CLUSTAL format seed alignment for MF_01640

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

E4PD_AERHH      ---MIKIAINGYGRIGRNVLRALYESGRDKNIKIVAINELAAPEAMVHLTRFDTSHGRFH
E4PD_AERS4      ---MIKIAINGYGRIGRNVLRALYESGRDKNIKIVAINELAAPEAMVHLTRFDTSHGRFR
E4PD_PSYIN      --MSIRIAINGYGRIGRSVVRALYENNRQDEMKVVVINELAEPSAIAHLTQYDSTHGRFP
E4PD_SHESM      ---MIRVAINGYGRIGRSILRALYESGKRQQIQIVAINELAKPEAIVHLTQYDTTHGRFQ
E4PD_SHESR      ---MIRVAINGYGRIGRSILRALYESGKRQQIQIVAINELAKPEAIVHLTQYDTTHGRFQ
E4PD_SHESA      ---MIRVAINGYGRIGRSILRALYESGKRQQIQIVAINELAKPEAIIHLTQYDTTHGRFQ
E4PD_SHEON      ---MIRVAINGYGRIGRSILRALYESGKRQQIQIVAINELAKPEAIIHLTQYDTTHGRFQ
E4PD_SHESW      ---MIRVAINGYGRIGRSILRALYESGKRQQIQIVAINELAKPEAIIHLTQYDTTHGRFQ
E4PD_SHEFN      ---MIRVAINGYGRIGRSILRALYESGKRQQIQIVAINELAKPEAICHLTQYDTTHGRFK
E4PD_SHEDO      ---MIRVAINGYGRIGRSILRALYESGKRQQIQIVAINELAKPEAIRHLTQYDTTHGRFG
E4PD_SHELP      ---MIKVAINGYGRIGRSILRALYESGKRDQIQIVAINELANPEAMLHLTQYDTTHGRFQ
E4PD_SHEAM      ---MIRVAINGYGRIGRSVLRALYESGKRGQMQLVAINELAKPEAIVHLTNYDTTHGRFH
E4PD_PSEA6      ---MIRVAINGFGRVGRNVLRALYETGQNKQIQIVAINELAEPEGVAHLLKYDTAHGRFR
E4PD_SHIFL      --MTVRVAINGFGRIGRNVVRALYESGRRAEITVVAINELADAAGMAHLLKYDTSHGRFA
E4PD_SHIDS      --MTVRVAINGFGRIGRNVVRALYESGRRAEITVVAINELADAAGMAHLLKYDTSHGRFA
E4PD_ECO57      --MTVRVAINGFGRIGRNVVRALYESGRRAEITVVAINELADAAGMAHLLKYDTSHGRFA
E4PD_ECOLI      --MTVRVAINGFGRIGRNVVRALYESGRRAEITVVAINELADAAGMAHLLKYDTSHGRFA
E4PD_ECOL5      --MTVRVAINGFGRIGRNVVRALYESGRRAEITVVAINELADAAGMAHLLKYDTSHGRFA
E4PD_SHIBS      --MTVRVAINGFGRIGRNVVRALYESGRRAEITVVAINELADAAGMAHLLKYDTSHGRFA
E4PD_SHISS      --MTVRVAINGFGRIGRNVVRALYESGRRAEITVVAINELADAAGMAHLLKYDTSHGRFA
E4PD_SHIF8      --MTVRVAINGFGRIGRNVVRALYESGRRAEITVVAINELADAAGMAHLLKYDTSHGRFA
E4PD_ECOL6      --MTVRVAINGFGRIGRNVVRALYESGRRAEITVVAINELADAAGMAHLLKYDTSHGRFA
E4PD_ECOK1      --MTVRVAINGFGRIGRNVVRALYESGRRAEITVVAINELADAAGMAHLLKYDTSHGRFA
E4PD_ECOUT      --MTVRVAINGFGRIGRNVVRALYESGRRAEITVVAINELADAAGMAHLLKYDTSHGRFA
E4PD_SALTI      --MTVRIAINGFGRIGRNVVRALYESGRRAEITVVAINELADAAGMAHLLKYDTSHGRFA
E4PD_SALTY      --MTVRIAINGFGRIGRNVVRALYESGRRAEITVVAINELADAAGMAHLLKYDTSHGRFA
