDRDIDAKVERTRNRPLVSGEIAPFDAVVFLAGQLGVGLLVLLQLNW----YSILLGA
W5J300_ANODA          DLWDRDIDAKVERTKHRPLVAGEISPFDALVFLAAQLGVGLTVLLQLNW----YSILLGA
COQ2_AEDAE            DMWDRDIDGKVARTRNRPLVAGELTSADAWFFLGAQLGVGLLILLELNW----YSIVLGA
E0W2B5_PEDHC          DLWDKDIDSKVSRTSNRPLVTGQVTKFKALVFLGGQLSISLLILLQLNW----YSVFLGA
COQ2_CAEEL            DLWDKDFDKKVERTKLRPLACGSLTEKQAIGLLAGLLSSSLAILLQLNW----YSVAVGA
COQ2_ARATH            DLLDQDIDTKVDRTKLRPIASGLLTPFQGIGFLGLQLLLGLGILLQLNN----YSRVLGA
F6HF43_VITVI          DLLDQDIDPKVERTKLRPIASGILTPFQGLSFLGFQLLLGLGILLQLNN----DSRILGA
B9H5T1_POPTR          DILDRDIDAKVDRTKRRPLASGVLKPSQGVLFLGFQLFLGLGILLQLNN----YSRVLGV
M1C9U9_SOLTU          DLLDRDIDTKVERTRSRPIASGVLTPFQGLTFLGFQLLLGLGILLQLNN----YSRILGA
K3YSY7_SETIT          DLLDRDIDNKVERTKSRPFASGALTPSQGVGFLGFQLLLGLGILLQLNN----YSRILGA
B6T4K7_MAIZE          DLLDRDIDNKVERTRSRPFASGVLTPLQGVGFLGIQLLLGLGILLQLNN----YSRILGA
Q6ZAH2_ORYSJ          DLLDRDIDNKVERTKSRPFASGILTPTQGVGFLGLQLLLGLGILLQLNN----YSRILGA
I1IFN5_BRADI          DLLDRDIDNKVERTKSRPFASGALTPSQGVCFLGAQLLLGLGILLQLNN----YSRVLGA
A0A804HRS2_MUSAM      DLLDRDIDIKVERTKYRPIACGVLTPFRGLCFLGFQLLLGLGILLQLNN----YSRILGA
D6RMJ5_COPC7          DMWDKNLDKSVARTKERPLARGDLTRKDAFIFLGGQLGLGLAVLLQFNW----YSILLGA
D0MXD0_PHYIT          DMWDKDFDKQVERTNKRPLAAGKLTYPQAWGFLAGQLSAGLAVLLQLNW----YSIAMGA
H9JR35_BOMMO          DMWDRDIDKQVARTKDRPLVSGAVSQTGAMIFLAAQLSLALGVLLQLNC----YSVALGA
COQ2_YEAST            DFLDRKLDQRVIRSVERPIASGRVSPRRALVFLGAQTLVGMGVLSLLPA----QCWWLGL
Q751D7_ASHGO          DLLDRDLDNKVLRTVERPITSGRVSAGRAVAFLGAQTAAGIGILACLPA----GCWWLGL
C4R445_KOMPG          DLLDRDLDNKVERTIERPLASRRVTPKQAITFLGAQLAVGLGVLLQLPA----DCFLLGA
A0A1D8PU83_CANAL      DIWDRNLDNQVARTMERPITSGRVSVPQAVAWLGVQCFAGLAVLLSLPF----ECFYLGA
Q6C2S2_YARLI          DILDRKLDAQVARTFDRPIAAGDVSVKQAVAFLGAQCAAGLGILMLLPM----NCWWLGA
COQ2_SCHPO            DLWDRELDAKVERSKSRPLASGKLSVRQAISLLSVQLTASLGILLQLNP----YTIKLGV
E3L3S4_PUCGT          DLWDRSIDQKVSRTQLRPLASGALSPANAIGWLGLQLSIGLAILLQLNI----YSILLGA
UBIA_ECOLI            DYADRKFDGHVKRTANRPLPSGAVTEKEARALFVVLVLISFLLVLTLN----TMTILLSI
UBIA_SALCH            DYADRKFDGHVKRTVNRPLPSGAVTEKEARNLFVVLVLLAFLLVLTLN----AMTILLSV
UBIA_SODGM            DYADRKIDGHVKRTRARPLPSGAIGEKEAKLLFGALVGISFALVLTLN----SMTIALST
UBIA_YERPS            DYADRHIDGFVKRTASRPLPSGTISEKESKILFVVLILLSFGLVLTLN----SMTIWLSL
UBIA_PHOLL            DFADRKFDGYVERTKTRPLPSGAISEKESKILFVVLALISFGLVLTLN----KMAIWLSA
UBIA_PROST            DFADRHFDGHVERTKHRPLPSGDVTEKEAKILFASLVGLSFLLVLTLN----SMTIWLSV
UBIA_PECAS            DYADRHFDGHVKRTASRPLPSGEVSEQSAKILFVVLVLLAFGLVLTLN----KMTIWLSV
UBIA_HAES1            DYADRHIDGKVKRTSLRPLSTGRATPREAKWLFIVLVFCSFLLVLCLN----LYTIGLSV
UBIA_PASMU            DYADRHIDGAVKRTSKRPLATGAATPEEAKWLFVLLVFCSFILVLFLN----TYAIVLSF
UBIA_HAEDU            DYADRHIDGKVKRTSQRPLATGRVTTVEAKVLFFVLLIIAFLLDLSLN----QYAFLLSF
UBIA_PHOPR            DFADRNFDGHVKRTAKRPMPSGKISEREALGLFGLLVLVSFVLVLTMN----TLTIMLSV
UBIA_ALIF1            DFADRKVDGHVKRTANRPLPSGLISSKEALSLFAVLVVCSFLLVLTMN----TLTIMLSG
UBIA_VIBPA            DFADRKVDGHVKRTKQRPLPSGKVTAKEAIGLFLVLAVSSFLLVLTMN----PLTIQLSF
UBIA_VIBVY            DFADRKVDGHVKRTQQRPLPSGRVTAKEAVILFLLLGISSFLLVLTMN----PLTIQLSF
UBIA_VIBCH            DYADRHVDGHVKRTSQRPLPAGLVSAKEALLLFVLLAVSSFLLVLTMN----TLTIQLSF
UBIA_PSEA6            DYADRKVDGKVDRTKARPLVSGVVTEKQALGLFATLVGVAFLLVLALN----WQTIVLSL
UBIA_PSET1            DFADRKIDGSVKRTMQRPLVSGQVSSGEAISLFILLITVAFLLVLMLS----VNTILLSF
UBIA_COLP3            DYADRKIDGEVERTKNRPLVNGMMTSGEAINLFGVLIGMAFGLVLMLS----WSTIYLSV
UBIA_ACIAD            DFADRKVDGHVARTKQRPLATGIIRPIEAIWVFLALVAASAALLLFLP----IETFYWSF
UBIA_PSYCK            DFADRKVDGHVSRTKGRPLADGRLSAKEAIAAFLVLVLLSASLLLFLP----IQVFYWSF
UBIA_ALCBS            DFADRNFDGDVERTQGRPLATGALSAKQALALFGGLGLLAFGLVLFLN----ELTFWLSF
UBIA_IDILO            DFADRNYDGHVRRTRQRPIPAGRISATEAMIGFIALLAIAFGLVMQLN----TETVMLSF
UBIA_PSEF5            DFADRKVDGQVKRTDQRPLATGKVSAKEALILFAVLMGAAFLLVLCTN----ATTVWLSF
UBIA_PSEPF            DWADRKVDGHVKRTAQRPIAAGKISSKEALVFFALLMGVSFLLVLCTN----AATIWLSL
UBIA_PSEPK            DFADRKVDGHVKRTADRPLASGRVRPREALTLFAILVGVSFLLVLCTN----SRTVWLSF
UBIA_PSESM            DFADRKVDGHVKRTEQRPLVSGKVSSREALVLFAVLVSLSFVLVLFTN----STTIWLSF
UBIA_PSEAE            DFADRNFDGHVARTKARPLATGKISVREAWITFAVLVALSFGLVLLTN----ATTVWLSF
UBIA_CHRSD            DYADRHFDGHVKRTRDRPLATGRITEKEAKVLFAGLVIIAFGLVCLTN----LPTVLLSF
UBIA_HAHCH            DYADRRIDMHVERTKGRPFAQNQVTEKEALTLFGILVGVSFILVLFTN----ALTIYLSA
UBIA_SACD2            DFADRKIDGHVRRTANRPLVTGLITPKQAVLFFVALLVIAFILVLFTN----PLTIKLSF
UBIA_METCA            DYADREFDPHVERTRLRPIAAGEVTSKEALILFMVLCLTAFALVLTMN----WLTIALSV
UBIA_NITOC            DFADRAFDPHVKRTINRPLATGKASSQEALLLFAGLCLVAFGLVLLLN----PLTIGLSF
UBIA_ALKEH            DYADRDFDGHVKRTTHRPMANGRVSEREALTLFVVLCLVAFGLVLLMN----PLTIALSL
UBIA_XANCP            DYADRWLDPHVERTKSRPLATGAVSGREALWVFVVLMLVAFALVLSLN----WLTVALSV
UBIA_XANOR            DYADRWLDPHVERTKSRPLATGAVSGREALWVFVVLMLVAFALVFTLN----WLTVLLSV
UBIA_XYLFT            DYTDRWLDPHVERTCTRPLVTGTVSPRNALLMFGTLMLIAFGLVLTMN----RLTVLLSV
UBIA_SHEDO            DYADRNLDAHVERTKQRPLASGAISSKEALSLFALLGLLAFALVLLLN----PLVVKLSV
UBIA_SHEFN            DFADRKLDAHVERTSMRPLVSGEVSVKEALTLFTLLGLAAFCLVLWLN----PLVVQLSV
UBIA_SHEON            DYADRDLDSHVERTKSRPLASGEISTKEALLLFVILGLAAFGLVLLLN----GLVVKLSV
UBIA_COXBU            DFADRHLDKHVQRTQMRPLASGSVSVTEAMLLFAVLSLIAFTLVLLLN----RLTVELAV
UBIA_BLOFL            DYIDYDIDMCVQRTIRRPIVIGSVKKQEALWVFFILILIALIVVCVFNN---IIAVFLSL
UBIA_BLOPB            DYVDYDIDGHVQRTKTRPLPSGMIRKKEALVALSILLFIAFILVLSLN----FITIFLSV
UBIA_FRATO            DIADVDFDKHVARTNTRPLTSGQLSIKNAIWLCISLTLVAFICVLFLN----LYTILLSF
UBIA_HYDCU            DYADRHFDGYVTRTCARPLATGQLTERQALKFFFVLCLLAFGLVLFLN----PFTILLSL
UBIA_AROAE            DYADRDFDGHVERTRTRPLTTGAVTVREALLLAAGLSLVSFVLILPL-D---PLVRWLSL
UBIA_DECAR            DYADRDFDKHVERTKERPLTAGKVTTKEALALFAGLSLLSFLLVVFLGN---TLVIWLSL
UBIA_THIDA            DYADRDFDPHVARTRDRPIAAGKVSPKEALLLAAGLSLLAFLLILPL-N---ALVLKLSL
UBIA_NITEU            DFADRRIDPHVSRTRNRPLAAGLITAREALLIAAGLSLCAFLLILPL-N---LLTIQLSV
UBIA_NITMU            DYADRNFDGHVERTRTRPLALGAVSTREALLLAAGLSLVAFLLIQPL-N---RLTIELSF
UBIA_METFK            DLADRNFDGHVERTRQRPLVTGDVTTKEAVLLALALSLVAFILVLQL-N---PLVVALSF
UBIA_BURL3            DYADRDFDRHVKRTADRPLTSGKIRAWEAIAIAVGLAFVSFLLILPL-N---TLTKQLSV
UBIA_BURTA            DYADRDFDRHVKRTAERPLTSGKIRAWEAVAIAVGLALVSFLLILPL-N---ALTKELSV
UBIA_PARXL            DYADRDFDRYVRRTENRPITSGKIRAWEAVALAAALSLLAFLLILPL-N---ALTKELSV
UBIA_CUPMC            DWADRDFDKHVKRTKERPLTAGLIASWEALAVAAVLALIALALILPL-N---ALTKWLAV
UBIA_CUPPJ            DYADRDFDKHVKRTKERPLTAGKIAAWEAVLIAAVLALIAFALILPL-N---SLTKWLAV
UBIA_RALSO            DWADRDFDKHVKRTRERPLTAGLIAPWEALAVAAVLALVAFTLILPL-N---ALTKWLSV
UBIA_POLSJ            DVADRDFDRHVKRTAQRPVTSGQVSVREALVLGAVLALLAFGLVLTT-N---AATIAWSF
UBIA_RHOFT            DVADRDFDRHVKRTAARPVTTGAVSVKEALVLGAVLALLAFALVLTT-N---AITIGISG
UBIA_NEIG1            DFADRDFDGAVERTKNRPFAQGRVKKKEALLLTAFLCLLAALCLIPL-N---HLTWLMSL
UBIA_LEGPL            DIADRHIDRHVARTQFRPLTSGEVSLSEAFILLFILLCASLFLLLKLP----INCFYFAV
PLQA_SYNY3            DLWDRDIDPQVERTKQRPLAARALSVQVGIGVALVALLCAAGLAFYLTP----LSFWLCV
Q8DLS6_THEVB          DCWDRNIDPHVQRTQNRPLASRRLSLGVALGLMVIALLCAWGLTFYLTP----LGYWLAV
Q7NFU6_GLOVI          DLWDRDIDPLVERTRARPLASRELAVPVAVVTFAVSLLCAWGLTFFLNP----FTFWLCV
A5GMW7_SYNPW          DLWDQRIDREVARTSQRPLARGDLNRVQAFTLLAVLLTLSLLVVISLPGDVRWLCLQLAV
Q7VDC5_PROMA          DLWDRKIDSKVKRTKNRPLANGSLSIVEAFSLLIFLLIISLKVILLLPTPSQNLSLKLAA
A3PBH9_PROM0          DIWDKKIDQRVVRTKNRPLAANKIGLKTAYSILFFLILCSFFLTLSLPQPGRTLSISLAF
Q3YRN9_EHRCJ          CICDREIDAKVKRTKNRPLADKSLTVVQALKVLVVLLLCSCGLLVFTNM----YTVKLSI
S5PJB2_ANAPH          DIFDRNIDIHVHRTKSRPIACGRLKVREGLCALAVLLCIAGVILLFTNK----LSLYLSI
Q4UAZ7_THEAN          DLADRNFDKLVQRTKIRPLASGSINTTEAFITLLLNSTVALGILSQFDH----TTIGLGI
Q4MYN9_THEPA          DLADRNFDKLVQRTKIRPLASGSINTTEALITLMFNSTIALTILYQFDP----TTIGLGL
A7AM23_BABBO          DMADRNIDKYVERTKTRPMAAGLLSTREALCVLSANAALGLLVLLQFDI----RTIRIGI
C6V5S7_NEORI          DIADRNIDGKVKRTASRPIASGEVSVTEAVLLFLILLILATVLLAFLPL----EATALGA
A8F2H7_RICM5          DIFDRKFDKHVARTKERPLASKALSVSYAILILFILSVISLCILLLLNK----TAIYTGF
Q9ZCN7_RICPR          DIFDRKFDKYVERTKKRPLASGAVSVFYAIFILLILSIISLSILLLLNK----TAIYTGF
W7X633_TETTS          DMWDRDFDNKVERTKVRPLASGDLTMKQASIFLFFHLCGGLLTLTQLNW----FSIALSF
A0A2D7AM03_9PROT      DYNDKDFDKKVERTKDRLIASNKVNKKEIIIFSFINLLIGSVPIYFIPN----NSIFISF
Q383Z3_TRYB2          DMCDRKFDRMVERTKTRPLASGVVSMKEASGLLITVAGFALVIALNLSP----MALASAV
V5BFC2_TRYCR          DMLDRKFDELVSRTKTRPLANREIGMTEASVVLFLNLSFAFVIAMNLSP----MALLAAL
Q4Q8D4_LEIMA          DMWDRKFDRMVERTAQRPLACGAISMAEASVILLLHLAVAGVIALNLSP----VALQACV
A4HGH9_LEIBR          DMWDRKFDRMVERTAQRPLACGAVSMTEASAILLSHLIAAGVIALNLSP----AALLASV
COQ2_DICDI            DMADYKFDSKVERTKTRPIASKQLTHKQSLIFLGGQLLASFGLILSS---LNYYTIALCA
D3BQE1_POLPP          DMVDYKFDRKVDRTKLRPIASNQVTHKEALALLAGQLAISFGLLLN----FNVYTILLSL
Q3IZ43_CERS4          DITDREFDAAVARTRSRPIPSGQVSAKAAAVWMVVQALVASLILFSFNG----TAILLGV
Q9A2Y5_CAUVC          DIVDRDFDAQVARTAMRPIPAGLISVKQAWLFVVGCCGVSFLILICLGW----TAILLGV
I1S1K6_GIBZE          DLVDAPIDAKIERTKMRPIPRGAISRQAAFAFSVSQAILAAACLLPLGF----ETALATI
M2UDD4_COCH5          DLVDAPIDKAIARTKTRPIPRGAITPLAAFIFAVSQATGALSFLYFLPA----DTAKVAT
C0NID8_AJECG          DLWDRNLDPHVERTRLRPIARKAIPPRNAVIFTGAQLLVGLGVLLQFPT----PCLWYGI
A0A0D8JX01_COCIM      DLWDRNLDPHVERTKFRPIARKAITPLSAMIFTGTQLLVGLAVLLQFPA----TCFWYAT
Q1K4Y3_NEUCR          DLWDRNLDPHVTRTRLRPIARRAITPFQGLVFTGSQLLAGLAVLLQFPF----ECFWYAT
G2WTU9_VERDV          DLWDRNLDPHVTRTRFRPIARRAVTPFNALVFTGAQLFAGLGILLSFPL----QCLYYGV
Q0USG0_PHANO          DLWDRNLDPHVERTRLRPIARRAISPPQAIVFLGGQLFTGLAVLLSLPF----ECFWYAT
Q4WNJ5_ASPFU          DLWDRNLDPYVERTKFRPIARGALSPKKALVFTCSQLLAGLAVLLQFPS----QCLWYGI
D5GD53_TUBMM          DLLDRNIDLHVSRTKFRPIARGAITPFNALAFTCVQLLAGLAVLVQFPA----QTIIWGI
                         *   *  : *:  * .                    .                    

