CLUSTAL format seed alignment for MF_01639

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

PDXY_VIBVU      ---------MQGILSIQSHVAYGHAGNSSAVFPMQRMGFEVWPIHTVQFSNHTQYQEGWT
PDXY_VIBVY      ---------MRGILSIQSHVAYGHAGNSSAVFPMQRMGFEVWPIHTVQFSNHTQYQEGWT
PDXY_VIBPA      ---------MQGILSIQSHVSFGHAGNSSAVFPMQRMGFEVWPIHTVQFSNHTQYQEGWT
PDXY_PHOPR      ---------MHGILSIQSHVTYGHAGNSSAIFPMQRMGFEVWPIHTVQFSNHTQYKQGWT
PDXY_SHISS      --------MMKNILAIQSHVVYGHAGNSAAEFPMRRLGANVWPLNTVQFSNHTQYGK-WT
PDXY_SHIBS      --------MMKNILAIQSHVVYGHAGNSAAEFPMRRLGANVWPLNTVQFSNHTQYGK-WT
PDXY_ECOLI      --------MMKNILAIQSHVVYGHAGNSAAEFPMRRLGANVWPLNTVQFSNHTQYGK-WT
PDXY_SHIFL      --------MMKNILAIQSHVVYGHAGNSAAEFPMRRLGANVWPLNTVQFSNHTQYGK-WT
PDXY_ECO57      --------MMKNILAIQSHVVYGHAGNSAAEFPMRRLGANVWPLNTVQFSNHTQYGK-WT
PDXY_SHIDS      --------MMKNILAIQSHVVYGHAGNSAVEFPMRRLGANVWPLNTVQFSNHTQYGK-WT
PDXY_ECOL5      --------MMKNILAIQSHVVYGHAGNSAAEFPMRRLGANVWPLNTVQFSNHTQYGK-WT
PDXY_ECOUT      --------MMKNILAIQSHVVYGHAGNSAAEFPMRRLGANVWPLNTVQFSNHTQYGK-WT
PDXY_ECOL6      --------MMKNILAIQSHVVYGHAGNSAAEFPMRRLGANVWPLNTVQFSNHTQYGK-WT
PDXY_SALCH      ---------MKNILAIQSHVVFGHAGNSAAEFPMRRLGANVWPLNTVQFSNHTQYGK-WT
PDXY_SALTY      ---------MKNILAIQSHVVFGHAGNSAAEFPMRRLGANVWPLNTVQFSNHTQYGK-WT
PDXY_SALPA      ---------MKNILAIQSHVVFGHAGNSAAEFPMRRLGANVWPLNTVQFSNHTQYGK-WT
PDXY_YERPA      ---------MKNILSIQSHVVFGHAGNSAAEFPMRRMGVNVWPLNTVQFSNHTQYGH-WT
PDXY_YERPE      ---------MKNILSIQSHVVFGHAGNSAAEFPMRRMGVNVWPLNTVQFSNHTQYGH-WT
PDXY_YERPN      ---------MKNILSIQSHVVFGHAGNSAAEFPMRRMGVNVWPLNTVQFSNHTQYGH-WT
PDXY_YERPS      ---------MKNILSIQSHVVFGHAGNSAAEFPMRRMGVNVWPLNTVQFSNHTQYGH-WT
PDXY_PECAS      ---------MKNILSIQSHVVFGHAGNSAAEFPMRRMGANVWPLNTVQFSNHTQYGH-WT
PDXY_PROMI      ---------MKNILSIQSHVVFGHAGNSXAEFPXRRMGVNVWPLNTVQFSNHTQYPEKWT
PDXY_PHOLL      ---------MKNILSIQSHVVFGHAGNSAAEFPMRRMGVNVWPLNTVQFSNHTQYAQ-WK
PDXY_BURCA      ---------MKNVLSIQSHVIYGHAGNSAAVFPMQRLGINVWPLNTVQLSNHMQYGH-WA
PDXY_BURL3      ---------MKNVLSIQSHVIYGHAGNSAAVFPMQRLGINVWPLNTVQLSNHMQYGH-WA
PDXY_BURMA      ---------MKNVLSIQSHVIYGHAGNSAAVFPMQRLGVNVWPLNTVQLSNHMQYGH-WA
PDXY_BURPS      ---------MKNVLSIQSHVIYGHAGNSAAVFPMQRLGVNVWPLNTVQLSNHMQYGH-WA
PDXY_BURP1      ---------MKNVLSIQSHVIYGHAGNSAAVFPMQRLGVNVWPLNTVQLSNHMQYGH-WA
PDXY_BURTA      ---------MKNVLSIQSHVIYGHAGNSAAVFPMQRLGVNVWPLNTVQLSNHMQYGH-WA
PDXY_PARXL      --------MTKNVLSIQSHVVFGHAGNSAAVFPMRRLGVNVWPLNTVQFSNHTQYGH-WT
PDXY_PSE14      ------MKRTPHLLAIQSHVVFGHAGNSAAVFPMQRIGVNVWPLNTVQFSNHTQYKQ-WT
PDXY_PSEU2      ------MKRTPHLLAIQSHVVFGHAGNSAAVFPMQRIGVNVWPLNTVQFSNHTQYKQ-WT