E4PD_SALCH      --MTVRIAINGFGRIGRNVVRALYESGRRAEITVVAINELADAAGMAHLLKYDTSHGRFA
E4PD_SALPA      --MTVRIAINGFGRIGRNVVRALYESGRRAEITVVAINELADAAGMAHLLKYDTSHGRFA
E4PD_YERPA      --MAIRIAINGFGRIGRSVLRALYESGRRAEISVVAINELASAEGMAHLLKYDSSHGRFA
E4PD_YERPE      --MAIRIAINGFGRIGRSVLRALYESGRRAEISVVAINELASAEGMAHLLKYDSSHGRFA
E4PD_YERPN      --MAIRIAINGFGRIGRSVLRALYESGRRAEISVVAINELASAEGMAHLLKYDSSHGRFA
E4PD_YERPS      --MAIRIAINGFGRIGRSVLRALYESGRRAEISVVAINELASAEGMAHLLKYDSSHGRFA
E4PD_YERE8      --MTIRIAINGFGRIGRSVLRALYESGRRAEISVVAINELANAEGMAHLLKYDSSHGRFA
E4PD_PHOLL      --MTIKVAINGFGRIGRSILRALYESGRRAEIAVIAVNELADAEGIAHLLKYDSSHGRFA
E4PD_PECAS      --MTIRIAINGFGRIGRSVLRALYESGRRAEITVVAINELASAEGMAHLLKYDSSHGRFS
E4PD_VIBVU      ---MLKVAINGFGRIGRNVLRAVYESGKHQQIKVVAVNELAQPEAMAHLLQYDTSHGRFG
E4PD_VIBVY      ---MLKVAINGFGRIGRNVLRAVYESGKHQQIKVVAVNELAQPEAMAHLLQYDTSHGRFG
E4PD_VIBPA      ---MLKVAINGFGRIGRNVLRAVYESGKHQQIKVVAVNELAQPEAMAHLLQYDTSHGRFG
E4PD_VIBCH      ---MLRVAINGFGRIGRNVLRAVYESGKRDRIQVVAVNELAKPDAMAHLLQYDTSHGRFG
E4PD_ALIF1      ---MLRVAINGFGRIGRSVLRALYESDKRDKIEVVAVNELSQPEAMAHLFQYDSTHGRFQ
E4PD_PHOPR      --MTLKVAINGFGRIGRSVLRALYESGKHHHINVVAVNELAEPEAMAHLLQYDSSHGRFF
E4PD_PSEHT      --MAIKLAINGFGRIGRNIVRALYESGLSNEIKIVAINELADPEAIAHLLKYDTSHGRFF
E4PD_COLP3      --MTIRIAINGFGRIGRSVVRALYESGKTDLFTLVSINELAPASGIAHLLKYDSTHGRFP
E4PD_IDILO      MSEPARIAINGFGRIGRSFLRALYENGYRDSVQVVLINEPAASEAIAHLLKYDSSHGRFG
                     ::****:**:**..:**:**..    . :: :** : . .: ** .:*::**** 

E4PD_AERHH      HPVQLAGNSMLVGEDL----------ISLFAERDPSRLPWRALGVDVVLDCTGVFGSRAD
E4PD_AERS4      YPVQLAGHSMLVGEDL----------ISLFAEQDPANLPWRALGVDVVLDCTGVFGSRAD
E4PD_PSYIN      FPVNLQNNLLKIKNDD----------IHLVRFSELADLPWHEHDIDIVLDCTGIYGSRAD
E4PD_SHESM      PRVKLVDDQMLIGDDV----------IKILHEPDPAKLPWHEMDIDIVYEATGAILDRNS
E4PD_SHESR      PRVKLVDDQMLIGDDV----------IKILHEPDPAKLPWREMDIDIVYEATGAILDRNS
E4PD_SHESA      PRVKLVDDQMLIGDDV----------IKILHEPDPAKLPWREMDIDIVYEATGAILDRNS
E4PD_SHEON      PRVKLVDGQMQIGDDT----------IKIFHEPDPAKLPWRELDIDIVYEATGAILDRQS
E4PD_SHESW      HKVKLVDNHMLIGDDA----------IKILHEPDAAKLPWREMDIDIVYEATGVILDRQS