COQ2_HUMAN            GSLLLVITYPLMKRISYWPQLALGLTFNWGALLGWSAIKGS-----CDPSVCLPLYFSGV
F6XCH9_MACMU          GSLLLVITYPLMKRITYWPQLALGLTFNWGALLGWSAIKGS-----CDPSVCLPLYFSGV
H0WKB3_OTOGA          ASLLLVITYPLMKRITYWPQLALGLTFNWGALLGWSAIKGS-----CDPAVCLPLYFSGV
G1T0N6_RABIT          ASLLLVITYPLMKRITYWPQLALGLTFNWGALLGWSAVQGS-----CDPSVCLPLYFSGV
G3SN39_LOXAF          ASLLLVITYPLMKRITYWPQLFLGLTFNWGALLGWSAVKGS-----CDPSVCLPLYFSGI
COQ2_BOVIN            ASLLLVTTYPLMKRITYWPQLALGLTFNWGALLGWSAVKGS-----CDPSVCLPLYFSGI
E2QT06_CANLF          ASLLLVITYPLMKRITYWPQLALGLTFNWGALLGWSAIKGS-----CDLSICLPLYFSGI
G1LEF8_AILME          ASLLLVITYPLMKRITYWPQLALGLTFNWGALLGWSAVKGS-----CDPSVCLPLYFSGI
COQ2_MOUSE            ASLLLVVTYPLVKRITFWPQLALGLTFNWGALLGWSAVKGS-----CDPAVCLPLYFSGV
COQ2_RAT              ASLLLVVTYPLMKRVTFWPQLALGLTFNWGALLGWSAVKGS-----CDPAVCLPLYFSGV
G1KKG5_ANOCA          ASLSLVVTYPLMKRVTYWPQLFLGLTFNWGALLGWSAIQGS-----CNWSVCLPLYFSGI
A3KNW5_DANRE          ASLSLVVTYPLMKRITYWPQFILGLTFNWGALLGWSAVKGS-----CDWSVCLPLYVSGV
H3AS40_LATCH          ASLSLVVTYPLMKRITYWPQFVLGLTFNWGALLGWSAVKGS-----CDWAVCLPLYFSGL
W5MV33_LEPOC          ASLSLVVTYPLMKRITYWPQLVLGLTFNWGALLGWSAVMGS-----CDWSVCLPLYFSGV
G3PKM8_GASAC          ASLCLVVSYPLMKRITYWPQFVLGLTFNWGALLGWSAVKGF-----CDWSVCLPLYFSGV
A7RFI6_NEMVE          ASLGPVIVYPLMKRITYWPHIFLGITLNWGAMLGWSAIQGS-----CDWSVCLPLYLACV
B3RWH5_TRIAD          CSVPFVIVYPLMKRFTFWPQLFLGITFNWGALLGYAAVNGY-----CDWNVVIPLYAASI
COQ2_DROME            SSLGLVITYPLMKRVTYWPQLVLGMAFNWGALLGWCATQGS-----VNLAACLPLYLSGV
COQ2_DROPS            SSLGLVITYPLMKRVTYWPQLVLGMAFNWGALLGWCATQGS-----VNLAACLPLYLSGV
Q7Q9Z4_ANOGA          SSLGLVIVYPLMKRVTYWPQLMLGATFNWGALLGWSATQGS-----VEWSACLPLYVAGV
W5J300_ANODA          SSLGLVIVYPLMKRITYWPQLMLGATFNWGALLGWSATQGS-----VDWAACLPLYAAGV
COQ2_AEDAE            SSLGLVIIYPLMKRITHWPQLVLGMTFNWGALLGWSATQGS-----VMWSACLPLYVAGV
E0W2B5_PEDHC          SSLLLVITYPLMKRITYWPQLILGCTFNWGALLGWSAVHGS-----CDWSICLPLYLSGI
COQ2_CAEEL            SSMALVVGYPLAKRFTYWPQFVLGLTFNWGALLGWCALKGD-----LSSSAPFWMYAAAL
COQ2_ARATH            SSLLLVFSYPLMKRFTFWPQAFLGLTINWGALLGWTAVKGS-----IAPSIVLPLYLSGV
F6HF43_VITVI          SSLLLVFSYPLMKRLTFWPQAYLGLTFNWGALLGWSAVRGS-----LDPAIVFPLYISGV
B9H5T1_POPTR          LSMFLVFTYPLMKRFTYWPQAYLGFTFSWGALLGWSAVKGS-----LDPAIVLPLYASGI
M1C9U9_SOLTU          SSLLLVFSYPLMKRFTFWPQAFLGLTFNWGALLGWAAIKGS-----IDPAVVLPLYASGV
K3YSY7_SETIT          SSLLLVFSYPLMKRFTFWPQAYLGLTFNWGALLGWAAIKES-----LDPAVVLPLYTAGI
B6T4K7_MAIZE          SSLVLVFSYPLMKRFTFWPQAYLGLTFNWGALLGWAAIKES-----IDPAIILPLYTAGI
Q6ZAH2_ORYSJ          SSLFLVFSYPLMKRFTFWPQAYLGLTFNWGALLGWAAIKES-----LDPAIILPLYTAGI
I1IFN5_BRADI          SSLLLVFSYPLMKRFTFWPQAYLGLTFNWGALLGWAAIKES-----LDPAVIVPLYTAGI
A0A804HRS2_MUSAM      SSLLLVFSYPLMKRLTFWPQAYLGLTFNWGALLGWAAVKES-----LDPAIVLPMYGAGV
D6RMJ5_COPC7          SSLSLVTIYPFMKRVTHWPQAVLGLAFNWGALLGWSAVAGT-----VDWAVCLPLYAGGV
D0MXD0_PHYIT          SSLALVATYPTMKRFTYWPQAVLGLTFNYGALLGWAAVHGS-----CEWPVVLPLYAGGV
H9JR35_BOMMO          SSMLLVVTYPLAKRFTAYPQVFLGATFNWGALLGYSAVQGS-----LDAAVCLPLYVAAL
COQ2_YEAST            ASLPIVFTYPLFKRFTYYPQAALSACFNWGALLGFPAMGV------MSWPTMIPLYLSSY
Q751D7_ASHGO          ASLPLVATYPLFKRFTYYPQVALSACFTWGALLGFPAMGV------LDWGTMVPLYLSSF
C4R445_KOMPG          VSLVPVAVYPLFKRITYYPQVVLSSCFTWGALLGFPAMGV------WNWSSMIPLYLSSF
A0A1D8PU83_CANAL      LSLPFVAAYPLFKRFTYYPQAMLSICFSWGCLLGFPAVGAP-----LNLWVAVPLFISNW
Q6C2S2_YARLI          LSMPFVMTYPLFKRFTYYPQAILSLCFTWAALLGPPAMGV------WCWPVMLSLWGSNF
COQ2_SCHPO            ASLVPVCIYPAMKRITYYPQVVLGLTFGYGAVMGWPALAGEAC---MNWSVVAPLYLSTI
E3L3S4_PUCGT          SSLSLVIIYPLMKRITYWPQFVLGLAFNWGALLGSSAILGQ-----TDWKVSIPLYVGHI
UBIA_ECOLI            AALALAWVYPFMKRYTHLPQVVLGAAFGWSIPMAFAAVSESV----P--LSCWLMFLANI
UBIA_SALCH            AALALAWVYPFMKRYTHLPQVVLGAAFGWSIPMAFAAVSESL----P--LSCWLMFLANI
UBIA_SODGM            VALALAWVYPFMKRYTHLPQLVLGAAFGWSIPMVFTAVSESL----P--LSCWLLFLANI
UBIA_YERPS            AALALAWIYPFMKRVTHLPQVVLGAAFGWSIPMGFAAVSESL----P--LVCWLLLLANI
UBIA_PHOLL            VGLALAWLYPFVKRFSHFPQFVLGAAYGWAIPMGFAAVSESL----P--LECWLLFLVNI
UBIA_PROST            AGLALAWIYPFVKRVSHLLQVVLGAAFGWSIPMGFSAVSESL----P--LVCWVLFLVNI
UBIA_PECAS            AGLVLAWVYPFMKRVSHLPQFVLGAAFGWSIPMAYAAVSESL----P--ATCWMMFLAYI
UBIA_HAES1            IAVILAFIYPFMKRYTHLPQFFLGAAFGWSIPMAYGATIEAL----P--LECWLLFIANL
UBIA_PASMU            IAVFLAFIYPFMKRYTHLPQLFLGMAFGWSIPMAYGASIEAL----P--LECWLLFFANL
UBIA_HAEDU            VAVALAVIYPFMKRFTHLPQVVLGMAFGWAIPMAYGAVIEDL----P--LTCWLLFLANI
UBIA_PHOPR            VGLVLAAAYPFMKRYTHLPQLVLGMAFGWSIPMAYAAQAGEL----P--VVAWLLFTANI
UBIA_ALIF1            IGIVLAIAYPFMKRVTYLPQFVLGLAFSWAIPMAYAAESNQV----P--PEAWLLFVINA
UBIA_VIBPA            AGLVLAFIYPFMKRYTHIPQLFLGLAFSWAIPMAWAAQTGEL----P--VMVWFVFVINA
UBIA_VIBVY            AGIVLAFIYPFMKRYTHLPQLFLGLAFSWAIPMAWAAQANEL----P--WVVWFVFAINA
UBIA_VIBCH            IGILLAFVYPFMKRFTHLPQLVLGLAFSWSIPMAWAAQANTL----T--PQVWVLFLINA
UBIA_PSEA6            GALALASVYPFMKRYTHFPQVVLGAAFGWAIPMAFMAVTEAV----P--AIAWWLFAINV
UBIA_PSET1            GALALAFCYPFMKRYTQLPQVVLGAAFGWAIPMAFMASINAL----P--IQAWLLFIANI
UBIA_COLP3            VAVLLAAIYPFMKRHTQLPQLFLGAAFSWGMIMAFSEAQGEI----P--LVAWLLFTANL
UBIA_ACIAD            GALFLAFIYPFMKRYTHLPQVFLGAAFSWAIPMAYTATGQAP----D--LTCWLLYFGNL
UBIA_PSYCK            GAVILAFIYPFMKRYTHLPQVFLAAAFGWAIPMAYVAIQGAP----D--IWCWLLFLAYM
UBIA_ALCBS            GGLGLAVLYPFTKRFTFMPQLFLGAAFSWAIPMAFAAETGEV----P--EIAWLLYVANV
UBIA_IDILO            FAAGVAALYPFCKRWTHLPQIVLGIAFSFGIPMAFTALESDQ----W--FIAGLLFLANI
UBIA_PSEF5            GALALAACYPFMKRYTYYPQVVLGAAYSWGILMTFTAQNGEL----P--ATAWLLYIANL
UBIA_PSEPF            GGLALAFTYPFMKRYTYYPQVVLGAAFSWGMPMAFTAETGEL----P--ATAWLLWIANL
UBIA_PSEPK            GAVALAFCYPFMKRYTYYPQVVLGAAYSWGIPMAFTAAGGEL----P--AGAWLLYIANL
UBIA_PSESM            GGLALAACYPFMKRYTYYPQVVLGAAFSWGMPMAFTAETGEL----P--AAAWLLYIANL
UBIA_PSEAE            GAVAVASLYPFMKRYTYYPQVVLGAAYSWGILMAFTAERGEL----P--ASAWLLFLANV
UBIA_CHRSD            AALALAATYPFMKRYTHFPQVVLGAAFSWGIPMAFMAIQRQV----P--LEAWLLLAANV
UBIA_HAHCH            GALALASTYPFMKRHTYLPQVVLGAAFAWGIPMAFAAELDAV----P--QQAWLLYTATV
UBIA_SACD2            GGALLAFCYPFMKRYTQLPQIVLGAAFAWSIPMAFAAQTNQL----P--EAIWVLYTAVV
UBIA_METCA            PGAFLAASYPFTKRYTHLPQAYLGLAFGWAIPMTFAAQTGSI----P--VVAWALYAATV
UBIA_NITOC            AGALLAATYPFMKRYTHWPQAYLGAAFGWAVPMAFAAQTGTV----P--IAAWLLFIATV
UBIA_ALKEH            VAVALAATYPFMKRYTHFPQVHLGAAFGWAIPMAFAAQTGAV----A--PVAWLLFLSAV
UBIA_XANCP            PGLFLAASYPYLKRHTHLPQVYLGMAFGWGIPMGFAAVQGSV----P--LLAWLLYAANI
UBIA_XANOR            PGVFLAASYPYLKRHTHLPQVYLGMAFGWGIPMAFAAVQGSV----P--VLGWLLYAANI
UBIA_XYLFT            AGLFLAMTYPYLKRYTHLPQVYLGIAFGWGIPMAFAAIQGKV----P--TLAWLLYVANI
UBIA_SHEDO            VGIVLTIMYPFMKRVTNMPQMFLGIVWSWSIPMAYAAQLGEV----P--VEAWWLFAANW
UBIA_SHEFN            VGIILTVMYPFMKRVTNMPQMFLGIVWSWSIPMAYAAQLGEV----P--VEAWWLFMANW
UBIA_SHEON            VGIILTIIYPFTKRVTNMPQMFLGVVWSWSIPMAYAAQTGEV----P--IEAWWLFAANW