PDXY_PSESM      ------MKRTPHLLAIQSHVVFGHAGNSAAVFPMQRIGVNVWPLNTVQFSNHTQYKQ-WT
PDXY_PSEF5      ------MKRTPHLLAIQSHVVFGHAGNSAAVFPMQRVGVNVWPLNTVQFSNHTQYGQ-WA
PDXY_PSEPF      ------MKRTPHLLAIQSHVVFGHAGNSAAVFPMQRVGVNVWPLNTVQFSNHTQYGQ-WA
PDXY_PSEPK      ------MKRTPHLLAIQSHVVFGHAGNSAAVFPMQRIGVNAWPLNTVQFSNHTQYGQ-WA
PDXY_PSEAE      ------MPRTPHLLAIQSHVVFGHAGNAAAVFPMQRIGINVWPLNTVQFSNHTQYGR-WT
PDXY_ALIF1      ---------MKRILSIQSHVVFGCAGNSAAVFPMRRMGMEVWPINTVQFSNHTQYQQGWK
PDXY_HAES1      ---------MKNILSIQSHVVYGYAGNKSATFPMQLLGIDVWALNTVQFSNHTQYGK-WT
PDXY_PASMU      ---------MKHVLSIQSHVVYGYAGNKSATFPMQLLGVDVWALNTVQFSNHTQYGK-WT
PDXY_MANSM      ---------MKNVLSIQSHVVFGYAGNKSATFPMQLMGVDVWALNTVQFSNHTQYGK-WT
PDXY_HAEIN      ---------MKNVLSIQSHVVYGFAGNKSATFPMQLLGVDVWALNTVQFSNHTQYGK-WT
PDXY_CORDI      ----------MNILSIQSHVSYGHVGNSAAVFPLQRIGHEVWPVHTVNFSNHTGYGQ-WG
PDXY_LEIXX      ----------MKILSIQSAVAYGHVGNSAAVFPLQRIGVEVLPVYTVNFSNHTGYGA-WR
PDXY_RUBXD      ----MSQGGGLNILSIQSSVAYGHVGNSAAVFPLQRLGIEVWAVNTVHFSNHTGYGE-WR
PDXY_DEIGD      MTSSSAPVLPQNILSIQSWVSYGHVGNAAALFPLQRLGFEVWTINTVQFSNHTGYGE-WT
PDXY_DEIRA      -MDSVTPTLPRNILSIQSWVSYGHVGNAAAIFPLQRLGFEVWGVHTVQFSNHTGYGA-WT
PDXY_GRABC      ----------MNILSIQSWVCYGHVGNASAVFPLQLLGAEVWAVNTVQFSNHTGYGD-WT
                            :*:*** * :* .**  . ** : :* :.  : **::***  *   * 

PDXY_VIBVU      GRAFSADDISELVRGLNNIGALEKCQAVLTGYQGSAEQCLAVEETVTKVKQANPDALYVC
PDXY_VIBVY      GRAFSADDISELVRGLNNIGALEKCQAVLTGYQGSAEQCLAVEETVTKVKQANPDALYVC
PDXY_VIBPA      GRAFAAEDISELVRGLGNIGALEKCQAVLTGYQGSAEQCLAVEDTVAKVKQANPNALYVC
PDXY_PHOPR      GRAFSASDIDELVQGLDNIDALKRCKAILTGYQGSAEQCEAIIRTVEKVKAQNPSSLYIC
PDXY_SHISS      GCVMPPSHLTEIVQGIAAIDKLHTCDAVLSGYLGSAEQGEHILGIVRQVKAANPQAKYFC
PDXY_SHIBS      GCVMPPSHLTEIVQGIAAIDKLHTCDAVLSGYLGSAEQGEHILGIVRQVKAANPQAKYFC
PDXY_ECOLI      GCVMPPSHLTEIVQGIAAIDKLHTCDAVLSGYLGSAEQGEHILGIVRQVKAANPQAKYFC
PDXY_SHIFL      GCVMPPSHLTEIVQGIAAIDKLHTCDAVLSGYLGSAEQGEHILGIVRQVKAANPQAKYFC
PDXY_ECO57      GCVMPPSHLTEIVQGIAAIDKLHTCDAVLSGYLGSAEQGEHILGIVRQVKAANPQAKYFC
PDXY_SHIDS      GCVMPPSHLTEIVQGIAAIDKLHTCDAVLSGYLGSAEQGEHILGIVRQVKAANPQAKYFC
PDXY_ECOL5      GCVMPPSHLTEIVQGIAAIDKLHTCDAVLSGYLGSAEQGEHILGIVRQVKAANPQAKYFC
PDXY_ECOUT      GCVMPPSHLTEIVQGIAAIDKLHTCDAVLSGYLGSAEQGEHILGIVRQVKAANPQAKYFC
PDXY_ECOL6      GCVMPPSHLTEIVQGIAAIDKLHTCDAVLSGYLGSAEQGEHILGIVRQVKAANPQAKYFC
PDXY_SALCH      GCVMPPSHLTEIVQGIADIGQLAHCDAVLSGYLGSAEQGEHILGIVRQVKAANPQAKYFC
PDXY_SALTY      GCVMPPSHLTEIVQGIADIGQLAHCDAVLSGYLGSAEQGEHILGIVRQVKAANPQAKYFC
PDXY_SALPA      GCVMPPSHLTEIVQGIADIGQLAHCDAVLSGYLGSAEQGEHILGIVRQVKAANPQAKYFC