E4PD_SHEFN      HTVKLNGDQLLIGDDS----------ILLLNQPDANLLPWAELDIDIVYEATGSLIDRQA
E4PD_SHEDO      QTVELQEGKLHIGDDA----------IALFHQSDATKLPWGELDIDIVFEASGSLIEREA
E4PD_SHELP      SPASLDANVMTIGDDR----------IQLLHEADAEKLPWRSLDIDIVFEATGALIDRQA
E4PD_SHEAM      TRASLDEGMMHLGNDA----------IRLLAIEDAAALPWQALDVDLVFECTGALNDRQS
E4PD_PSEA6      FPVVLDNQQLVVAGDH----------ITLLQQENIRDLPWAQLDIDVVLECTGVNNERVH
E4PD_SHIFL      WEVRQERDQLFVGDDA----------IRVLHERSLQSLPWRELGVDVVLDCTGVYGSREH
E4PD_SHIDS      WEVRQERDQLFVGDDA----------IRVLHERSLQSLPWRELGVDVVLDCTGVYGSREH
E4PD_ECO57      WEVRQERDQLFVGDDA----------IRVLHERSLQSLPWRELGVDVVLDCTGVYGSREH
E4PD_ECOLI      WEVRQERDQLFVGDDA----------IRVLHERSLQSLPWRELGVDVVLDCTGVYGSREH
E4PD_ECOL5      WEVRQERDQLFVGDDA----------IRVLHERSLQSLPWRELGVDVVLDCTGVYGSREH
E4PD_SHIBS      WEVRQERDQLFVGDDA----------IRVLHERSLQSLPWRELGVDVVLDCTGVYGSREH
E4PD_SHISS      WEVRQERDQLFVGDDA----------IRVLHERSLQSLPWRELGVDVVLDCTGVYGSREH
E4PD_SHIF8      WEVRQERDQLFVGDDA----------IRVLHERSLQSLPWRELGVDVVLDCTGVYGSREH
E4PD_ECOL6      WEVRQERDQLFVGDDA----------IRVLHERSLQSLPWRELGVDVVLDCTGVYGSREH
E4PD_ECOK1      WEVRQERDQLFVGDDA----------IRVLHERSLQSLPWRELGVDVVLDCTGVYGSREH
E4PD_ECOUT      WEVRQERDQLFVGDDA----------IRVLHERSLQSLPWRELGVDVVLDCTGVYGSREH
E4PD_SALTI      WEVRHEREQLFVGDDV----------IRILHERTLADLPWRELGVDVVLDCTGVYGNREH
E4PD_SALTY      WEVRHEREQLFVGDDV----------IRILHERTLADLPWRELGVDVVLDCTGVYGNREH
E4PD_SALCH      WEVRHEREQLFVGDDV----------IRILHERTLADLPWRELGVDVVLDCTGVYGNREH
E4PD_SALPA      WEVRHEREQLFVGDDV----------IRILHERTLADLPWRELGVDVVLDCTGVYGNQEH
E4PD_YERPA      WDVRQECDSLYVGDDI----------IRLIHQSEIEQLPWSELGIDVVLDCSGVYGSRED
E4PD_YERPE      WDVRQECDSLYVGDDI----------IRLIHQSEIEQLPWSELGIDVVLDCSGVYGSRED
E4PD_YERPN      WDVRQECDSLYVGDDI----------IRLIHQSEIEQLPWSELGIDVVLDCSGVYGSRED
E4PD_YERPS      WDVRQECDSLYVGDDI----------IRLIHQSEIEQLPWSELGIDVVLDCSGVYGSRED
E4PD_YERE8      WDVRQECDKLYVGDDI----------IRLIHQPEIEQLPWGELGIDVVLDCSGVYGSRAD
E4PD_PHOLL      WDVRLNNDVLQVGDDN----------IRLFHQSDISMLPWQELGIDIVLDCSGIYGSRAD
E4PD_PECAS      WDVRQECDQLYVGDDD----------IRLLHQVEIQQLPWRELSVDIVLDCSGVYGSRED