UBIA_COXBU            IGILLALVYPFLKRFTHLPQLWLGVAFSWSIPMAFAATVGHV----P--AVAWLLFFAAV
UBIA_BLOFL            IVLGLSIIYPYLKRYIYLPQLVLGIIFSWSILIVYTVMNCAV----N--KTTWLLFLANT
UBIA_BLOPB            VALILSWIYPYLKRYIYFPQVMLGLLFSWPILMAFTAINNPI----N--STAWLLFLMNT
UBIA_FRATO            VALFLAILYPFCKRFFAIPQLILGLAFNFGIFMAFSAIQNQI----P--VEAWIFYIATI
UBIA_HYDCU            GAVGLAILYPFMKRHTFWPQAFLGAAFAWAIPMAFAAIQNQV----P--WQAWVIFGVTL
UBIA_AROAE            PALFLAASYPYTKRFLAIPQAYLGIAFGFGIPMGFAAVQGEV----P--AIAWLLLLANI
UBIA_DECAR            PAVFLAASYPFTKRFFAIPQAYLGVAFGFGIPMAYAAHLGEV----P--AEAWWLLLANV
UBIA_THIDA            IALFLAGSYPFTKRFFAIPQAYLGVAFGFGIPMSYAALWGEV----P--AEAWLLLAANV
UBIA_NITEU            PALFLAASYPFTKRFFAMPQAYLGIAFSFGIPMAFAAQTGTV----P--PLAWLLVLANL
UBIA_NITMU            VALFLAASYPFTKRFFAMPQAYLGIAFSFGIPMAFAAQTGEV----P--FPAWFLMGANL
UBIA_METFK            PALFLAASYPLTKRFLSIPQAYLGIAFGFGIPMAFAAITGQL----P--LEAWILLLANV
UBIA_BURL3            VALFVAGSYPFMKRFFAIPQAYLGIAFGFGIPMAFAAVQDTV----P--TIAWVMLIANI
UBIA_BURTA            VAVFVAATYPFMKRFFAIPQAYLGIAFGFGIPMAFAAVQDTV----P--ALAWMLLAANV
UBIA_PARXL            AALFVAGSYPFTKRFFAIPQAYLGIAFGFGIPMAFAAIQNHV----P--MLAWVMLLANV
UBIA_CUPMC            VAAVLAGTYPFFKRFFAIPQAYLGIAFGFGIPMAFAAIQDQV----P--FVAWLMLLANV
UBIA_CUPPJ            VAAVVAGTYPFFKRFFAIPQAYLGIAFGFGIPMAFAAVQDQV----P--LVAWVMLLANV
UBIA_RALSO            AAVLIAGTYPFFKRFFAIPQAYLGIAFGFGIPMAYAAVQDQV----P--APAWLMLAANV
UBIA_POLSJ            AALAVTLAYPFAKRYVSMPQAVLGVAFSFGIPMAFAAVQSRV----P--LLAWVLLLGNL
UBIA_RHOFT            AALAITLAYPYAKRYVSMPQAVLGVAFGMGIPMAFAAVLGEV----P--RLAWLLMLGNL
UBIA_NEIG1            PALFLALTYPFTKRFFPIPQFYLGFAFSFGIPMAFAAVGNSV----P--VEAWILFAANV
UBIA_LEGPL            ISVLITFLYPFCKRFFNAPQLVLGLAFSMGIPMAFIASGKNL----N--SDFIVLFLINF
PLQA_SYNY3            AAVPVIVAYPGAKRVFPVPQLVLSIAWGFAVLISWSAVTGDL----T--DATWVLWGATV
Q8DLS6_THEVB          AAVPVILLYPLAKRVLPIPQLVLAVAWGFAVLIPWAAVQGRL----T--LTTAGLWAAVV
Q7NFU6_GLOVI          AAVPVIALYPGAKRVFPVPQLVLSLAWGFAALISWSAVTGGL----E--TPAWWLWGATV
A5GMW7_SYNPW          LALPPILFYPSAKRWFPFPQAILALCWGFAVLIPWAAATGSL----SISLPLLATWGATL
Q7VDC5_PROMA          MALVPILIYPSSKRWFRYPQVLLAFCWGFAVLIPWAASEHSL----NGGFPLLTCWLATM
A3PBH9_PROM0          VALPIILIYPSAKRWFKYPQLILSICWGFAVLIPWAANEGNL----N-SIVLLFCWLATI
Q3YRN9_EHRCJ          ITMILIVIYPLSKRFFAWPQFLLGLVFNSGVLLVCSMITGR-----L-TLSCILLYIGCI
S5PJB2_ANAPH          ICFCGVVLYPLMKRFFSYPQFVLGIVWNFGILIGSAMAANE-----V-KFGSILLYIGCI
Q4UAZ7_THEAN          LTGITCSIYPFMKRYIKYPQLVLGLSSSIGTLMAWTAISGNP----L-TMAPFCIYLTSS
Q4MYN9_THEPA          LTGVTCSIYPFMKRYIKYPQLILGLSSSIGTLMAWTAISGNP----L-TMAPLCIYLTSS
A7AM23_BABBO          LTAIGSCVYPFMKRYTNFPPLFLGLATNLSVYIAWSAIAPT-----F-TLAPSFLYIASN
C6V5S7_NEORI          FTIVGVVVYPFSKRYFAYPQLLLAVIFNVGALFASIVVVNS-----I-HASALFIYLACF
A8F2H7_RICM5          FAVIMISLYPLMKRITYFPQIFLGFTFKLGALIAYAAVQDTL------DIAAIIMYLACC
Q9ZCN7_RICPR          FAVIMIILYPLMKRITYFPQIFLGFTFKLGVLVAYGAVQDKL------DTEAIIMYLACC
W7X633_TETTS          GIVPIAALYPLFKRFTYYPQVVLGSCFNWGVMVGYAAAADMI----N-YNVAIPAYIGGV
A0A2D7AM03_9PROT      CVIPFIVIYPFMKRITWWPQLWLGICYNWGILVGYSVYNQYL----F-SIELILFYLGSI
Q383Z3_TRYB2          ALAPIAAVYPLMKRITYMPQLVLGLCFNGGIFVGYAAVLNRI----D-LAVTLPIYCSAV
V5BFC2_TRYCR          SIVPLVAVYPLMKRVTYMPQFFLGLCFNWGIFVGYAAVLNRV----D-LAVTLPIFCSGV
Q4Q8D4_LEIMA          AITPVWLMYPFMKRITYAPQFFLGLCFNWGIFVGYAAVLGRV----D-MAVCLPIYGGAV
A4HGH9_LEIBR          AVTPLWILYPLMKRITHAPQLFLGLCFNWGIFVGYAAVLGRV----D-MAVCVPIYCAAV
COQ2_DICDI            SSLPIVVLYPFMKRFTYYPQFVLGLAFNWGALAGYSAIAGSC----N-WSIVAPLYLAGI
D3BQE1_POLPP          ASVPIVIIYPFMKRYTYYPQFVLGCAFNWGALVGYSAVQGYC----D-WKICLPLYVAGI
Q3IZ43_CERS4          ASLALVCIYPFAKRFTWWPQAFLGLAFNWGALLLWAAHTGSL----G--WAPVALYASGI
Q9A2Y5_CAUVC          LSLALVAAYPFMKRITWWPQAWLGLTFNWGALLGYAAATGHL----S--WSAALLYASGI
I1S1K6_GIBZE          PTILATLYYPFAKRHTYFAQVVLGFCLTWGVMVGSSSMGVEAPWKQES---AVSLLLASN
M2UDD4_COCH5          PTIIGTIYYPFAKRHTNLPQLVLGFCLSWGIMVGSSAVGVTKPWTDPS---TVFLLVASI
C0NID8_AJECG          PSLLFVAAYPLAKRVTNYPQFVLGLTFSWGAIMGFPALNIDLLGNTNAILAASSLYSSCV
A0A0D8JX01_COCIM      PSLLLVATYPLAKRVTNYPQAVLGLTFSWGAIMGFPTLGIDLLANGGAAVAAASLYASCI
Q1K4Y3_NEUCR          PSLLFVASYPLAKRVTYYPQFVLGLTFSWGAIMGFPALGVDLLANQAALTAAGCLYTSNI
G2WTU9_VERDV          PSLLFVASYPLAKRVTYYPQAVLGLTFSWGAIMGFPALGVDLLANSAALTAAACLYSSNI
Q0USG0_PHANO          PSLLLVATYPLAKRVTYYPQFVLGLTFSWGAMMGFPALGIDLLLNQSALIAASCLYASNV
Q4WNJ5_ASPFU          PSLLLVTTYPLAKRVTYYPQAVLGLTFSWGAIMGFPALGVDLFSNHAALEAAAALYSSCV
D5GD53_TUBMM          PSLAVVTVYPLMKRATHYPQFVLGLAFSWGALLGFPALGLGL--DGPVMATAACLYGSNV
                              **  **        *.                                    

COQ2_HUMAN            MWTLIYDTIYAHQDKRDDVLIGLKSTALRFGENTKPWLSGFSVAMLGALSLVGVNSGQ--
F6XCH9_MACMU          MWTLIYDTIYAHQDKRDDVLIGLKSTALRFGENTKLWLSGFSVAMLGALSLVGVNSGQ--
H0WKB3_OTOGA          MWTLIYDTIYAHQDKRDDALIGLKSTALLFRENTKQWLGGFSAAMLGALSLVGVSSSQ--
G1T0N6_RABIT          MWTLIYDTIYAHQDKRDDALLGLKSTALRFRENTKQWLSGFGVAMLGALSLAGVSCDQ--
G3SN39_LOXAF          MWTLIYDTIYAHQDKKDDVLIGLKSTALRFRENTKQWLSGFSLAMLGALGLVGVNCDQ--
COQ2_BOVIN            MWTLIYDTIYAHQDKKDDALIGLKSTALLFREDTKKWLSGFSVAMLGALSLVGVNSGQ--
E2QT06_CANLF          MWTLIYDTIYAHQDKRDDALIGLKSTALRFQENTKQWLSGFGVAMLGALSLVGVNSGQ--
G1LEF8_AILME          MWTLIYDTIYAHQDKRDDALIGLKSTALRFRENTKQWLSGFGVAMLGALSLVGVNSGQ--
COQ2_MOUSE            MWTLIYDTIYAHQDKKDDALIGLKSTALLFQENTRQWLSGFGVAMVAALSLAGANNGQ--
COQ2_RAT              MWTLIYDTIYAHQDKKDDALIGLKSTALLFRENTKQWLSGFGVAMVGALSLVGASSGQ--
G1KKG5_ANOCA          LWTLTYDTIYAHQDRRDDLAIGVKSTALRFRENTKQWLSGFSTMMLLGLTVTGMNCDQ--
A3KNW5_DANRE          MWTLIYDTIYAHQDKDDDLKVGVKSTALRFQENTKLWLSGFTGAMLSGLLLAGVNADQ--
H3AS40_LATCH          MWTLIYDTIYAHQDKADDVLVGVKSTALRFNEQTKQWLAGFSAAMLAGLTLTGINCGQ--
W5MV33_LEPOC          MWTLIYDTVYAHQDKADDILVGVKSTALCFQEQTKPWLTGFSVAMLSGLILTGINSHQ--
G3PKM8_GASAC          MWTLIYDTIYAHQDKDDDIKIGVKSTALRFSEQTKPWLSGFAVAMLSGLVAAGVNAEQ--
A7RFI6_NEMVE          PWTIIYDTIYSHQDKSDDLAVGVKSAALLLGDQVKYWLSAFGAIMMTNMTIAGMACDQ--
B3RWH5_TRIAD          SWTLFYDTIYAHQDKDDDRFINVKSTALLFGDNTKHWLSLFAGITTTGLVLSGLSAHQ--
COQ2_DROME            CWTIVYDTIYAHQDKLDDLQIGVKSTALRFGENTKVWLSGFTAAMLTGLSAAGWACDQ--
COQ2_DROPS            CWTIVYDTIYAHQDKLDDLQIGVKSTALRFGENTKVWLSGFTAAMLTGLSTAGWACDQ--
Q7Q9Z4_ANOGA          CWTIVYDTIYAHQDKVDDLIIGIKSTALRFGDKTKLWLSGFTAAMIGNLLTAGLVCDQ--
W5J300_ANODA          CWTIVYDTIYAHQDKVDDLLIGIKSTALRFGDNTKLWLSGFTGAMMVNLMAAGAACDQ--
COQ2_AEDAE            CWTIVYDTIYAHQDKVDDALLGIKSTAIRFGDNTKLWLSGFSTAMIGGLVASGMVCEQ--
E0W2B5_PEDHC          SWTLFYDTIYAYQDVVDDLSLGIKSTAIKFGSDAKYYLSAFATIMISSLLLAGYNSSQ--
COQ2_CAEEL            QWTLIYDTIYAHQDKADDIMIGVKSTALRLGADTKKWLSAFGVGTVASLTACGIASDQ--
COQ2_ARATH            CWTLVYDTIYAHQDKEDDVKVGVKSTALRFGDNTKLWLTGFGTASIGFLALSGFSADL--
F6HF43_VITVI          CWTLVYDTIYAHQDKEDDLKVGVKSTALRFGDSTKEWLSGFGIACISSLALSGFNADL--
B9H5T1_POPTR          FWTLVYDTIYAHQDKEDDLKVGVKSTALLFGDSTKEWISGFGIACIGGLALSGFNADL--