PDXY_YERPA      GCVMPASHLTDIVQGIADIDRLKDCDAVLSGYIGSPEQGSHILAAVAQVKQANPDAWYFC
PDXY_YERPE      GCVMPASHLTDIVQGIADIDRLKDCDAVLSGYIGSPEQGSHILAAVAQVKQANPDAWYFC
PDXY_YERPN      GCVMPASHLTDIVQGIADIDRLKDCDAVLSGYIGSPEQGSHILAAVAQVKQANPDAWYFC
PDXY_YERPS      GCVMPASHLTDIVQGIADIDRLKDCDAVLSGYIGSPEQGSHILAAVAQVKQANPDAWYFC
PDXY_PECAS      GCVMPASHLTEVVQGIANIDKLKTCNAVLSGYIGSAEQGEHILGIVRQVKAANPDALYFC
PDXY_PROMI      GCVMXAEHITEIVDGIAAIGKLAQCDAVLSGYLGSAEQGRRIVDIVKKVKQANPNAWYFC
PDXY_PHOLL      GCVMPANHLTEIVQGIEEIEQLKSCHAVLSGYIGSAEQGGHIIDIVKRVKAVNPDAWYFC
PDXY_BURCA      GSAIDAAKMEQLVDGIAAIGVLKRCDAVLSGFLGSPPQARAAVEIVRTVKAMNPNAWYFC
PDXY_BURL3      GSAIDAAKMEQLVDGIAAIGALKRCDAVLSGFLGSPPQARAAVEIVRSVKAMNPNAWYFC
PDXY_BURMA      GSAIDAAKMEQLVDGIAAIGALKRCDAVLSGFLGSPAQARAAVEIVRTVKATNPNAWYFC
PDXY_BURPS      GSAIDAAKMEQLVDGIAAIGALKRCDAVLSGFLGSPAQARAAVEIVRTVKATNPNAWYFC
PDXY_BURP1      GSAIDAAKMEQLVDGIAAIGALKRCDAVLSGFLGSPAQARAAVEIVRTVKATNPNAWYFC
PDXY_BURTA      GSAIDAAKMEQLVDGIAAIGALKRCDAVLSGFLGSPAQARAAVEIVRTVKATNPNAWYFC
PDXY_PARXL      GGAIDATQMVELVDGIGAIGMLPRCDAVLSGYLGTPEQAQSVLEIVKAVKAANPRAWYFC
PDXY_PSE14      GEVLAPQQIPALIEGIAAIGELGNCDAVLSGYLGSAAQGRAILTGVARIKAANPKALYLC
PDXY_PSEU2      GEVLAPQQIPALIDGIAAIGELGNCDAVLSGYLGSAAQGRAILTGVARIKAANPKALYLC
PDXY_PSESM      GEVLAPQQIPALIDGIAAIGELGNCDAVLSGYLGSAAQGRAILSGVARIKAANPKALYLC
PDXY_PSEF5      GEVLAPQQIPELVEGIAAIGELGNCDAVLSGYLGSAAQGRAILSGVARIKAVNPKALYLC
PDXY_PSEPF      GEVLAPHRIPELVEGIAAIGELGNCDAVLSGYLGSAAQGRAILSGIERIKAVNPKALYLC
PDXY_PSEPK      GEVLAPAQIPALVEGISNIGELGHCDAVLSGYLGSAEQGRAILAGVERIKAVNPKALYLC
PDXY_PSEAE      GQVLPPEQIPALVDGIAGIGELGNCDAVLSGYLGSAAQGRAILDVVARIKQANPRALYLC
PDXY_ALIF1      GIAMPAGHISELVDGLSAIEATQVCDAVLSGYLGSAAQGQEIVTAVNKIKQDNPNAIYFC
PDXY_HAES1      GMVIPKEQIGEIVQGIDNIGELHQCDAVLSGYIGSAEQVEEIIKAFHKIKERNPKAIYLC
PDXY_PASMU      GMVIPKEQIGEIVRGIDAIEALHLCDAIVSGYIGSAEQVEEIVNAVRFIKSKNPNALYLC
PDXY_MANSM      GMVIPKEQIGEIIRGIDEIGELKNCNAVVSGYLGSAEQVDEIIKAVEKVKSLNPQALYLC
PDXY_HAEIN      GMVIPQEQIREIVTGLDNIEKLQECDALLSGYLGSAEQVDQILFALEQIKLRNPNALYLC
PDXY_CORDI      GELIPAAQVRNVIDGMEQRGAFERIDAILSGYQGGSDIADVIVDAVARIKEANPQAVYAC
PDXY_LEIXX      GPLIAPDEVREVITGIEERRVLGSIDAVLSGYQGSEGIGDVIVDAVARVKAADPHAVYAC
PDXY_RUBXD      GPVLAAGDVSEVLRGIGERGVLGSCGAVLSGYMGDVSLGEVILGAVGRVRGANPQALFCC
PDXY_DEIGD      GSVFPPELVADLLNGIAARGVLPTCAAVLSGYMGSEGTVSAVVEAVRRVREANPAALYCC
PDXY_DEIRA      GPVFEPGVIAELLDGIEARGVLPQCDGVLSGYVGSGGTVAAVVGAVGRVRQAHPQALYCC
PDXY_GRABC      GQVFGGDDIAALMKGIADRGVLPRCDAVLSGYMGSDAIGGAILDAVASVRAANPEALYCC
                *  :    :  :: *:          .:::*: *           .  ::  .* : : *