E4PD_VIBVU      KRISHDQEHLYVHHDACPQGKGEFDSIRILHLSEINLLPWRDLEVDLVLDCTGVFGCQAD
E4PD_VIBVY      KRISHDQEHLYVHHDACPQGKGEFDSIRILHLSEINLLPWRDLEVDLVLDCTGVFGCQAD
E4PD_VIBPA      KKISHDQEHLNVHHES-----GEYDAIRILHLSEIELLPWRDLEVDIVLDCTGVYGSKAD
E4PD_VIBCH      KKISHDQQHIYVHHQN-----GEYDSIRILHLSEIPLLPWRDLGVDLVLDCTGVYGCQED
E4PD_ALIF1      HKVTHDQEYPYSDVPD-----SSQDKVRILHQADLSLLPWQSLEVDLVLDCTGVYGSKSD
E4PD_PHOPR      KPVSHDQEHLFIAHEN-----GERDDIRILHQSDITLLPWHDLDVDIVLDCTGVYGSRED
E4PD_PSEHT      FPVKLGEDTISVAGDA----------IALFCEPNPAELPWKTLGVDVVLECTGVYHSREH
E4PD_COLP3      FSVSEKENQLIINGDE----------IALTHIGNLNSLPWQQQNIDIVLDCTGKYGNKAD
E4PD_IDILO      EKVTQSGDALTVAGDN----------IALTHQTEIEAIDWRAHEVDFVVDCTGVFGSQAD
                                          : :        : *    :*.* :.:*    :  

E4PD_AERHH      AELHLAAGAGKVLFSHPAEADVDATIVYGVNHQVLTGRERIVSNASCTTNCVVPVIETLH
E4PD_AERS4      AELHLGAGAGKVLFSHPADADVDATIVYGVNHQVLTGRERIVSNASCTTNCVVPVIETLH
E4PD_PSYIN      ADAHIAAGAKKVIFSHPADPDVDATVVYGINHQQLTGDETFISGASCTTNCMVPVIDTLD
E4PD_SHESM      CEAHIHAGAKQVLISHPSSADVDGTIVYGVNQDLLRAEHTVVSNASCTTNCIVPVIDVLD
E4PD_SHESR      CEAHIHAGAKQVLISHPSSADVDGTIVYGVNQDLLRAEHTVVSNASCTTNCIVPVIDVLD
E4PD_SHESA      CEAHILAGAKQVLISHPSSADVDGTIVYGVNQDLLRAEHTVVSNASCTTNCIVPVIDVLD
E4PD_SHEON      CEAHIHAGAKQVLISHPSSADVDGTIVYGVNHDLLRAEHTVVSNASCTTNCIVPVIDVLD
E4PD_SHESW      CEAHIHAGAKQVLISHPSSADVDGTIVYGVNHDLLRAEHTVVSNASCTTNCIVPVIDVLD
E4PD_SHEFN      CEAHIHAGAKQVLISHPSSADVDETIVYGVNHDLLRAEHTVISNASCTTNCIVPVIDVLD
E4PD_SHEDO      CEAHIISGAKQVLISHPSSQDVDATIVYGVNHHLLAAEHTVVSNASCTTNCIVPVIDVLD
E4PD_SHELP      CEAHIRAGAKQVLISHPSSGDVDATIVYGVNHQDLKAEHKVVSNASCTTNCLVPIIQVLD
E4PD_SHEAM      AEAHITAGARKVLISHPSSADVDATIVYGVNDASLKATDTVVSNASCTTNCLVPVIDVLD
E4PD_PSEA6      GEQHIAQGAKKVLFSQPCGPDVDATIIMGINEESLKASDSIVSAGSCTTNCIVPVIQVLD
E4PD_SHIFL      GEAHIAAGAKKVLFSHPGSNDLDATVVYGVNQDQLRAEHRIVSNASCTTNCIIPVIKLLD
E4PD_SHIDS      GEAHIAAGAKKVLFSHPGSNDLDATVVYGVNQDQLRAEHRIVSNASCTTNCIIPVIKLLD
E4PD_ECO57      GEAHIAAGAKKVLFSHPGSNDLDATVVYGVNQDQLRAEHRIVSNASCTTNCIIPVIKLLD
E4PD_ECOLI      GEAHIAAGAKKVLFSHPGSNDLDATVVYGVNQDQLRAEHRIVSNASCTTNCIIPVIKLLD
E4PD_ECOL5      GEAHIAAGAKKVLFSHPGSNDLDATVVYGVNQDQLRAEHRIVSNASCTTNCIIPVIKLLD