M1C9U9_SOLTU          FWTLVYDTIYAHQDKEDDLKVGVKSTALRFGDSTKEWISGFGLACISSLALSGINADI--
K3YSY7_SETIT          CWTLVYDTIYAHQDKEDDLKVGVKSTALRFGDLTKYWISGFGAACICSLALSGYNADL--
B6T4K7_MAIZE          CWTLVYDTIYAHQDKEDDLKVGVKSTALRFGDLTKYWISGFGAACVGSLALSGYNADL--
Q6ZAH2_ORYSJ          CWTLVYDTIYAHQDKEDDLKVGVKSTALRFGDLTKHWISGFGVACIGSLALSGYSADL--
I1IFN5_BRADI          CWTLVYDTIYAHQDKEDDLKVGVKSTALRFGESTKQWISAFGAASIGSLALSGYNAEL--
A0A804HRS2_MUSAM      CWTLVYDTIYAHQDKEDDQKVGVKSTALRFGSSTKYWITGFGIACISNLALSGYNAEL--
D6RMJ5_COPC7          CWTLVYDSIYAHQDKLDDVHAGIKSTALLFADKTRSILTGLSLSSMSLVSYAGYLNHQ--
D0MXD0_PHYIT          AWTLVYDTLYAHQDKKDDIKIGVRSTALLFGDKTKPVLNLFSAATIAGFGTAGYMAGL--
H9JR35_BOMMO          GWTVHYDTIYAHQDKKDDARIGIKSTALTFGRHTRAALGAVLAASGVSFAAAGPAAGL--
COQ2_YEAST            LWCMTYDTIYAHQDKKFDIKAGIKSTALAWGPRTKSIMKAMSASQIALLAVAGLNSGLL-
Q751D7_ASHGO          LWCMTYDTIYAHQDKAFDIKAGIKSTALRWGDRTRGICAGMATAQIGLLALAGANSGLL-
C4R445_KOMPG          AWCMTYDTIYAHQDKKFDVKAGIKSTALAWGDKSKPIMYGLTTIQMATFALSGYMNSM--
A0A1D8PU83_CANAL      IWCLTYDTIYAHQDKKFDIKAGIKSTALAWGDKTKPIMKGLTVAQAGFYGFAGFMNSM--
Q6C2S2_YARLI          LWCMVYDTIYAHQDKVFDVEAGIKSTALAWGDNSKSIMTVLTLGQLGLLFGAGVYADM--
COQ2_SCHPO            SWIVLYDTIYAHQDKRDDVKANIYSTALRFGDNTKPVLCGLAALQIATLATAGIMNGQ--
E3L3S4_PUCGT          CWTIVYDTIYAQQDKKSDVLAGVKSTALLFGARPVPILAGFSTAFVGFTALSGFMNGC--
UBIA_ECOLI            LWAVAYDTQYAMVDRDDDVKIGIKSTAILFGQYDKLIIGILQIGVLALMAIIGELNGL--
UBIA_SALCH            LWAVAYDTQYAMVDRDDDIKIGIKSTAILFGRYDTLIIGILQLGVMALMALIGWLNGL--
UBIA_SODGM            TWTVAYDTQYAMVDRDDDLRIGVKSTAILFGRFDKLIIGLLQLATLLLLGVIGWQLGL--
UBIA_YERPS            CWTVAYDTQYAMVDRDDDLRIGVKSTAILFGQHDKLIIGLLQLATLLLMVAIGWLMNL--
UBIA_PHOLL            FWSVIYDTQYAMVDRNDDLKIGVKSTAILFGRFDKLIIGLLQLAMLLLLVLVGYLINL--
UBIA_PROST            LWSVIYDTQYAMVDRNDDLKIGVKSTAILFGQYDKLIIGILQIVMIVLLVLVGSLADL--
UBIA_PECAS            CWTVAYDTQYAMVDRDDDLKIGVKSTAILFGRFDNIIIGLLQFSMLALLLALGNITGL--
UBIA_HAES1            SWTVAYDTQYAMVDRDDDLRIGVKSTAILFAQYDNKIIALLQIITLIFLFSVGYLSQL--
UBIA_PASMU            AWTVAYDTQYAMVDRDDDLRIGVKSTAILFAQYDNKIISLLQIVTLFFLGLIGYLSQL--
UBIA_HAEDU            LWTVAYDTQYAMVDRDDDLRIGVKSTAILFAQYDNKIIALLQFLSLILFILFGWLSEY--
UBIA_PHOPR            LWTIAYDTQYAMVDRDDDLKVGIKSAAILFGRFDKIIIGVLQLSTLVTMILIGHSLDL--
UBIA_ALIF1            LWTIAYDTQYAMVDRDDDVKIGIKSTAILFGRYDKTIIGLLQLSVLALLIVLGSQLAL--
UBIA_VIBPA            LWTIAYDTQYAMVDRDDDLKIGIKSTAILFGRHDKLIIGVLQLVTLAMLVGLGQFYQL--
UBIA_VIBVY            LWTIAYDTQYAMVDRDDDIQIGVKSTAILFGRHDKLIIGLLQLLTLVMLVWLGLHYQL--
UBIA_VIBCH            LWTIAYDTQYAMVDRDDDVKIGIKSTAILFGRWDKRIIGLLQLATLSLLVALGQGLAL--
UBIA_PSEA6            LWTVAYDTQYAMVDRNDDLQIGVKSTAVLFGQYDRLIIGLLQLSVVVMLLGMGQYLGF--
UBIA_PSET1            CWTVAYDTMYAMVDRDDDLKIGVKSTAILFGKYDRHIIGLLNLAFIALMLSIGALNNI--
UBIA_COLP3            CWTIAYDTMYAMVDRDDDVKIGVKSTAILFAENDKRVIGFLQLMTLALLWTVGDILAF--
UBIA_ACIAD            AWTVAYDTQYAITDREYDLKIGVKSTAILFNRFDIPIISTLQLSSLLLIGMALYIENL--
UBIA_PSYCK            CWTVAYDTQYAMADREDDIKIGVKSTAILFDRYDVIIISLLQTLFLVIMGAVMWHYFA--
UBIA_ALCBS            LWTVAYDTEYAMCDREDDLKLGIKSTAILFGDADRLMIAILQALTLLALIMVGHRLGF--
UBIA_IDILO            LWTVAYDTEYAMADREDDLKIGLQSTAILFGRFDRLAIGLLQLATLALLGWILHLITV--
UBIA_PSEF5            LWTVGYDTYYAMTDRDDDLKIGVKSTAILFGDADRVIILTLQGLSLGCLLLAGARFNL--
UBIA_PSEPF            LWTVGYDTYYAMTDRDDDLKIGVKSTAILFGDADRVIILTLQVLSLGCLVLAGSKFEL--
UBIA_PSEPK            LWTVGYDTYYAMVDRDDDLKIGVKSTAILFGDADRSIILTLQLLSLGCLLLAGSRFDL--
UBIA_PSESM            LWTVGYDTYYAMVDRDDDLKIGVKSTAVLFGDADRVIILSLQGLALGCLALAGSRFEL--
UBIA_PSEAE            LWTVAYDSYYAMTDREDDLKIGIKSTAILFGDADRLIIGSLQGLTLLLLVLAGNRFEL--
UBIA_CHRSD            AWTVAYDTEYAMVDRDDDLKVGIKSTAVLFGRADRLMIGLLQALTLLLLAWVGLRLAL--
UBIA_HAHCH            VWTVAYDTMYAMADREDDLKIGVKSTAILFGEADRAAVAGLQVLTLGVLFMVGAQHEL--
UBIA_SACD2            LWTVAYDTFYAMADREDDLKIGVKSTAILFGDQDRIITACLQLMALVAMAMAGERFGL--
UBIA_METCA            LWALIYDTMYAMVDREDDVKIGIKSTAILFGKYDREIIGALQIAMLAILAGIGRYLGL--
UBIA_NITOC            LWATVYDTFYGMVDREDDLLIGVKSTAILFGEGDRLVTALLQGALLLLLFWIGYREGL--
UBIA_ALKEH            LWATIYDTQYAMVDRDDDLKIGVKSTAVLFGQADRAIIGVLQGVMLAVLVAAGLVVGL--
UBIA_XANCP            LWATAYDTWYAMVDREDDLRMGSKSTAILFGRYDLIAQGVLYALMFAALVLVGLRAGL--
UBIA_XANOR            LWATAYDTWYAMVDRDDDIRMGSKSTAILFGRFDLVAQGILYALMFAVLALVDLRADL--
UBIA_XYLFT            LWTTAYDTWYAMVDRDDDIKMGAKSTAILFADLDLVVQGVLYTLMLLTLCLVGLRATL--
UBIA_SHEDO            CWTVAYDTMYAMIDRDDDLKVGIKSSAILFGRFDRQWIAVFQLMAFGCFLMAGLSAER--
UBIA_SHEFN            CWTVAYDTMYAIVDRDDDLKVGIKSTAILFGRFDRQIIGVFQLAALGCFVMAGLVADR--
UBIA_SHEON            FWTVAYDTMYAMVDRDDDLKIGIKSTAILFGKYDRQIIGLFQIAALFCFVAAGWSADR--
UBIA_COXBU            LWPIVYDTQYAMIDREDDVKVGIKSTAILFGRYDRLMIGLLQGSVLLTFGLLGWYLRF--
UBIA_BLOFL            IWVVLYDTEYAMVDRDDDKCIGIKSSALLFGKIDKIVIGILQLLTVFILYIIGIVEQL--
UBIA_BLOPB            VWTIVYDTQYAMIDREDDIYVGIKSSAVLFGDMDKFLIGILQLCIVFILGIIGWKERF--
UBIA_FRATO            CWTIAYDTIYALADREFDLETGIKSSAVLFGNKVFRYILLFNFLSLLLLIILGIYCDF--
UBIA_HYDCU            VWALVYDTAYAVADKEDDVKLGIKSTAILFGDRVQEIIGFFQAIMLLGFLWIGDLFGL--
UBIA_AROAE            FWAVAYDTEYAMVDRPDDLKIGIKTSAITFGRFDVAAVMLCYAVAFGLIAAVGIATGR--
UBIA_DECAR            FWAVAYDTEYAMVDRDDDLKIGIKTSAITFGRFDVAAVMLCYGVTLAIIGGIGYSLNR--
UBIA_THIDA            FWAIAYDTEYAMVDRADDLKIGIKTSAITFGRFDLTAIAFCYAATLALLAWVGALRDF--
UBIA_NITEU            FWVIAYDTEYALVDRADDLKIGIRTSAITLGRFDVAGILLCHIIFLSTLTYAGILLQR--
UBIA_NITMU            LWVIAYDTEYAMVDKVDDLRIGIKTSAITFGRFDVVGVVLCHMAFLAGMVAIGLLQNL--
UBIA_METFK            FWAIAYDTEYAMVDRNDDLNIGIRSSAIFFGRLDVFAVMACYGAFLILMAWVGVRLQQ--
UBIA_BURL3            FWSVAYDTEYAMVDRDDDIKIGIRTSALTFGRFDVAAVMLCYAVTLGIYVWIGVTLGF--
UBIA_BURTA            FWSVAYDTAYAMVDRDDDLKIGMRTSAITFGRYDVLAIMLCYAAMLGIYVWVGVTQHF--
UBIA_PARXL            FWSVAYDTEYAMVDRDDDIKIGIRTSALTFGRFDVAAIMLCYAVTLGIYVGIGVLLGF--
UBIA_CUPMC            FWAIAYDTAYAMVDRDDDLLLGMKTSAITFGRFDVAAIMICYAVFLGLMAWAGSLLGL--
UBIA_CUPPJ            FWAVAYDTAYAMVDRDDDLLIGIKTSAITFGRFDVAAIMLCYAAFLVLMGWAGVMLSL--
UBIA_RALSO            LWAIAYDTAYAMVDRDDDLLIGIQTSAITFGRFDVAAIMLCYAGFFGIMAWVGHALAL--
UBIA_POLSJ            CWVIAYDTEYAMVDRDDDLKIGMKTSAITLGRFDVAGVMLSYLVYLSVWALALADIPQ--
UBIA_RHOFT            FWVLAYDTEYAMVDRDDDIRLGLKTSAITLGRLDVPVILLCYLAFIVIWDVALMPYVQ--
UBIA_NEIG1            LWTLAYDTVYAMADKEDDLKIGIKTSAVTFGRYDIAAVMLCHGGFTLLMAVLGAVIGA--
UBIA_LEGPL            SWIIAYDTMYAMTDKADDLKIGVKSTAIYFASYDRLIIALLLIFLHSLWLVWAINKNV--
PLQA_SYNY3            FWTLGFDTVYAMADREDDRRIGVNSSALFFGQYVGEAVGIFFALTIGCLFYLGMILML--
Q8DLS6_THEVB          MWTLAFDTVYAMPDRPDDRRLGVNSSALFFGAYAPLAIALFYALTVVFLMMVGVRAGL--
Q7NFU6_GLOVI          LWTLGFDTVYALSDREDDLKIGINSSAIFFGRFTPEAIAAFFAGAALCLAVVGYQLEL--
A5GMW7_SYNPW          CWTFSFDTVYAMADRVDDAKLKLRSSALTLGDSAVRVVRAGYGLTAAGLAMAAAATQA--
Q7VDC5_PROMA          VWTFGFDTVYAMADKDDDKKLGLQSSALSLGQKALKSVFICYALTSTLIAFSALTKDI--
A3PBH9_PROM0          FWTFGFDTIYALADKKYDIKIGINSSAVNLQNNTRITIQICYFLTSCFLALCGFINQM--
Q3YRN9_EHRCJ          FWTIGYDTIYAAQDRECDAKLGLNSTALRFGNDIRLWIGRVYTITVAMWMSAGVVAML--