PDXY_VIBVU      DPVMGAPDKGCIVAPGIAENLLNRLMPMADVIVPNQFELSQFAE-MEIHTLDDAIIACQR
PDXY_VIBVY      DPVMGAPDKGCIVAPGIAENLLNRLMPMADVIVPNQFELSQFAE-MEIHTLDDAIIACQR
PDXY_VIBPA      DPVMGAPDKGCIVAPGIAENLLTRLMPMADVIVPNQFELSQFAE-MEIHSLDDAITACQR
PDXY_PHOPR      DPVMGAPDKGCIVAPGITEYLVDHLMPMADVIVPNQFELSQFAQ-MEINTLSDAVEACNI
PDXY_SHISS      DPVMGHPEKGCIVAPGVAEFHVRHGLPASDIIAPNLVELEILCE-HAVNNVEEAVLAARE
PDXY_SHIBS      DPVMGHPEKGCIVAPGVAEFHVRHGLPASDIIAPNLVELEILCE-HAVNNVEEAVLAARE
PDXY_ECOLI      DPVMGHPEKGCIVAPGVAEFHVRHGLPASDIIAPNLVELEILCE-HAVNNVEEAVLAARE
PDXY_SHIFL      DPVMGHPEKGCIVAPGVAEFHVRHGLPASDIIAPNLVELEILCE-HAVNNVEEAVLAARE
PDXY_ECO57      DPVMGHPEKGCIVAPGVAEFHVRHGLPASDIIAPNLVELEILCE-HPVNNVEEAVLAARE
PDXY_SHIDS      DPVMGHPEKGCIVAPGVAEFHVRHGLPASDIIAPNLVELEILCE-HPVNNVEEAVLAARE
PDXY_ECOL5      DPVMGHPEKGCIVAPGVAEFHVRHGLPASDIIAPNLVELEILCE-HPVNNVEEAVLAARE
PDXY_ECOUT      DPVMGHPEKGCIVAPGVAEFHVRHGLPASDIIAPNLVELEILCE-HPVNNVEEAVLAARE
PDXY_ECOL6      DPVMGHPEKGCIVAPGVAEFHVRHGLPASDIIAPNLVELEILCE-HPVKNVEEAVLAARE
PDXY_SALCH      DPVMGHPEKGCIVAPGVAEFHVRYALPASDIIAPNLIELEILSK-HSVNNVDDAVQAARE
PDXY_SALTY      DPVMGHPEKGCIVAPGVAEFHVRYALPASDIIAPNLIELEILSK-HSVNNVDDAVQAARE
PDXY_SALPA      DPVMGHPEKGCIVAPGVAEFHVRYALPASDIIAPNLIELEILSK-HSVNNVNDAVQAARE
PDXY_YERPA      DPVMGHPEKGCIVAPGVAEFFCNEALPASDMIAPNLLELEQLSG-ERVENVEQAVQVARS
PDXY_YERPE      DPVMGHPEKGCIVAPGVAEFFCNEALPASDMIAPNLLELEQLSG-ERVENVEQAVQVARS
PDXY_YERPN      DPVMGHPEKGCIVAPGVAEFFCNEALPASDMIAPNLLELEQLSG-ERVENVEQAVQVARS
PDXY_YERPS      DPVMGHPEKGCIVAPGVAEFFCNEALPASDMIAPNLLELEQLSG-ERVENVEQAVQVARS
PDXY_PECAS      DPVMGTPEKGCIVAPGVSDFHCQQSLLAADIVAPNLPELELLGG-RTVHNVAEAVETARA
PDXY_PROMI      DPVMGHPEKGCIVPPEVSGVLCEDALPISDIIAPNLLELETLAGGATLHNVDQCVKAARQ
PDXY_PHOLL      DPVMGHPEKGCIVVPGVAEFLCKDALPVSDIIAPNLLELETLSM-QKVTNVEQAVMAART
PDXY_BURCA      DPAMGQTG-GIRPEPGVEEFIVEEVPALADGMSPNHTELQKLAG-RRIETVAEAVDACRA
PDXY_BURL3      DPAMGQTG-GIRPEPGVEEFMVQEMPALADGMSPNHTELQKLAG-RRIETVAEAVEACRA
PDXY_BURMA      DPAMGQTG-GIRPEPGVEEFIVAELPELADGMAPNHSELQKLAG-QRIETVAEAVAACRS
PDXY_BURPS      DPAMGQTG-GIRPEPGVEEFIVAELPELADGMAPNHSELQKLAG-QRIETVAEAVAACRS
PDXY_BURP1      DPAMGQTG-GIRPEPGVEEFIVAELPELADGMAPNHSELQKLAG-QRIETVAEAVAACRL
PDXY_BURTA      DPAMGQTG-GIRPEPGVEEFIVAELPELADGMAPNHGELQKLAG-QRIETVAEAVEACRS
PDXY_PARXL      DPVMGAVS-GCKVEPGIQEFLVRTMPGVADAMAPNHTELQRLVG-REIETLEEAVTACRE
PDXY_PSE14      DPVMGHPEKGCIVAPEVSDFLLQEAAAMADFMCPNQLELDSFSG-RKPESLADCLAMARA
PDXY_PSEU2      DPVMGHPEKGCIVAPEVSDFLLQEAAAMADFMCPNQLELDSFSG-RKPESLHDCLAMARA
PDXY_PSESM      DPVMGHPEKGCIVPPQVSDFLLEEAAAVADFMCPNQLELDSFSG-RKPESLPDCLAMARA