E4PD_SHIBS      GEAHIAAGAKKVLFSHPGSNDLDATVVYGVNQDQLRAEHRIVSNASCTTNCIIPVIKLLD
E4PD_SHISS      GEAHIAAGAKKVLFSHPGSNDLDATVVYGVNQDQLRAEHRIVSNASCTTNCIIPVIKLLD
E4PD_SHIF8      GEAHIAAGAKKVLFSHPGSNDLDATVVYGVNQDQLRAEHRIVSNASCTTNCIIPVIKLLD
E4PD_ECOL6      GEAHIAAGAKKVLFSHPGSNDLDATVVYGVNQDQLRAEHRIVSNASCTTNCIIPVIKLLD
E4PD_ECOK1      GEAHIAAGAKKVLFSHPGSNDLDTTVVYGVNQDQLRAEHRIVSNASCTTNCIIPVIKLLD
E4PD_ECOUT      GEAHIAAGAKKVLFSHPGSNDLDTTVVYGVNQDQLRAEHRIVSNASCTTNCIIPVIKLLD
E4PD_SALTI      GEAHIAAGAKKVLFSHPGSNDLDATVVFGVNQNQLRAEHRIVSNASCTTNCIIPVIKLLD
E4PD_SALTY      GEAHIAAGAKKVLFSHPGSNDLDATVVFGVNQNQLRAEHRIVSNASCTTNCIIPVIKLLD
E4PD_SALCH      GEAHIAAGAKKVLFSHPGSNDLDATVVFGVNQNQLRAEHRIVSNASCTTNCIIPVIKLLD
E4PD_SALPA      GEAHIAAGAKKVLFSHPGSNDLDATVVFGVNQNQLRAEHRIVSNASCTTNCIIPVIKLLD
E4PD_YERPA      GEAHVASGAKKVLFAHPGGHDLDATVVYGVNHQDLRAEHRIVSNASCTTNCIIPIIQLLD
E4PD_YERPE      GEAHVASGAKKVLFAHPGGHDLDATVVYGVNHQDLRAEHRIVSNASCTTNCIIPIIQLLD
E4PD_YERPN      GEAHVASGAKKVLFAHPGGHDLDATVVYGVNHQDLRAEHRIVSNASCTTNCIIPIIQLLD
E4PD_YERPS      GEAHVASGAKKVLFAHPGGHDLDATVVYGVNHQDLRAEHRIVSNASCTTNCIIPIIQLLD
E4PD_YERE8      GEAHLTSGAKKVLFAHPGGHDLDATVVYGVNHQDLQADHRIVSNASCTTNCIIPIIQLLD
E4PD_PHOLL      GEAHLASGAKKVLFAHPGGNDLDATVVYGVNQHLLTAEDRIVSNASCTTNCIIPIIKLLD
E4PD_PECAS      GEAHLAAGAKKVLFSHPGTTDLDATVVFGVNHDRLESGHRIVSNASCTTNCIIPVIKLLD
E4PD_VIBVU      GLEHIKAGAKKVLFSHPGASDLDNTIIYGVNHETLKAEHNVVSNGSCTTNCIVPIIKVLD
E4PD_VIBVY      GLEHIKAGAKKVLFSHPGASDLDNTIIYGVNHETLKAEHNVVSNGSCTTNCIVPIIKVLD
E4PD_VIBPA      GLAHIEAGAKKVLFSHPGANDLDNTIIYGVNHETLKDEHRVVSNGSCTTNCIVPIIKVLD
E4PD_VIBCH      GQQHIDAGAKLVLFSHPGASDLDNTIIYGVNHETLTAEHKIVSNGSCTTNCIVPIIKVLD
E4PD_ALIF1      GEKHITAGAKKVLFSHPGGSDLDNTIIYGVNHDTLLPEHRIVSNGSCTTNCIIPVIKAID
E4PD_PHOPR      GLAHIKAGAKKVLFSHPAANDIDNTIIYGVNHKTLTSEHRIVSNGSCTTNCIVPVIKIID
E4PD_PSEHT      AQLHLTAGAKKVLFSHPADNDVDATIVYGINDDELKPEHTIVSNGSCTTNCVVPVIKVLD
E4PD_COLP3      GLSHINRGAKKVLFSHPGSQDIDATIIYGINHQTLTSSDRVVSNGSCTTNCIVPVIKVID
E4PD_IDILO      GQLYLQQGVKRVLFSHPGKPDVDFTAIYGVNEKELTVDHKVVSNGSCTTNCIVPVIKVLD
                   ::  *.  *::::*   *:* * : *:*.  *   . .:* .******::*:*. :.