S5PJB2_ANAPH          FWTTAFDTIYAHQDKVDDARLGLGSTALKFGDNTGLYVKRLYILTITMWVCAGVVSSL--
Q4UAZ7_THEAN          LWSLIYDTVYAHQDKNDDIKLGLGSLAIEWGDNTKKMCNIIAYNMSILMASCGYLAHL--
Q4MYN9_THEPA          LWSLIYDTVYAHQDKNDDIKLGLGSLAIEWGDKTKKMCNIVAYNMSILMATCGYLAHL--
A7AM23_BABBO          LWTLIYDTVYAHQDLKYDRKIGVKSLAIYWGDNTKKNCKLCSIGISTLLVAAGYASGL--
C6V5S7_NEORI          FWTLYYDTIYGHQDKRYDAALGVHSLSLGKFG-SKEWLKKYARLALSFLAFSAVLPGL--
A8F2H7_RICM5          FWAIGYDTIYGYMDIKDDKKIGVKSLSIYLENKHSKLWLYICYIGFILLFILATKMAN--
Q9ZCN7_RICPR          FWAIGYDTIYGYMDIKDDKKIGVKSLSIYLENKNPKFWLYICYIGFILLFILATKIAN--
W7X633_TETTS          LWTLIYDTIYAHQDKLDDIKVGVKSTALAWGENTKNVMYGLWGTQLSLFLYAGIQGGL--
A0A2D7AM03_9PROT      LFTLGYDTVYGYQDLKDDQIIGVKSTSLKFKDKPKLFLFIVYITAFTLWINAMFVLNK--
Q383Z3_TRYB2          VWTVLYDTIYAYQDRADDLKCGVKSSAILIGDR-KHILTFMILPIGMGILISGLMVSQ--
V5BFC2_TRYCR          VWTILYDTIYAYQDRDDDMKCGVKSSAILIGDR-KYILTLMIFPVGLGILISGLMVSQ--
Q4Q8D4_LEIMA          IWTILYDTIYAYQDRRDDLKCGVKSTAIWIGDR-KYILNAMVAPIGASMLISGFLASQ--
A4HGH9_LEIBR          IWTILYDTIYAYQDRRDDLKCGIKSTAIWIGDR-KYILSAMVAPIGGGMLISGFLASQ--
COQ2_DICDI            SWTMVYDTIYAHQDKRDDILVGVKSTALKFAEKSRIILSVFSGLVISGMFLTGIAANM--
D3BQE1_POLPP          SWTMVYDTIYAHMDKKDDLSIGVKSTALAFGEKSRLILTGFSVATIAALNLAGLAAGL--
Q3IZ43_CERS4          AWTLFYDTIYAHQDKEDDALIGVRSTARLFGQHTGKWLVAFMMAATLLMTLAVLLTVLPQ
Q9A2Y5_CAUVC          FWTLGYDTIYAIQDIEDDALAGIKSSTRRLGQHVQIGVAGFYLVSFILLVIAGWM-----
I1S1K6_GIBZE          LWVILFDTVYAHQDLEDDLKVGVKSLAVLFNGRARPLLWTLFLGMCTCLYWCGVTGGL--
M2UDD4_COCH5          LWVILFDTIYAHQDLADDVKMGVKSIAVLFRHHAKALLWALFLGMIASLLASGYHGQL--
C0NID8_AJECG          AWTVLYDTIYAHMDIKYDAAAGIKSIALKHEHNTKAILSALAVTQVTLLAAAGVAVNA--
A0A0D8JX01_COCIM      AWTILYDTIYAHMDVKDDAAAGIKSIALKHQGDTKAILSGLAVAQVGLLAAAGVAVGS--
Q1K4Y3_NEUCR          AWTVLYDMIYAHMDIKDDAKAGIKSIALKHDKETKQVLTGLAVAQIALLAGAGAAVGA--
G2WTU9_VERDV          AWTVLYDMIYAHMDIKDDAKAGIKSIALKHDADTKKVLTGLAAVQIGLLGAAGVAAGA--
Q0USG0_PHANO          AWTVLYDMIYAHMDIKDDAKAGIKSIALKHENETKAVLSGLAVVQLGLLATSGFAAGL--
Q4WNJ5_ASPFU          AWTVLYDMIYAHMDIKDDVAAGIKSIALRHEHNTKTVLSGLAAVQVALLATAGVAAGA--
D5GD53_TUBMM          AWTVVYDIVYAHQDVRDDVKAGVKSIVVKHEAYTKYLMSALGAAQVGLLASAGAVAGC--
                       :   :*  *.  *   *      :                                   

COQ2_HUMAN            -TAPYYA----ALGAVGAHLTHQIYTLDIHR----------PEDCWNKFISNRTLGLI--
F6XCH9_MACMU          -TAPYYA----ALGAVGAHLTHQIYTVDIHR----------PEDCWNKFISNRTLGLI--
H0WKB3_OTOGA          -TAPYYA----ALLAVGAHLAHQIYTLDIHR----------PEDCWDKFTSNRTIGLI--
G1T0N6_RABIT          -TAPYYA----ALVAVGAHLAHQIYTLDIHR----------PEDCWDKFTSNRTVGLL--
G3SN39_LOXAF          -TAPYYI----ALAAVAGHLTHQISTLDIHR----------PEDCWDKFASNRTIGLI--
COQ2_BOVIN            -TMPYYT----ALAAVGAHLAHQIYTLDINR----------PEDCWEKFTSNRTIGLI--
E2QT06_CANLF          -TAPYYT----ALAAVGAHLAHQIYTLDIHR----------PEDCWDKFTSNRTLGLV--
G1LEF8_AILME          -TAPYYT----ALAAVGAHLAHQIYTLDIHR----------PEDCWDKFTSNRTLGLI--
COQ2_MOUSE            -TVPYYA----AVAAVGAHLAHQIYTVDIHR----------AEDCWDKFTSNRTVGML--
COQ2_RAT              -TLPYYA----AVAAVGAHLAHQIYTVDIHR----------AEDCWEKFTSNRTVGLL--
G1KKG5_ANOCA          -TFPYYA----AVTAVGFHLARQIYTLDIHS----------PEDCWKKFSSNRTVGLL--
A3KNW5_DANRE          -TAPYYC----AVSAVALHLAHQIYSVDINR----------PEDCWKKFASNRNLGLL--
H3AS40_LATCH          -TLPYYA----AVAAIGTHLAHQVYTLDINK----------PEDCWRKFASNRTVGLV--
W5MV33_LEPOC          -TLPYYG----ALSVVAIHLVYQVYSLDINK----------PEDCWEKFESNRNLGLL--
G3PKM8_GASAC          -TLPYYA----VLSAVATHLTHQIYTLDINK----------PEDCWKKFSSNRNLGLL--
A7RFI6_NEMVE          -TWPYYT----SLALAAAHLTWQIKTVDLSN----------DEDCFEKFKSNKWLGLL--
B3RWH5_TRIAD          -TWPYFA----AVGGGFAHLLYQIYSVNISN----------TDSCLKVFKSNMWYGLI--
COQ2_DROME            -TVPYYA----AVGVVGAHLVQQIYSLNIDN----------PSDCAKKFISNHQVGLI--
COQ2_DROPS            -TLPYYA----AVGVVGAHLVQQIYSLNIDN----------PTDCAKKFLSNHQVGLI--
Q7Q9Z4_ANOGA          -TWPYYT----SIGLIGAHLAHQIHSLNIHN----------PKDCATKFISNHQVGFL--
W5J300_ANODA          -TWPYYT----SVGLIAAHLAQQIHSLNIHN----------PTDCATKFISNHQVGLL--
COQ2_AEDAE            -TWPYYS----AVGVISAHLAHQIYSLNIDN----------PTDCATKFISNHQVGLI--
E0W2B5_PEDHC          -TFCYYF----SVAAAATHLGLQVKTLDIDQ----------PIDCWKKFISNRYLGGI--
COQ2_CAEEL            -TWPYYV----ALAATTAQLGWQVGTVDIDN----------GSDCWDKFKSNSWMGII--
COQ2_ARATH            -GWQYYA----SLAAASGQLGWQIGTADLSS----------GADCSRKFVSNKWFGAI--
F6HF43_VITVI          -GWPYYV----ALMAASGHLTWQIWTVDLSC----------RADCNRKFVSNKWFGAI--
B9H5T1_POPTR          -GWPFYA----FLAAGSGQLAWQIWTVNLSC----------PADCSRKFVSNKWFGAI--
M1C9U9_SOLTU          -GWPYYA----FLTAASGQLAWQIWTVDLSS----------RADCNRKFVSNKWFGAF--
K3YSY7_SETIT          -GWPYYP----FLSAAAVQLAWQISTVELSN----------RSDCNRKFVSNKWFGAL--
B6T4K7_MAIZE          -GWPYYP----FIAAAAAQLAWQVSTVDLSS----------RSDCNKKFVSNKWFGAL--
Q6ZAH2_ORYSJ          -AWPYYP----FLAAASAQLAWQISTVDLSD----------RLDCNRKFVSNKWFGAL--
I1IFN5_BRADI          -AWAYFP----FLTAAAAQLAWQISTVDLSD----------RADCNRKFVSNKWFGAL--
A0A804HRS2_MUSAM      -AWPFYP----FLVAAAGQLGWQILTVDLSN----------RADCNRKFVSNKWFGAL--
D6RMJ5_COPC7          -TEPFYA----GVALGLAQLGRILYRTDFED----------RKSCWEGFASSGWVGFW--
D0MXD0_PHYIT          -DWPFFL----GLTGGAAHLAWQVNTAKLDD----------PINLQARFASNKWFGAL--
H9JR35_BOMMO          -GPLYHA----AVLAYVAAAARQIYTLKTDD----------AKDCADKFKSNSSFGFL--
COQ2_YEAST            WGPGFIG----GLGVFAYRLFSMIKKVDLDN----------PKNCWKYFNANINTGLY--
Q751D7_ASHGO          LGPGFAA----GLGIFAYRLYAMIRNVDLDS----------PADCWRWFQSNIRTGLY--
C4R445_KOMPG          -GPGFAL----GAIIGGYRVFQMVRKVDLDN----------PKDCWYHFRNNINNGHI--
A0A1D8PU83_CANAL      -GPGFYI----AGAYAIARLYNQILKVDLDN----------PKSCWSAFTSNIGTGFI--
Q6C2S2_YARLI          -GPGFYS----AFTWVSYRLGKMIKTVDLDD----------PVDCGKHFRSNINTGHI--
COQ2_SCHPO            -GPVFYTL---GVAGAAYRLSSMIYKVDLDD----------PKDCFRWFKRNSNTGYL--
E3L3S4_PUCGT          -GIPFYSL---AVIAPAIHLAHLLANLQPDS----------PSACHSSFIASAITGSL--
UBIA_ECOLI            -GWGYYW----SILVAGALFVYQQKLIANRE----------REACFKAFMNNNYVGLV--
UBIA_SALCH            -GGGYYW----AVLVAGALFVYQQKLIANRE----------REACFKAFMNNNYVGLV--
UBIA_SODGM            -GRIYYL----ALAGAAGLFLWQQKLIVDRE----------REACFRAFLNNNLVGML--
UBIA_YERPS            -GGAFYW----SILLAGALFTHQQKMIAQRE----------REPCFRAFLNNNYVGLV--
UBIA_PHOLL            -GGIYYW----SLLLTGTLFIYQQKLIAGRE----------RELCFQAFLNNNYVGLV--
UBIA_PROST            -GAVYYI----ALSLSALLFIYQQKLMVDRE----------RAPCFKAFLNNNYVGLI--
UBIA_PECAS            -GIPYTI----SLLVAAGMFIYQQILTAGRE----------RDACFKAFHNNKYAGMA--
UBIA_HAES1            -NNRYFI----VLAIAGLFFVYQCRLTKNRD----------RASCFNAFLNNNYFGLT--
UBIA_PASMU            -HTSYFV----VLFLATLLFVYQCKLIKDRE----------RESCFKAFLNNNYFGAM--
UBIA_HAEDU            -HIGYFI----VLALTSTLFIYQCWLTKQRV----------REQCFKAFLNNNYFGFG--
UBIA_PHOPR            -HQIYYW----FLLMASGLFVYQQRLIGSRE----------REPCFKAFLNNNYVGML--
UBIA_ALIF1            -SGIYYW----GILAAAGFFVYQQWLIKGRE----------REACFKAFLNNNYVGGL--