PDXY_PSEF5      DPVMGHPEKGCSVPAEVSDFLLDEAVAMADFLCPNQLELDSFCG-RKPQSLFDCLGMARS
PDXY_PSEPF      DPVMGHPEKGCSVPAEVSDFLLEEAAAVADFMCPNQLELDSFSG-RKPQSLFDCLAMARA
PDXY_PSEPK      DPVMGHPEKGCIVPPEVSEFLLDEAAATADILCPNQLELDSFCG-RRAQSLEDCVNMARS
PDXY_PSEAE      DPVMGHPEKGCIVAPEVSDFLLEEAAAVADYLCPNQLELDSFCD-RQPNSLADCVEMARS
PDXY_ALIF1      DPVMGHPEKGCIVAPEVETFFKESALSSADIIAPNLLELESLTG-MTINTLDQVIEANNQ
PDXY_HAES1      DPVMGHPDKGCVVADGVKEGLIKIAMAQADIITPNLVELRELSG-LAVENFEQAIEAVKV
PDXY_PASMU      DPVMGHPDKGCIVAEGVKEGLINLAMAEADLITPNLVELRELSG-LPVENFAQAQDAVRA
PDXY_MANSM      DPVMGHPDKGCIVADGVKEGLINLAVSHADILTPNLVELREISG-LPVENFEQAIEAVKV
PDXY_HAEIN      DPVMPHPKKICVVANGVREALIEKAIPVADIMTPNLHELRQLTE-FPINTFDDVLKAVNA
PDXY_CORDI      DPVMGNAKSGCFVSDLIPPLLRDKVVPVADIITPNQFELEYLTG-VPAHDTTSTLEAIAA
PDXY_LEIXX      DPVMGNAASGCFVAPAIPDLLRDRVVPVADLITPNQFELGYLTG-STPDTLESTLASVEA
PDXY_RUBXD      DPVMGDEGRGFFVRPGIPRFMRERAVPAADVVTPNQFELEYLAG-VEVRTLGGALAAAEK
PDXY_DEIGD      DPVMGDVGRGVFVRPELPDLIRTQAVPEADIVTPNQFELELLTG-RRVTRLQEALDASRM
PDXY_DEIRA      DPVMGDVGRGVFVHPDLPALIAAQAIPAADIVTPNQFELELLTG-QKVETLADALAAAHA
PDXY_GRABC      DPVIGDTGRGIFVRPGLPELFRDRAVPTANILTPNQFELEWLTG-HHCRTLADARAAVKV
                **.:            :           :: : **  **  :                  

PDXY_VIBVU      ALAK----GPKVVLVKHLYCLSD----ESFNMLLATQEGTYLAKRPHFEFA--KAPVGAG
PDXY_VIBVY      ALAK----GPKVVLVKHLYCLSD----ESFNMLLATQEGTYLAKRPHFEFA--KAPVGAG
PDXY_VIBPA      ALAK----GPKVVLVKHLYCLEN----GSFNMLLATQEGIYLAKRPQFEFA--KQPVGVG
PDXY_PHOPR      ALAK----GPKVVLVKHLYCVSD----DKFSMLLATPEGCFLAQRPHLTFA--QQPVGVG
PDXY_SHISS      LIAQ----GPQIVLVKHLARAGY--SRDRFEMLLVTADEAWHISRPLVDFGM-RQPVGVG
PDXY_SHIBS      LIAQ----GPQIVLVKHLARAGY--SRDRFEMLLVTADEAWHISRPLVDFGM-RQPVGVG
PDXY_ECOLI      LIAQ----GPQIVLVKHLARAGY--SRDRFEMLLVTADEAWHISRPLVDFGM-RQPVGVG
PDXY_SHIFL      LIEQ----GPQIVLVKHLARAGY--SRDRFEMLLVTADEVWHISRPLVDFGM-RQPVGVG
PDXY_ECO57      LIAQ----GPQIVLVKHLARAGY--SRDRFEMLLVTADEAWHISRPLVDFGM-RQPVGVG
PDXY_SHIDS      LIAQ----GPQIVLVKHLAQAGY--SRDRFEMLLVTADEAWHISRPLVDFGM-RQPVGVG
PDXY_ECOL5      LIAQ----GPQIVLVKHLARAGY--SRDRFEMLLVTADEAWHISRPLVDFGM-RQPVGVG
PDXY_ECOUT      LIAQ----GPQIVLVKHLARAGY--SRDRFEMLLVTADEAWHISRPLVDFGM-RQPVGVG
PDXY_ECOL6      LIAQ----GPQIVLVKHLARAGY--SRDRFEMLLVTADEAWHISRPLVDFGM-RQPVGVG
PDXY_SALCH      LIAQ----GPEIVLVKHLARAGY--SSERFEMLLVTAQEAWHISRPLVDFGS-RQPVGVG
PDXY_SALTY      LIAQ----GPEIVLVKHLARAGY--SSERFEMLLVTAQEAWHISRPLVDFGS-RQPVGVG
PDXY_SALPA      LIAQ----GPEIVLVKHLARAGY--SSERFEMLLVTAQEAWHISRPLVDFGS-RQPVGVG
PDXY_YERPA      LCAR----GPKVVLVKHLSRAGY--HADCFEMLLVTADDAWHICRPLVDFGK-RQPVGVG