E4PD_AERHH      REFEINCGTITTIHSAMHDQQVIDAYHSDLRRTRAASQSIIPVDTKLAKGLERILPHFAG
E4PD_AERS4      REFEINCGTITTIHSAMHDQQVIDAYHSDLRRTRAASQSIIPVDTKLAKGLERILPHFAG
E4PD_PSYIN      KHFAIKCGTITTIHSAMNDQPVIDAYHSDLRRTRAASQSIIPVDTKLAAGIERILPKFAN
E4PD_SHESM      KHFGVKSGAITTIHSAMNDQQVIDAYHDDLRRTRAAGQSIIPVDTKLARGIERILPHMKD
E4PD_SHESR      KHFGVKSGAITTIHSAMNDQQVIDAYHDDLRRTRAAGQSIIPVDTKLARGIERILPHMKD
E4PD_SHESA      KHFGVKSGAITTIHSAMNDQQVIDAYHDDLRRTRAAGQSIIPVDTKLARGIERILPHMKD
E4PD_SHEON      KHFGVKSGAITTIHSAMNDQQVIDAYHDDLRRTRAAGQSIIPVDTKLARGIERILPHMKD
E4PD_SHESW      KHFGVKSGAITTIHSAMNDQQVIDAYHDDLRRTRAAGQSIIPVDTKLARGIERILPHMKD
E4PD_SHEFN      KHFEVKSGAITTIHSAMNDQQVIDAYHDDLRRTRAAGQSIIPVDTKLARGIERILPHMKD
E4PD_SHEDO      SHFGVISGAITTIHSAMNDQQVIDAYHDDLRRTRAAGQSIIPVDTKLARGIERILPKMKD
E4PD_SHELP      RAFKVRSGAITTIHSAMNDQQVIDAYHDDLRRTRAAGQSIIPVDTKLARGIERILPEMKD
E4PD_SHEAM      RHFGVKSGAITTIHSAMNDQQVIDAYHDDLRRTRAASQSIIPVDTKLARGIERILPQMKD
E4PD_PSEA6      EAFSVSSGTITTIHSSMHDQQVIDAYHPDLRRTRAASQSIIPVDTKLARGIERVLPKFAG
E4PD_SHIFL      DAYGIESGTVTTIHSAMHDQQVIDAYHPDLRRTRAASQSIIPVDTKLAAGITRFFPQFND
E4PD_SHIDS      DAYGIESGTVTTIHSAMHDQQVIDAYHPDLRRTRAASQSIIPIDTKLAAGITRFFPQFND
E4PD_ECO57      DAYGIESGTVTTIHSAMHDQQVIDAYHPDLRRTRAASQSIIPVDTKLAAGITRFFPQFND
E4PD_ECOLI      DAYGIESGTVTTIHSAMHDQQVIDAYHPDLRRTRAASQSIIPVDTKLAAGITRFFPQFND
E4PD_ECOL5      DAYGIESGTVTTIHSAMHDQQVIDAYHPDLRRTRAASQSIIPVDTKLAAGITRFFPQFND
E4PD_SHIBS      DAYGIESGTVTTIHSAMHDQQVIDAYHPDLRRTRAASQSIIPVDTKLAAGITRFFPQFND
E4PD_SHISS      DAYGIESGTVTTIHSAMHDQQVIDAYHPDLRRTRAASQSIIPVDTKLAAGITRFFPQFND
E4PD_SHIF8      DAYGIESGTVTTIHSAMHDQQVIDAYHPDLRRTRAASQSIIPVDTKLAAGITRFFPQFND
E4PD_ECOL6      DAYGIESGTVTTIHSAMHDQQVIDAYHPDLRRTRAASQSIIPVDTKLAAGITRFFPQFND
E4PD_ECOK1      DAYGIESGTVTTIHSAMHDQQVIDAYHPDLRRTRAASQSIIPVDTKLAAGITRFFPQFND
E4PD_ECOUT      DAYGIESGTVTTIHSAMHDQQVIDAYHPDLRRTRAASQSIIPVDTKLAAGITRFFPQFND
E4PD_SALTI      DAYGIESGTVTTIHSAMNDQQVIDAYHSDLRRTRAASQSIIPVDTKLAAGITRIFPQFND
E4PD_SALTY      DAYGIESGTVTTIHSAMNDQQVIDAYHSDLRRTRAASQSIIPVDTKLAAGITRIFPQFND
E4PD_SALCH      DAYGIESGTVTTIHSAMNDQQVIDAYHSDLRRTRAASQSIIPVDTKLAAGITRIFPQFND
E4PD_SALPA      DAYGIESGTVTAIHSAMNDQQVIDAYHSDLRRTRAASQSIIPVDTKLAAGITRIFPQFND