UBIA_VIBPA            -GQSYYW----TVLIAASLFVYQQHLIRHRE----------RDLCFRAFLNNNYVGMV--
UBIA_VIBVY            -GQSFYW----SVLAAGALFVYQQHLIRHRQ----------RELCFQAFLNNNYVGMV--
UBIA_VIBCH            -GTSYYW----GLLIAAGLFAYQQHLIRYRE----------RMPCFQAFLNNNYVGMA--
UBIA_PSEA6            -TLSFYV----GVLLASVLFIHQQRLISGRA----------RQACFSAFLNNNYVGMA--
UBIA_PSET1            -GLSYWL----GLSVAIVLLVYQQVLIQQRA----------RTDCFKAFLNNHYVGLA--
UBIA_COLP3            -GWPYQL----CIIAAAGLFSYQQLLIVNRE----------RDACFQAFLHNHWVGLV--
UBIA_ACIAD            -LFPWGI---IGLVVVAVDFIYQWTKTKNRD----------PQLCFWAFRHNRWVGLI--
UBIA_PSYCK            -PTSLGITPVFGLALVAMMFAKQNSACASRN----------ALACFKAFLANIWVGRY--
UBIA_ALCBS            -SWPWYA----GLVGMSLSFAFQHSLIRYRE----------RWPSFHAFLNNHWAGAC--
UBIA_IDILO            -ELWVWL----ALAAIFLLFAYQHWLIRHRE----------PGKCFQAFLHNHYIGMV--
UBIA_PSEF5            -GGWFHL----GLAVAAACFAWEFWYTRDRD----------RMKCFKAFLHNHWAGLA--
UBIA_PSEPF            -GMWFHL----GLLVAAGCYAWEFWYTRDRD----------RMRCFRAFLHNHWAGLA--
UBIA_PSEPK            -GGWFHL----GLLGAAACFAWEYWSTRKLD----------RESCFKAFLHNHWAGML--
UBIA_PSESM            -GAFFYM----GLLVAAACFAWEFWSTRLRE----------RDACFKAFLHNHWAGLA--
UBIA_PSEAE            -GLCFYL----GLAVAAACFVWEAWSTRDRD----------PQACFRAFLHNHWAGLA--
UBIA_CHRSD            -GGFFWL----GLAAMGAIFVFQHRLIRHRE----------RDHCFRAFLNNHWAGLV--
UBIA_HAHCH            -GVYYQV----SLIIVAVLFVYQQHLIRDRS----------SQHCFKAFLNNHWVGAA--
UBIA_SACD2            -GFSFKV----SLLVAGGLFAYQQYLIRNRE----------PNACFRAFLHNNWVGLV--
UBIA_METCA            -GGLYAL----GLAAAAGFSVYQQVLIFRRE----------KSKCFRAFLNNHWFGAA--
UBIA_NITOC            -GFYYYL----GLAIAAGFAGYQQYLLRSRE----------PAQYFRAFLNNNAFGAV--
UBIA_ALKEH            -GAFWYL----GLAAAAALFAYQQWLIRERR----------REDCFRAFLNNNWLGGL--
UBIA_XANCP            -SIAYWA----GLGIAALLVAYEFHIARHRE----------RGPCFRAFLHNNWVGLA--
UBIA_XANOR            -GAAYWA----GLGVAALLVAYEFRIARHRE----------RGPCFRAFLHNNWVGLA--
UBIA_XYLFT            -SHTYWI----SLISAVALIGYQFIIARRRE----------PTACFRAFMHNNWVGMT--
UBIA_SHEDO            -EFIYAL----GLLGFIAFSVYQQRLIFSRE----------RPACFKAFLNNNWVGML--
UBIA_SHEFN            -GVIYGL----GIISFIGFAVYQQRLIFGRE----------RAPCFKAFLNNNWAGMV--
UBIA_SHEON            -GLVYGL----GLLTFVGFSTYQQMLIFGRE----------RAPCFKAFLNNNWAGLV--
UBIA_COXBU            -NYWFYL----GLLVALGLMCYQQFLIRHRK----------PPDCFAAFRNNNWVGFF--
UBIA_BLOFL            -PIIFYL---FSIVGASILFIWQQVLIFNRN----------REKCLWAFLSNSYVGML--
UBIA_BLOPB            -TVVFYF---FSLFGVIILFMWQQILINKRK----------RIRYFQAFLSNNYVGML--
UBIA_FRATO            -NSFFYL----GVVICSLFFVRNYFLYKKLG----------ITNCINAFSANHWIGLI--
UBIA_HYDCU            -SWLYYG----SVLIAAGFFVYHQYLLSFDQ----------PQKAFKAFLNNHWVGLV--
UBIA_AROAE            -GPWFFG----GIAIAAAIAIYHYTLIRDRD----------RARCFRAFLHNNWVGAV--
UBIA_DECAR            -GPAFYA----GLAVATCIMGVHYTWIRGRE----------RMPCFKAFLHNNWVGLS--
UBIA_THIDA            -SGWYYA----GLAAAGAIAVYHLRLIRERD----------PRQCFRAFLHNTWFGAA--
UBIA_NITEU            -GIWFYG----ALLVALGLVIVQYGMIRKRE----------PSRCFQAFLHNNWIGAV--
UBIA_NITMU            -GVIYYI----GLATALGLILYQYRLIHDRD----------RARCFKAFLHNNWVGAT--
UBIA_METFK            -SWPYFA----GLGVAALVALYHYALIRDRD----------RQSCFKAFLHNNWLGAA--
UBIA_BURL3            -GLAYWA----GWAAAVGCALYHYTLIKDRE----------RMPCFAAFRHNNWLGGV--
UBIA_BURTA            -GWPYWA----GWAAAAGCSIYHYTLIKDRE----------RMACFAAFRHNNWLGGA--
UBIA_PARXL            -GALYWL----GWAAAAGCAIYHYTLIRNRE----------RMACFAAFRHNNWLGGA--
UBIA_CUPMC            -GWPYYA----GLVAAAGMAGYHYTLIRERD----------RMKCFAAFRHNNWLGAC--
UBIA_CUPPJ            -GWPYWV----GLAAAAVCAGYHYTLIRDRD----------RMRCFAAFRHNNWLGAC--
UBIA_RALSO            -GAAYWI----GLAAAAALAGYYYTLLRTRD----------RMQCFFVFRHNNWFGAC--
UBIA_POLSJ            -AAIYWM----AIGLAGLQALWHGWLIRKRE----------RDDCFKAFRLNHWLGFT--
UBIA_RHOFT            -GALFTI----AFALAFGQVAWHYTLIRSRS----------REGCFKAFRLNHWLGFT--
UBIA_NEIG1            -AWAYWT----AIPIVLLLQYRQYAAIKSRV----------RQICFETFLANNRIGWV--
UBIA_LEGPL            -ECFFYL----LWCTAAGILTYQLKLIYARI----------PKNCFKAFLVSGYYGLV--
PLQA_SYNY3            -NPLYWL----SLAIAIVGWVIQYIQLSAP--------TPEPKLYGQIFGQNVIIGFV--
Q8DLS6_THEVB          -TWRFWL----ALAVTTYFWLRQSLQIYTHERRDTQTTTLPIQTYGRYFNENVWLGFL--
Q7NFU6_GLOVI          -GSIFYV----CLIVATLFWWREYRSLVTG---------DDPARFNRIFNENVTVGFV--
A5GMW7_SYNPW          -GVIFWI----VWAVACIGFWRSTLPLKAKK-------QQAPSVYANHFARQVQLGSL--
Q7VDC5_PROMA          -GIIFWP----FWLIASIGMQKEVFSLKEL--------EANTNKFGKHFRNQVFLGGL--
A3PBH9_PROM0          -DFIFWP----IWLTTSILMQRDILKVFPEE-------KQSIKNIGNHFKNQSIYGGV--
Q3YRN9_EHRCJ          -HPVFYI----AVLIIAVIFYYQYKKSDFDN----------SEKCMYMFNMNAYIGLV--
S5PJB2_ANAPH          -SWPYYV----FILKSAGVFYYQWRKTDFDN----------PARCMYMFKTNIYAGIL--
Q4UAZ7_THEAN          -TDLFYV----SVVLSHLWMLREIKKVDLNN----------PANCLLFFKKSTIYGGL--
Q4MYN9_THEPA          -TDLFYV----SVVISHLWMLREIKKVDLSD----------PANCLLFFKKTTIYGGL--
A7AM23_BABBO          -NNWYYG----LIALSHFWMNRQINAVDLKD----------AKQCLSFFKRSVIYGAL--
C6V5S7_NEORI          -NLLYYI----GLAALFFMEEKFTESINLDD----------PKNCGIAFKRMNFVGVL--
A8F2H7_RICM5          -HNIDYL----PILAALILLILQVATLDIEN----------PANCMTRFRANNYIGLV--
Q9ZCN7_RICPR          -FNIDYL----PVLAALILLILQIATLDIKN----------PVNCIKRFSANNYVGVL--
W7X633_TETTS          -GLPFFP----CCLASHLYLFRLIQDFNMDD----------PKTCWNFFVYNKNFGLL--
A0A2D7AM03_9PROT      -SNITIF----IFTLSCLLIIIKVLKTDINN----------VIDCMKTFNYNSYFSLA--
Q383Z3_TRYB2          -SLPFYI----GVLCCVWYLQGVVDNVNIYD----------AWSCGMGFRRNVRFAIL--
V5BFC2_TRYCR          -SLPFYI----ATLLCIWHLQGIVDDVNIYD----------ASSCGKGFLRNARFGIY--
Q4Q8D4_LEIMA          -SLPYYI----GIVLCMYHLHSIVDDVNIYD----------SWSCAQGFTRNVRLGMY--
A4HGH9_LEIBR          -SLPYYI----GIILCMYRLHSIVDDVNIYD----------SWSCAQGFTRNVRLGMY--
COQ2_DICDI            -PLFYYL----GTAACSSHLIWQLKTVDFNN----------PSSCLEKFISNKNFGLY--
D3BQE1_POLPP          -PTVYFV----GTTIGAAHLAWQIGSVDFSS----------PKSCMKFFISNRTFALI--
Q3IZ43_CERS4          GSILQLLIALAGVWGFGAHMTWQIARLDTED----------TARCLRLFRSNRDAGLI--
Q9A2Y5_CAUVC          GDIGPLFLPLAAL--FALHLSRQAAAVRIED----------GPGALKLFKSNALAGLL--
I1S1K6_GIBZE          -GVPYFVI---TVGGCAVSVGSMVALVDLKD----------PESCWKWFATGFWFTAL-S
M2UDD4_COCH5          -GILYYAV---TVVGCILSVGTMVVKVDLKS----------PASCWLWFSQGFWLTGL-A
C0NID8_AJECG          -GPIFFIG---SCGSAFATLSTLIWKVKLKD----------VGNCWWWFKNGCWITGG-G
A0A0D8JX01_COCIM      -GPIFFVG---SCGSAIITLGTMIWRVKLDD----------VKDCWWWFKYGCWFTGA-G
Q1K4Y3_NEUCR          -GPAFFIG---SCGGAALTLGYMIKKVNLKS----------VKDCWWWFVNGCWITGG-V
G2WTU9_VERDV          -GPAFFVG---SCGGALVTLGIMIKRVNLKS----------VKDCWWWFVNGCWITGG-V
Q0USG0_PHANO          -GPCFYFV---SCGGAALTLGTMIRKVRLKD----------VKNCWWWFVNGAWFTGG-A
Q4WNJ5_ASPFU          -GPLFYVG---TCGSAAVSLGIMIWKVQLKN----------VKNCWWWFKNGCLLTGG-G
D5GD53_TUBMM          -GPVFYLV---SCGGAAGSLAYMIRKVNLKD----------VKECWYYFEWCAWAVGFFA
                                                                      .           