PDXY_YERPE      LCAR----GPKVVLVKHLSRAGY--HADCFEMLLVTADDAWHICRPLVDFGK-RQPVGVG
PDXY_YERPN      LCAR----GPKVVLVKHLSRAGY--HADCFEMLLVTADDAWHICRPLVDFGK-RQPVGVG
PDXY_YERPS      LCAR----GPKVVLVKHLSRAGY--HADCFEMLLVTADDAWHISRPLVDFGK-RQPVGVG
PDXY_PECAS      LCEK----GPKIVLVKHLSRAAS--REDSFEMLLVTPTDAWHISRPLVEFE--RQPVGVG
PDXY_PROMI      LCQQ----GPKIVLVKHLSRAGF--RHDRFEMLLVTADHSWHVSRPLVDFGE-RQPVGVG
PDXY_PHOLL      LCDK----GPDIVLVKHLSRAGY--RTDRFEMLLVTKEHSWHVSRPLVDFGE-RQPVGVG
PDXY_BURCA      LIRR----GPQIILVKHLHDRNS--PADRFNMLAVTETEAWIGQRPLYAFP--RHPVGVG
PDXY_BURL3      LIRR----GPQIILVKHLHDRNS--PADRFNMLAVTETEAWIGQRPLYAFP--RHPVGVG
PDXY_BURMA      IIRR----SPQVILVKHLHDRNS--PADRFNMLVVTETEAWIGQRPLYAFP--RHPVGVG
PDXY_BURPS      IIRR----GPQVILVKHLHDRNS--PADRFNMLVVTETEAWIGQRPLYAFP--RHPVGVG
PDXY_BURP1      IIRR----GPQVILVKHLHDRNS--PADRFNMLVVTETEAWIGQRPLYAFP--RHPVGVG
PDXY_BURTA      IIRR----GPRLILVKHLHDRNS--PADRFNMLVVTETEAWIGQRPLYAFP--RHPVGVG
PDXY_PARXL      LIAR----GPKLVLVKHLLDRNS--PADRFNMLVVTEREAWMGQRPLYPFA--RQPVGVG
PDXY_PSE14      LLAR----GPKAVVVKHLDYPGK--AADGFEMLLVTAEASWHLRRPLLAFP--RQPVGVG
PDXY_PSEU2      LLAR----GPRAIVVKHLDYPGK--AADGFEMLLVTAEASWHLRRPLLAFP--RQPVGVG
PDXY_PSESM      LLAR----GPKAIVVKHLDYPGK--AADGFEMLLVTAEASWHLRRPLLAFP--RQPVGVG
PDXY_PSEF5      LLDK----GPRAVLVKHLDYPGK--LVDGFEMLLVTADGSWHLRRPLLAFP--RQPVGVG
PDXY_PSEPF      LLAR----GPKAVLVKHLDYPGK--PADGFEMLLVTAEGSWHLRRPLLAFP--RQPVGVG
PDXY_PSEPK      LLQR----GPQVVLVKHLAYPGR--AEEHFEMLLVTAEHSWHLRRPLLAFP--RQPVGVG
PDXY_PSEAE      LLAR----GPRAILVKHLNYPGK--AGDTFEMLLVAADQAWHLQRPLLAFP--RQPVGVG
PDXY_ALIF1      LLEK----GVKMVVVKHLSRAGI--QKDRFEMLLTTEDGSYHVSRPLYDFDAKRQPVGAG
PDXY_HAES1      ILSK----GPKKVLVKHLSRVGK--NAAQFEMLLANNDGIWHISRPLHNFN--KEPVGVG
PDXY_PASMU      ILAK----GPKKVLVKHLSKVGK--DSSQFEMLLATKDGMWHISRPLHQFR--KEPVGVG
PDXY_MANSM      IRAK----GPKTVLIKHLSKVGK--YADKFEMLLANDEGIWHLTRPLYTFA--KEPVGVG
PDXY_HAEIN      LIAK----GVKKVLVKHLGSAGKINDPDTFEIIMATPEGVWHLSRPLYQFN--FEPVGVG
PDXY_CORDI      AQEM----GPNTVLVTSVRRPET--PADAIEMIAANEQGAWLVRTPFIDFK----RNGSG
PDXY_LEIXX      ARAM----GPSTVLVTSVERPDR--PEGTIEMLAVDDTGAWIVQTPRLPMK----ANGSG
PDXY_RUBXD      VLGL----GPGTVLVTSLRRRDAG-EEGRIEMLAATREGAWLVGTPLLPLE----VNGAG
PDXY_DEIGD      LRGTLREGGPRLVVVTSLVREDA--PQGVIETLAVTGEGAWLCRTPLLPLDP--PRNGTG
PDXY_DEIRA      LRERLNPAGPRIVLLTSLVRADA--PASSIETLAVTGEGSWLCRTPLLPLDP--PRNGTG
PDXY_GRABC      LAESMIRQGPRIILVTSLHVAET--PSGSLDMLVYENGRFYLLRTPLLPV----SINGAG
                        .   :::. :           :. :       :    *   .       * *

PDXY_VIBVU      DLISAIFTAGLLKGWTPKQAFQHCHDACYGVLNATYQAGEWELQTIAAQQEFVEPSKHFP