E4PD_YERPA      IAYGIESGTVTTIHSSMNDQPVIDAYHQDLRRTRAASQSIIPVDTKLAAGITRIFPKFCD
E4PD_YERPE      IAYGIESGTVTTIHSSMNDQPVIDAYHQDLRRTRAASQSIIPVDTKLAAGITRIFPKFCD
E4PD_YERPN      IAYGIESGTVTTIHSSMNDQPVIDAYHQDLRRTRAASQSIIPVDTKLAAGITRIFPKFCD
E4PD_YERPS      IAYGIESGTVTTIHSSMNDQPVIDAYHQDLRRTRAASQSIIPVDTKLAAGITRIFPKFCD
E4PD_YERE8      VAFGIESGTVTTIHSSMNDQPVIDAYHQDLRRTRAASQSIIPVDTKLAAGITRIFPKFCD
E4PD_PHOLL      DQFEIESGTVTTIHASMNDQPVIDAYHKDLRRTRAASQSIIPVDTKLAAGITRIFPKFCD
E4PD_PECAS      DAFGIENGTVTTIHSSMNDQPVIDAYHHDLRRTRAASQSIIPVDTKLSAGITRIFPQFVD
E4PD_VIBVU      EAFGIESGTITTIHSSMNDQQVIDAYHSDLRRTRAASQSIIPVDTKLHKGIERIFPKFSN
E4PD_VIBVY      EAFGIESGTITTIHSSMNDQQVIDAYHSDLRRTRAASQSIIPVDTKLHKGIERIFPKFSN
E4PD_VIBPA      EAFGIESGTITTIHSSMNDQQVIDAYHNDLRRTRAASQSIIPVDTKLHKGIERIFPKFSN
E4PD_VIBCH      DAFGIDSGTITTIHSSMNDQQVIDAYHNDLRRTRAASQSIIPVDTKLHKGIERIFPKFSN
E4PD_ALIF1      DAFGIDSGTITTIHSSMNDQQVIDAYHSDLRRTRAASQSIIPVDTKLHKGIERIFPKFSN
E4PD_PHOPR      DAFGIESGTITTIHSAMNDQQVIDGYHSDLRRTRAASQSIIPVDTKLHLGIGRIFPKFVD
E4PD_PSEHT      DAFGIESGAITTIHASMNDQPVIDAYHHDLRRTRAASQSIIPVDTKLARGIDRILPKFKG
E4PD_COLP3      EAFGVESGSITTIHSSMHDQQVIDAYHKDLRLSRAASQSIIPVDTKLAAGIERILPKFKG
E4PD_IDILO      DAFGIDSGAITTIHSAMHDQQVIDAYHPDLRRTRAAGRSIIPVDTRLARGIERILPHLEG
                  : :  *::*:**::*:** ***.** *** :***.:****:**:*  *: *.:*.: .

E4PD_AERHH      KFEAIAVRVPTINVTAMDLSITVRKKVTVTDVNQALQRASRGT-LSGILDYTEEPLVSVD
E4PD_AERS4      KFEAIAVRVPTINVTAMDLSITVRKKVTVTDVNQALQRASRGT-LSGILDYTEEPLVSVD
E4PD_PSYIN      KFEAIAVRVPTINVTAMDLSITVSKDVTIQEINDCLLKASETN-LKDILGYTEAPLVSID
E4PD_SHESM      KFEAISVRVPTINVTAIDLSVTLDKTVDIATVNQVLELAANGR-FNGILGYTDEPLVSCD
E4PD_SHESR      KFEAISVRVPTINVTAIDLSVTLDKTVDIATVNQVLELAANGR-FNGILGYTDEPLVSCD
E4PD_SHESA      KFEAISVRVPTINVTAIDLSVTLDKTVDIATVNQVLELAANGR-FNGILGYTDEPLVSCD
E4PD_SHEON      KFEAISVRVPTINVTAIDLSVTLDKTVDIATVNQVLELAANGR-FNGILGYTDEPLVSCD
E4PD_SHESW      KFEAISVRVPTINVTAIDLSVTLAKTVDIASVNQVLELAANGR-FNGILGYTDEPLVSCD
E4PD_SHEFN      KFEAISVRVPTINVTAIDLSVTLEKKVNIEQINSVLQRASNGS-FNGILGYTDEPLVSCD
E4PD_SHEDO      KFEAISVRVPTINVTAIDVSVTLRDRVDISIINSVLQQAAKGR-FDGILGYTDEPLVSCD
E4PD_SHELP      KFEAISVRVPTINVTAIDLSVTLDKRVDIDTVNQVLSQAANGS-YQGVVGYTNAPLVSCD