COQ2_HUMAN            VFLGIVLGNLWKEKKTDKTKKGIENKIEN-------------------------------
F6XCH9_MACMU          VFLGIVLGNLWKEKKTDKTKKSTENKIEN-------------------------------
H0WKB3_OTOGA          IFLGIVLGNLWKEKKTDDIKKNTESRIEN-------------------------------
G1T0N6_RABIT          IFVGIVLGNLCKEKKTEDTKKNTDGRVAN-------------------------------
G3SN39_LOXAF          IFLGIVLGNLQKEKKTEETKKNIGSRLEN-------------------------------
COQ2_BOVIN            IFLGIVLGNLCKAKETDKTRKNIENRMEN-------------------------------
E2QT06_CANLF          VLLGIVLGNLWKEKKTDEANKSIDRIEN--------------------------------
G1LEF8_AILME          VLLGIILGNLWKEKKTDEAK----------------------------------------
COQ2_MOUSE            LFLGIVLGNLCKEK-TEEAKDAEAVRVGSEQTS---------------------------
COQ2_RAT              LFLGIVLGNLYKDK-PDETKGVDAVGEESERTS---------------------------
G1KKG5_ANOCA          LFIGIVFGNLQKTKNTEDVKKPLASSSKKMNTDAQEK-----------------------
A3KNW5_DANRE          LFLGIVAGNLWKKRSDEQYETQLNSISH--------------------------------
H3AS40_LATCH          LFIGIVLGTLWKGKNKPDPSEERDRQKSIP------------------------------
W5MV33_LEPOC          LFLGIVLGNLWKTKNNSDEQEKKLKPE---------------------------------
G3PKM8_GASAC          LLLGIVAGNLWKERRETLQPNEEAVR----------------------------------
A7RFI6_NEMVE          ILTGIIGGGLLKEKKQDHHPSTEVLKKSKT------------------------------
B3RWH5_TRIAD          IFTGIIGGKLLLREGKEEQQSSQ-------------------------------------
COQ2_DROME            LFLGIVLGTLLKSDESKKQRQSSLTTSTASSYVP----------ALPQKPEVLS------
COQ2_DROPS            LFLGIVLGTLLKANDTKNQPQPALTSSAASSYA-----------SLTQKPEVLS------
Q7Q9Z4_ANOGA          LFLGIVLGTLYKKNSED-RTKGSVTGSSSNP-------SGQLSATVTSARNIVV------
W5J300_ANODA          LFLGIVLGTLYKGYSDDQRSKTVISPSNSNSNSSNGSASDQLTVAVAGARNIAV------
COQ2_AEDAE            LFLGIVLGTLYKGYSQRAGKSSTTSSSSTSSSSS---PSSGLLLAATNHHQPARQAS---
E0W2B5_PEDHC          IFAGIVLGTFFKKKKKKKT-----------------------------------------
COQ2_CAEEL            LFSGIVASTLLKEVFQILIRPYH-------------------------------------
COQ2_ARATH            IFSGVVLGRSFQ------------------------------------------------
F6HF43_VITVI          LFGGILLGKLSS------------------------------------------------
B9H5T1_POPTR          VFSGVLLGRLWS------------------------------------------------
M1C9U9_SOLTU          IFGGILFGRLL-------------------------------------------------
K3YSY7_SETIT          VFSGILFGRLVS------------------------------------------------
B6T4K7_MAIZE          VFSGILFGRLVS------------------------------------------------
Q6ZAH2_ORYSJ          IFGGVLCGRLVS------------------------------------------------
I1IFN5_BRADI          VFSGILCGRLAS------------------------------------------------
A0A804HRS2_MUSAM      VFSGILFGRLAS------------------------------------------------
D6RMJ5_COPC7          IWAGAMADYGLSLVALG-------------------------------------------
D0MXD0_PHYIT          MFASVVAVYFYAMPELHTLALRMSTDDKRSLQHVVAVSDRIKCVEWMAVTAALHGEKALP
H9JR35_BOMMO          ILLGILGGGCAPYVDSLKKDNNNYDVNAAKSCFF--------------------------
COQ2_YEAST            FTYALAVDYILRLFGFL-------------------------------------------
Q751D7_ASHGO          FSAALFCDYLLTIFGVM-------------------------------------------
C4R445_KOMPG          FFAGIFLDYILRLLGYI-------------------------------------------
A0A1D8PU83_CANAL      FWYGIVFDYILLLLGYI-------------------------------------------
Q6C2S2_YARLI          MSAGILADWGMRLAGFY-------------------------------------------
COQ2_SCHPO            VAAAIALDWLAKSFIYDS------------------------------------------
E3L3S4_PUCGT          VWVGCLLDYCTRFFLI--------------------------------------------
UBIA_ECOLI            LFLGLAMSYWHF------------------------------------------------
UBIA_SALCH            LFLGLAMSYWHF------------------------------------------------
UBIA_SODGM            IFVGILLSLLSY------------------------------------------------
UBIA_YERPS            LFLGILISYW--------------------------------------------------
UBIA_PHOLL            LFLGIFFSYV--------------------------------------------------
UBIA_PROST            LFIGIFLSYL--------------------------------------------------
UBIA_PECAS            IFIGVLFGL---------------------------------------------------
UBIA_HAES1            VFIAVLFGI---------------------------------------------------
UBIA_PASMU            VFVAFLFGIFFDKL----------------------------------------------
UBIA_HAEDU            IFIAILVGIYGF------------------------------------------------
UBIA_PHOPR            IFLGIAISVMMQ------------------------------------------------
UBIA_ALIF1            IFIAISASVLI-------------------------------------------------
UBIA_VIBPA            IAIGLLVAFW--------------------------------------------------
UBIA_VIBVY            LALGLFVAFW--------------------------------------------------
UBIA_VIBCH            ITAGILLSVW--------------------------------------------------
UBIA_PSEA6            IALGIAGHYFM-------------------------------------------------
UBIA_PSET1            FFIGLLFSYPVAF-----------------------------------------------
UBIA_COLP3            VFVGIAIEYL--------------------------------------------------
UBIA_ACIAD            IFLAILAAFRF-------------------------------------------------
UBIA_PSYCK            VFVLIAIACIWTTFNG--------------------------------------------
UBIA_ALCBS            VFIGLYFQYF--------------------------------------------------
UBIA_IDILO            FAIGLAVHYWF-------------------------------------------------
UBIA_PSEF5            IFVGVVLDYALR------------------------------------------------
UBIA_PSEPF            IFVGIVLDYALR------------------------------------------------
UBIA_PSEPK            VFIGVVLDYALR------------------------------------------------
UBIA_PSESM            IFLGIVADYALR------------------------------------------------
UBIA_PSEAE            IFLGTVADYALR------------------------------------------------
UBIA_CHRSD            VFAGIALSLWPML-----------------------------------------------
UBIA_HAHCH            VFLGLVLEFLFRP-----------------------------------------------
UBIA_SACD2            VFLGILVDKLITN-----------------------------------------------
UBIA_METCA            VFAGLFADYLWAG-----------------------------------------------
UBIA_NITOC            IFGGIALHYLTA------------------------------------------------
UBIA_ALKEH            IFLGLLLDLHLGG-----------------------------------------------
UBIA_XANCP            IFVGIAASLALR------------------------------------------------
UBIA_XANOR            IFVGIAVAGR--------------------------------------------------
UBIA_XYLFT            IFAGIALATTH-------------------------------------------------
UBIA_SHEDO            LFLTLAADYLLY------------------------------------------------
UBIA_SHEFN            LFIALALDYMI-------------------------------------------------
UBIA_SHEON            LFVSLGADYLF-------------------------------------------------
UBIA_COXBU            IFLGILLTYRN-------------------------------------------------
UBIA_BLOFL            IFVGIVLSF---------------------------------------------------
UBIA_BLOPB            VFIGIASSFH--------------------------------------------------
UBIA_FRATO            IFIIAVIQYI--------------------------------------------------
UBIA_HYDCU            ILIGIMLDTL--------------------------------------------------
UBIA_AROAE            LFVALVIDYVAFPAA---------------------------------------------
UBIA_DECAR            IFVGIVVDFLVSGRNLW-------------------------------------------
UBIA_THIDA            VFGGIVLHFLLRSGSLFP------------------------------------------
UBIA_NITEU            IFAGILLDTLFRTDQSF-------------------------------------------
UBIA_NITMU            IFAGIVLDYLVRAAS---------------------------------------------
UBIA_METFK            IFVGVLASDYFRSSILSI------------------------------------------
UBIA_BURL3            LFAGIAAHYLLAGS----------------------------------------------
UBIA_BURTA            LFAGIAAHYALSAL----------------------------------------------
UBIA_PARXL            LFAGIAAHYAATWF----------------------------------------------
UBIA_CUPMC            VFAGTFVAYLLK------------------------------------------------
UBIA_CUPPJ            VFAGTAVAYAIR------------------------------------------------
UBIA_RALSO            VFVGAALAYALR------------------------------------------------
UBIA_POLSJ            VFAGIALSYLAA------------------------------------------------
UBIA_RHOFT            LFVGIAGSYALR------------------------------------------------
UBIA_NEIG1            WFAAIFAHTFFAK-----------------------------------------------
UBIA_LEGPL            MWFAVGLALI--------------------------------------------------
PLQA_SYNY3            LLAGMLLGWL--------------------------------------------------
Q8DLS6_THEVB          LWVGMWCPRP--------------------------------------------------
Q7NFU6_GLOVI          ILTGLIGGTLI-------------------------------------------------
A5GMW7_SYNPW          LLAGVILSRLG-------------------------------------------------
Q7VDC5_PROMA          ILFGLILGNF--------------------------------------------------
A3PBH9_PROM0          LLLGIIIAS---------------------------------------------------
Q3YRN9_EHRCJ          LFVGAVFGRVLNVI----------------------------------------------
S5PJB2_ANAPH          LFLGVCLGRIV-------------------------------------------------
Q4UAZ7_THEAN          LLIGIILGKPELKFDFKSEKSLEPAAS---------------------------------
Q4MYN9_THEPA          LLLGIILGKPELKFDFKSEKSLESTAS---------------------------------
A7AM23_BABBO          VLTAVVLGN-----DIPSKVKFTS------------------------------------
C6V5S7_NEORI          IFFIILLGRL--------------------------------------------------
A8F2H7_RICM5          LSMVFY------------------------------------------------------
Q9ZCN7_RICPR          LIMAFC------------------------------------------------------
W7X633_TETTS          MFLSILIGKIFPKAIEEDDEEDLIEDERQTQQNKNKIETQKP------------------
A0A2D7AM03_9PROT      IMIILATS----------------------------------------------------
Q383Z3_TRYB2          VTFSLCLGNVLWALASEHQPEKDAASNAISEKSALMKFLLLNKEAEPMSYSVQDIRWVDR
V5BFC2_TRYCR          IFLAMCLGNVFWTLASEHQRAKDADNIAVPEKSALMRFLLFRKTAESPAFNTQDIRWIDR
Q4Q8D4_LEIMA          VFLAMCLGNLCWAFASEHEAELDRNTDSAPKSSVLSRFLFLDQETHGPAYTKGSFNWADR
A4HGH9_LEIBR          VFLAMCLGNLCWAFASEHEAELDRNTDSAPKSSILSRFLFLDQETREASYTKGSFTWADR
COQ2_DICDI            FLLIIIVSKLLQDKE------------------------------NENEIQKK-------
D3BQE1_POLPP          ILVTIILARLIEDDEYTTAEYEFELGPIKLKYSNTFIPAIKGNDNNNNNIVNNI------
Q3IZ43_CERS4          PALFLATAALL-------------------------------------------------
Q9A2Y5_CAUVC          VFAGLVAGLWKPGVSF--------------------------------------------
I1S1K6_GIBZE          ILAGLSANYVLP------------------------------------------------
M2UDD4_COCH5          IFGGLFADYCGNGGK---------------------------------------------
C0NID8_AJECG          ITFGLLGEYLAQVFGLYE-ASNSAIEERKDWDELR-------------------------
A0A0D8JX01_COCIM      IATGLFGEYVSQRSSLQQMADDGATNVTKNEMPLQK------------------------
Q1K4Y3_NEUCR          ISLGLAADYLLKYYGQEK--LEKKPEELESA-----------------------------
G2WTU9_VERDV          ISMGLGMDYAVRYAADDE--DNKAIVQ---------------------------------
Q0USG0_PHANO          ISLGLAGEYLAQFFGQHE--DNQVDGAREGRHVATA------------------------
Q4WNJ5_ASPFU          ITLGMFFEYIAQTTGLYK--SDNNLH----------------------------------
D5GD53_TUBMM          VGGGLFGEYMAVRSGLYGGEGLWGLGGSRHRAFQRVQNKDG-------------------
                                                                                  

COQ2_HUMAN            ------------------------------------------------------------
F6XCH9_MACMU          ------------------------------------------------------------
H0WKB3_OTOGA          ------------------------------------------------------------
G1T0N6_RABIT          ------------------------------------------------------------
G3SN39_LOXAF          ------------------------------------------------------------
COQ2_BOVIN            ------------------------------------------------------------
E2QT06_CANLF          ------------------------------------------------------------
G1LEF8_AILME          ------------------------------------------------------------
COQ2_MOUSE            ------------------------------------------------------------
COQ2_RAT              ------------------------------------------------------------
G1KKG5_ANOCA          ------------------------------------------------------------
A3KNW5_DANRE          ------------------------------------------------------------
H3AS40_LATCH          ------------------------------------------------------------
W5MV33_LEPOC          ------------------------------------------------------------
G3PKM8_GASAC          ------------------------------------------------------------
A7RFI6_NEMVE          ------------------------------------------------------------
B3RWH5_TRIAD          ------------------------------------------------------------
COQ2_DROME            ------------------------------------------------------------
COQ2_DROPS            ------------------------------------------------------------
Q7Q9Z4_ANOGA          ------------------------------------------------------------
W5J300_ANODA          ------------------------------------------------------------
COQ2_AEDAE            ------------------------------------------------------------
E0W2B5_PEDHC          ------------------------------------------------------------
COQ2_CAEEL            ------------------------------------------------------------
COQ2_ARATH            ------------------------------------------------------------
F6HF43_VITVI          ------------------------------------------------------------
B9H5T1_POPTR          ------------------------------------------------------------
M1C9U9_SOLTU          ------------------------------------------------------------
K3YSY7_SETIT          ------------------------------------------------------------