PDXY_VIBVY      DLISAIFTAGLLKGWTPKQAFQHCHDACYGVLNATYQAGEWELQTIAAQQEFVEPSKHFP
PDXY_VIBPA      DLISAIFTSGLLKGWSPKQAFQHCHDACYGVLSATYHAGEWELQTIAAQQEFVEPSKHFP
PDXY_PHOPR      DLISSLFTAGLLKGYSTMRAFQHCHDACYGVLKQTHQLNEWELQTILAQNELVEPSETFP
PDXY_SHISS      DVTSGLLLVKLLQGATLQEVLEHVTAAVYEIMVTTKAMQEYELQVVAAQDRIAKPEHYFS
PDXY_SHIBS      DVTSGLLLVKLLQGATLQEALEHVTAAVYEIMVTTKAMQEYELQVVAAQDRIAKPEHYFS
PDXY_ECOLI      DVTSGLLLVKLLQGATLQEALEHVTAAVYEIMVTTKAMQEYELQVVAAQDRIAKPEHYFS
PDXY_SHIFL      DVTSGLLLVKLLQGATLQEALEHVTAAVYEIMVTTKAMQEYELQVVAAQDRIAKPEHYFS
PDXY_ECO57      DVTSGLLLVKLLQGATLQEALEHVTAAVYEIMVTTKAMQEYELQVVAAQDRIAKPEHYFS
PDXY_SHIDS      DVTSGLLLVKLLQGATLQEALEHVTAAVYEIMVTTKAMQEYELQVVAAQDRIAKPEHYFS
PDXY_ECOL5      DVTSGLLLVKLLQGATLQEALEHVTAAVYEIMVTTKAMQEYELQVVAAQDRIANPEHYFS
PDXY_ECOUT      DVTSGLLLVKLLQGATLQEALEHVTAAVYEIMVTTKAMQEYELQVVAAQDRIANPEHYFS
PDXY_ECOL6      DVTSGLLLVKLLQGATLQEALEHVTAAVYEIMVTTKAMQEYELQVVAAQDRIANPEHYFS
PDXY_SALCH      DVTSGLLLVKLLQGATLQQALEHVTAAVYEIMIATKTMQEYELQVVAAQDRIANPEHYFS
PDXY_SALTY      DVTSGLLLVKLLQGATLQQALEHVTAAVYEIMIATKTMQEYELQVVAAQDRIANPEHYFS
PDXY_SALPA      DVTSGLLLVKLLQGATLQQALEHVTAAVYEIMIATKTMQEYELQVVAAQDRIANPEHYFS
PDXY_YERPA      DLTSGLLLVNLLKGEPLDKALEHVTAAVYEVMLKTQEMGEYELQVVAAQETIVTPICQFT
PDXY_YERPE      DLTSGLLLVNLLKGEPLDKALEHVTAAVYEVMLKTQEMGEYELQVVAAQETIVTPICQFT
PDXY_YERPN      DLTSGLLLVNLLKGEPLDKALEHVTAAVYEVMLKTQEMGEYELQVVAAQETIVTPICQFT
PDXY_YERPS      DLTSGLLLVNLLKGEPLDKALEHVTAAVYEVMLKTQEMGEYELQVVAAQETIVTPICQFT
PDXY_PECAS      DLTSGLLLVNLLKGVALDKALEHTTAAVYEVMLVTKEMNEYELQLVAAQDGIANPRHHFQ
PDXY_PROMI      DLTSGLMLVDLLKGVELKTALEHVAAAVYEVMLKTKEMNEYELQLVAAQDQMVHPTHNFC
PDXY_PHOLL      DLTSGLLLVNLLKGESLQTALEHVAAAVYEVMVTTKEMGEYELQIVAAQDRMVAPNHKFW
PDXY_BURCA      DLTSAIFVACRLRGDSVRAAFEHTLAAVHAVVKATYDARRYELELVAAQDEIARPSEWFG
PDXY_BURL3      DLTSAIFVACRLRGDSVRAAFEHTLAAVHAVVKATYDARRYELELVAAQDEIARPSEWFG
PDXY_BURMA      DLTSAIFVARRLRGDSVRAAFEHTLAAVHAVVKATYDARRYELELVAAQDEIARPSEWFG
PDXY_BURPS      DLTSAIFVARRLRGDSVRAAFEHTLAAVHAVVKATYDARRYELELVAAQDEIARPSEWFG
PDXY_BURP1      DLTSAIFVARRLRGDSVRAAFEHTLAAVHAVVKATYDARRYELELVAAQDEIARPSEWFG
PDXY_BURTA      DLTSAIFVARRLRGDSVRAAFEHTLAAVHAVVKATYDARRYELELVAAQDEIAQPSEWFG
PDXY_PARXL      DLTSAVFVARTLLGDSIRAAFEHTLAAVNAVVKATWQAGRYELELVAAQSEIAQPREWFD
PDXY_PSE14      DLTSGLFLSRILLGDDLVAAFEFTAAAVHEVLLETQACGSYELELVRAQDRIAHPRVKFD
PDXY_PSEU2      DLTSGLFLSRVLLGDDLVAAFEFAAAAVHEVLLETQACGSYELELVRAQDRIAHPRVKFE
PDXY_PSESM      DLTSGLFLSRILLGDDLVAAFEFTAAAVHEVLLETQACGSYELELVRAQDRIAHPRVKFE