B6T4K7_MAIZE          ------------------------------------------------------------
Q6ZAH2_ORYSJ          ------------------------------------------------------------
I1IFN5_BRADI          ------------------------------------------------------------
A0A804HRS2_MUSAM      ------------------------------------------------------------
D6RMJ5_COPC7          ------------------------------------------------------------
D0MXD0_PHYIT          AKAIEAFPAYFHSDDRRVNLNKIQDWWSKRHALVQPEGER--------------------
H9JR35_BOMMO          ------------------------------------------------------------
COQ2_YEAST            ------------------------------------------------------------
Q751D7_ASHGO          ------------------------------------------------------------
C4R445_KOMPG          ------------------------------------------------------------
A0A1D8PU83_CANAL      ------------------------------------------------------------
Q6C2S2_YARLI          ------------------------------------------------------------
COQ2_SCHPO            ------------------------------------------------------------
E3L3S4_PUCGT          ------------------------------------------------------------
UBIA_ECOLI            ------------------------------------------------------------
UBIA_SALCH            ------------------------------------------------------------
UBIA_SODGM            ------------------------------------------------------------
UBIA_YERPS            ------------------------------------------------------------
UBIA_PHOLL            ------------------------------------------------------------
UBIA_PROST            ------------------------------------------------------------
UBIA_PECAS            ------------------------------------------------------------
UBIA_HAES1            ------------------------------------------------------------
UBIA_PASMU            ------------------------------------------------------------
UBIA_HAEDU            ------------------------------------------------------------
UBIA_PHOPR            ------------------------------------------------------------
UBIA_ALIF1            ------------------------------------------------------------
UBIA_VIBPA            ------------------------------------------------------------
UBIA_VIBVY            ------------------------------------------------------------
UBIA_VIBCH            ------------------------------------------------------------
UBIA_PSEA6            ------------------------------------------------------------
UBIA_PSET1            ------------------------------------------------------------
UBIA_COLP3            ------------------------------------------------------------
UBIA_ACIAD            ------------------------------------------------------------
UBIA_PSYCK            ------------------------------------------------------------
UBIA_ALCBS            ------------------------------------------------------------
UBIA_IDILO            ------------------------------------------------------------
UBIA_PSEF5            ------------------------------------------------------------
UBIA_PSEPF            ------------------------------------------------------------
UBIA_PSEPK            ------------------------------------------------------------
UBIA_PSESM            ------------------------------------------------------------
UBIA_PSEAE            ------------------------------------------------------------
UBIA_CHRSD            ------------------------------------------------------------
UBIA_HAHCH            ------------------------------------------------------------
UBIA_SACD2            ------------------------------------------------------------
UBIA_METCA            ------------------------------------------------------------
UBIA_NITOC            ------------------------------------------------------------
UBIA_ALKEH            ------------------------------------------------------------
UBIA_XANCP            ------------------------------------------------------------
UBIA_XANOR            ------------------------------------------------------------
UBIA_XYLFT            ------------------------------------------------------------
UBIA_SHEDO            ------------------------------------------------------------
UBIA_SHEFN            ------------------------------------------------------------
UBIA_SHEON            ------------------------------------------------------------
UBIA_COXBU            ------------------------------------------------------------
UBIA_BLOFL            ------------------------------------------------------------
UBIA_BLOPB            ------------------------------------------------------------
UBIA_FRATO            ------------------------------------------------------------
UBIA_HYDCU            ------------------------------------------------------------
UBIA_AROAE            ------------------------------------------------------------
UBIA_DECAR            ------------------------------------------------------------
UBIA_THIDA            ------------------------------------------------------------
UBIA_NITEU            ------------------------------------------------------------
UBIA_NITMU            ------------------------------------------------------------
UBIA_METFK            ------------------------------------------------------------
UBIA_BURL3            ------------------------------------------------------------
UBIA_BURTA            ------------------------------------------------------------
UBIA_PARXL            ------------------------------------------------------------
UBIA_CUPMC            ------------------------------------------------------------
UBIA_CUPPJ            ------------------------------------------------------------
UBIA_RALSO            ------------------------------------------------------------
UBIA_POLSJ            ------------------------------------------------------------
UBIA_RHOFT            ------------------------------------------------------------
UBIA_NEIG1            ------------------------------------------------------------
UBIA_LEGPL            ------------------------------------------------------------
PLQA_SYNY3            ------------------------------------------------------------
Q8DLS6_THEVB          ------------------------------------------------------------
Q7NFU6_GLOVI          ------------------------------------------------------------
A5GMW7_SYNPW          ------------------------------------------------------------
Q7VDC5_PROMA          ------------------------------------------------------------
A3PBH9_PROM0          ------------------------------------------------------------
Q3YRN9_EHRCJ          ------------------------------------------------------------
S5PJB2_ANAPH          ------------------------------------------------------------
Q4UAZ7_THEAN          ------------------------------------------------------------
Q4MYN9_THEPA          ------------------------------------------------------------
A7AM23_BABBO          ------------------------------------------------------------
C6V5S7_NEORI          ------------------------------------------------------------
A8F2H7_RICM5          ------------------------------------------------------------
Q9ZCN7_RICPR          ------------------------------------------------------------
W7X633_TETTS          ------------------------------------------------------------
A0A2D7AM03_9PROT      ------------------------------------------------------------
Q383Z3_TRYB2          FAHPAFVAAQKAQHEGEEKTVVVPAWMRREYLGENVGTIMRFFGVDEEAIQTWQKWWYAQ
V5BFC2_TRYCR          MAHPVYVAAQEVKQDSTQKPLVIPAWMRREYLGENLGNLMLLLGVENEFVVSWQEWWYAQ
Q4Q8D4_LEIMA          FMHPAFVQAESAKLAGATEAPPIPAWMRREYFWQNVSAILLFCGVAEDTVAAWSTFSYEW
A4HGH9_LEIBR          FMHPAFVQAESAKAAGATEAPPIPAWMRREYFSQNLSAILLFCGVSEETVTAWSTSSYTF
COQ2_DICDI            ------------------------------------------------------------
D3BQE1_POLPP          ------------------------------------------------------------
Q3IZ43_CERS4          ------------------------------------------------------------
Q9A2Y5_CAUVC          ------------------------------------------------------------
I1S1K6_GIBZE          ------------------------------------------------------------
M2UDD4_COCH5          ------------------------------------------------------------
C0NID8_AJECG          ------------------------------------------------------------
A0A0D8JX01_COCIM      ------------------------------------------------------------
Q1K4Y3_NEUCR          ------------------------------------------------------------
G2WTU9_VERDV          ------------------------------------------------------------
Q0USG0_PHANO          ------------------------------------------------------------
Q4WNJ5_ASPFU          ------------------------------------------------------------
D5GD53_TUBMM          ------------------------------------------------------------
                                                                                  

COQ2_HUMAN            ------------
F6XCH9_MACMU          ------------
H0WKB3_OTOGA          ------------
G1T0N6_RABIT          ------------
G3SN39_LOXAF          ------------
COQ2_BOVIN            ------------
E2QT06_CANLF          ------------
G1LEF8_AILME          ------------
COQ2_MOUSE            ------------
COQ2_RAT              ------------
G1KKG5_ANOCA          ------------
A3KNW5_DANRE          ------------
H3AS40_LATCH          ------------
W5MV33_LEPOC          ------------
G3PKM8_GASAC          ------------
A7RFI6_NEMVE          ------------
B3RWH5_TRIAD          ------------
COQ2_DROME            ------------
COQ2_DROPS            ------------
Q7Q9Z4_ANOGA          ------------
W5J300_ANODA          ------------
COQ2_AEDAE            ------------
E0W2B5_PEDHC          ------------
COQ2_CAEEL            ------------
COQ2_ARATH            ------------
F6HF43_VITVI          ------------
B9H5T1_POPTR          ------------
M1C9U9_SOLTU          ------------
K3YSY7_SETIT          ------------
B6T4K7_MAIZE          ------------
Q6ZAH2_ORYSJ          ------------
I1IFN5_BRADI          ------------
A0A804HRS2_MUSAM      ------------
D6RMJ5_COPC7          ------------
D0MXD0_PHYIT          ------------
H9JR35_BOMMO          ------------
COQ2_YEAST            ------------
Q751D7_ASHGO          ------------
C4R445_KOMPG          ------------
A0A1D8PU83_CANAL      ------------
Q6C2S2_YARLI          ------------
COQ2_SCHPO            ------------
E3L3S4_PUCGT          ------------
UBIA_ECOLI            ------------
UBIA_SALCH            ------------
UBIA_SODGM            ------------
UBIA_YERPS            ------------
UBIA_PHOLL            ------------
UBIA_PROST            ------------
UBIA_PECAS            ------------
UBIA_HAES1            ------------
UBIA_PASMU            ------------
UBIA_HAEDU            ------------
UBIA_PHOPR            ------------
UBIA_ALIF1            ------------
UBIA_VIBPA            ------------
UBIA_VIBVY            ------------
UBIA_VIBCH            ------------
UBIA_PSEA6            ------------
UBIA_PSET1            ------------
UBIA_COLP3            ------------
UBIA_ACIAD            ------------
UBIA_PSYCK            ------------
UBIA_ALCBS            ------------
UBIA_IDILO            ------------
UBIA_PSEF5            ------------
UBIA_PSEPF            ------------
UBIA_PSEPK            ------------
UBIA_PSESM            ------------
UBIA_PSEAE            ------------
UBIA_CHRSD            ------------
UBIA_HAHCH            ------------
UBIA_SACD2            ------------
UBIA_METCA            ------------
UBIA_NITOC            ------------
UBIA_ALKEH            ------------
UBIA_XANCP            ------------
UBIA_XANOR            ------------
UBIA_XYLFT            ------------
UBIA_SHEDO            ------------
UBIA_SHEFN            ------------
UBIA_SHEON            ------------
UBIA_COXBU            ------------
UBIA_BLOFL            ------------
UBIA_BLOPB            ------------
UBIA_FRATO            ------------
UBIA_HYDCU            ------------
UBIA_AROAE            ------------
UBIA_DECAR            ------------
UBIA_THIDA            ------------
UBIA_NITEU            ------------
UBIA_NITMU            ------------
UBIA_METFK            ------------
UBIA_BURL3            ------------
UBIA_BURTA            ------------
UBIA_PARXL            ------------
UBIA_CUPMC            ------------
UBIA_CUPPJ            ------------
UBIA_RALSO            ------------
UBIA_POLSJ            ------------
UBIA_RHOFT            ------------
UBIA_NEIG1            ------------
UBIA_LEGPL            ------------
PLQA_SYNY3            ------------
Q8DLS6_THEVB          ------------
Q7NFU6_GLOVI          ------------
A5GMW7_SYNPW          ------------
Q7VDC5_PROMA          ------------
A3PBH9_PROM0          ------------
Q3YRN9_EHRCJ          ------------
S5PJB2_ANAPH          ------------
Q4UAZ7_THEAN          ------------
Q4MYN9_THEPA          ------------
A7AM23_BABBO          ------------
C6V5S7_NEORI          ------------
A8F2H7_RICM5          ------------
Q9ZCN7_RICPR          ------------
W7X633_TETTS          ------------
A0A2D7AM03_9PROT      ------------
Q383Z3_TRYB2          LDHYNMFSSIAV
V5BFC2_TRYCR          LDHYNMFSKLAI
Q4Q8D4_LEIMA          MDHYNMFSKVSP
A4HGH9_LEIBR          MDHYNMFSQVTL
COQ2_DICDI            ------------
D3BQE1_POLPP          ------------
Q3IZ43_CERS4          ------------
Q9A2Y5_CAUVC          ------------
I1S1K6_GIBZE          ------------
M2UDD4_COCH5          ------------
C0NID8_AJECG          ------------
A0A0D8JX01_COCIM      ------------
Q1K4Y3_NEUCR          ------------
G2WTU9_VERDV          ------------
Q0USG0_PHANO          ------------
Q4WNJ5_ASPFU          ------------
D5GD53_TUBMM          ------------