PDXY_PSEF5      DLTSGLFLARVLLGDSLVAAFEFTAAAVHEVLLETQACASYELELVRAQDRIAHPRVRFE
PDXY_PSEPF      DLTSGLFLARVLLGDNLVAAFEFTAAAVHEVLLETQACASYELQLVRAQDRIAHPRVKFE
PDXY_PSEPK      DLTSGLFLARVLLGDSWVQAFEFTAAAVHEVLLETQACASYELQLVRAQDRIAHPRVRFE
PDXY_PSEAE      DLASGLFLSRLLLGDDLRNAFEFTGAAVHEVLLETQACGSYELELVRAQDRIAHPRVRFD
PDXY_ALIF1      DLISGVMLANLMAGYSPIDAFERTNAAVDSVMQETFNRGAYELQLIASQERFNAPEIIVK
PDXY_HAES1      DLTAGLFLANLLNGKSDVEAFEHTANTVNDVMETTHNAGVYELQTIAAREWIVNPKSQYK
PDXY_PASMU      DLTAGLFIANLLNGKSDIEAFEHTANAVNDVMTVTQQKDNYELQIIAAREYIMQPSSQYK
PDXY_MANSM      DLTAGLFLANKVNGKSDLEAFEHMANAVNEVMKTTFELNSYELQLIAARKLIVNPVSSVK
PDXY_HAEIN      DLIAGTFLANLLNGKSDVEAFEAMNNEVAGVMKTTFELGSYELQTIAARFEILNPSSNYK
PDXY_CORDI      DVTAALFTGHYIRERDAADALARTASSVFDLIETTFTADSRELLIIESQEAIAHPRLQFE
PDXY_LEIXX      DVTAALFTAHYVRTGEAETALRKTVSSVYDLLASTLESGERELRLVESQEFYANPREQFA
PDXY_RUBXD      DATAALFLGHLLLGRGLEEALSLTASSVYAVLEKTLRRGAREIQLVAAQESLVAPPVRFP
PDXY_DEIGD      DAIAALFLGHYLRTQDAGTALSLSMSALFAVLDLTHRVGTREIQLVAAQDEYTRPSRVFE
PDXY_DEIRA      DAIAALFYGQFLRTGSAEQALTLSMSALYALLDLTHRLGTREIQLVAAQGEFERPRHLFA
PDXY_GRABC      DAIAALFLFHRLDTGDARQALEKAASSVYGLLKRTAEAGSMEILTVAARQEFLTPSTCFY
                *  :. :    :       .:         ::  *      *:  : ::     *     

PDXY_VIBVU      LEEVTLKTVE-
PDXY_VIBVY      LEEVTLKTVE-
PDXY_VIBPA      IEEVELEMA--
PDXY_PHOPR      IERLNLNLKTA
PDXY_SHISS      ATKL-------
PDXY_SHIBS      ATKL-------
PDXY_ECOLI      ATKL-------
PDXY_SHIFL      ATKL-------
PDXY_ECO57      ATKL-------
PDXY_SHIDS      ATKL-------
PDXY_ECOL5      ATKL-------
PDXY_ECOUT      ATKL-------
PDXY_ECOL6      ATKL-------
PDXY_SALCH      ATRL-------
PDXY_SALTY      ATRL-------
PDXY_SALPA      ATRL-------
PDXY_YERPA      AVRL-------
PDXY_YERPE      AVRL-------
PDXY_YERPN      AVRL-------
PDXY_YERPS      AVRL-------
PDXY_PECAS      AVRLS------
PDXY_PROMI      ATQLD------
PDXY_PHOLL      AIQLD------
PDXY_BURCA      AWVTDA-----
PDXY_BURL3      AWVTDA-----
PDXY_BURMA      AWVTGAD----
PDXY_BURPS      AWVTGAD----
PDXY_BURP1      AWVTGAD----
PDXY_BURTA      AWVTGAD----
PDXY_PARXL      AWVGDTA----
PDXY_PSE14      AVRL-------
PDXY_PSEU2      AVRL-------
PDXY_PSESM      AVRL-------
PDXY_PSEF5      ATPIGF-----
PDXY_PSEPF      ATPISL-----
PDXY_PSEPK      AQLLAL-----
PDXY_PSEAE      AVRL-------
PDXY_ALIF1      AEKVA------
PDXY_HAES1      AVKIG------
PDXY_PASMU      AVKIA------
PDXY_MANSM      AVKIA------
PDXY_HAEIN      AEKVA------
PDXY_CORDI      VEQIA------
PDXY_LEIXX      VSRVG------
PDXY_RUBXD      VRRVA------
PDXY_DEIGD      AERVA------
PDXY_DEIRA      AERVE------
PDXY_GRABC      AQIC-------