E4PD_SHEAM      KFEAISVRVPTINVTAIDLSVTLDTRVDIATVNAALKAAADGS-ASGILGYTDEPLVSCD
E4PD_PSEA6      KFEAIAVRVPTINVSAMDLSVTLDAKVTIDDVNQALKTVKNGR-LNGILDFTEEPLVSVD
E4PD_SHIFL      RFEAIAVRVPTINVTAIDLSVTVKKPVKANEVNLLLQKAAQGA-FHGIVDYTELPLVSVD
E4PD_SHIDS      RFEAIAVRVPTINVTAIDLSVTVKKPVKANEVNLLLQKAAQGA-FHGIVDYTELPLVSVD
E4PD_ECO57      RFEAIAVRVPTINVTAIDLSVTVKKPVKANEVNLLLQKAAQGA-FHGIVDYTELPLVSVD
E4PD_ECOLI      RFEAIAVRVPTINVTAIDLSVTVKKPVKANEVNLLLQKAAQGA-FHGIVDYTELPLVSVD
E4PD_ECOL5      RFEAIAVRVPTINVTAIDLSVTVKKPVKANEVNLLLQKAAQGA-FHGIVDYTELPLVSVD
E4PD_SHIBS      RFEAIAVRVPTINVTAIDLSVTVKKPVKANEVNLLLQKAAQGA-FHGIVDYTELPLVSVD
E4PD_SHISS      RFEAIAVRVPTINVTAIDLSVTVKKPVKANEVNLLLQKAAQGA-FHGIVDYTELPLVSVD
E4PD_SHIF8      RFEAIAVRVPTINVTAIDLSVTVKKPVKANEVNLLLQKAAQGA-FHGIVDYTELPLVSVD
E4PD_ECOL6      RFEAIAVRVPTINVTAIDLSVTVKKPVKANEVNLLLQKAAQGA-FHGIVDYTELPLVSVD
E4PD_ECOK1      RFEAIAVRVPTINVTAIDLSVTVKKPVKANEVNLLLQKAAQGA-FHGIVDYAELPLVSVD
E4PD_ECOUT      RFEAIAVRVPTINVTAIDLSVTVKKPVKANEVNLLLQKAAQGA-FHGIVDYTELPLVSVD
E4PD_SALTI      RFEAIAVRVPTINVTAIDLSVTVKKPVKASEVNQLLQKAAQGA-FHGIVDYTESPLVSID
E4PD_SALTY      RFEAIAVRVPTINVTAIDLSVTVKKPVKASEVNQLLQKAAQGA-FHGIVDYTESPLVSID
E4PD_SALCH      RFEAIAVRVPTINVTAIDLSVTVKKPVKASEVNQLLQKAAQGA-FHGIVDYTESPLVSID
E4PD_SALPA      RFEAIAVRVPTINVTAIDLSVTVKKPVKASEVNQLLQKAAQGA-FHGIVDYTESPLVSID
E4PD_YERPA      RFEAISVRVPTINVTAIDLSVSVTHPVGVAEVNQLLQKAARGA-FRGIVDYTELPLVSMD
E4PD_YERPE      RFEAISVRVPTINVTAIDLSVSVTHPVGVAEVNQLLQKAARGA-FRGIVDYTELPLVSMD
E4PD_YERPN      RFEAISVRVPTINVTAIDLSVSVTHPVGVAEVNQLLQKAARGA-FRGIVDYTELPLVSMD
E4PD_YERPS      RFEAISVRVPTINVTAIDLSVSVTHPVGVAEVNQLLQKAARGA-FRGIVDYTELPLVSMD
E4PD_YERE8      RFEAISVRVPTINVTAIDLSVSVTSPVDVAEVNQLLQKAARGS-FRGIVDYTELPLVSTD
E4PD_PHOLL      RFEAISVRVPTINVTAIDLSVTVKSSVTVNKINELMQKSAATS-FRGIVDYTELPLVSTD
E4PD_PECAS      RFEAISVRVPTINVTAIDLSVSVRKAVNVNEINALLQKSAHES-FRGIVDYTELPLVSAD
E4PD_VIBVU      KFEAISVRVPTVNVTAMDLSVTINTNVKVNDVNQTIVNASQCT-LRGIVDYTEAPLVSID
E4PD_VIBVY      KFEAISVRVPTVNVTAMDLSVTINTNVKVNDVNQTIVNASQCT-LRGIVDYTEAPLVSID
E4PD_VIBPA      KFEAISVRVPTVNVTAMDLSVTINTNVKVNDVNQTIVNASQCT-LRNIVDYTESPLVSID
E4PD_VIBCH      KFEAISVRVPTVNVTAMDLSVTIKSNVKVNDVNQTIVNASQCT-LRGIVDYTEAPLVSID
E4PD_ALIF1      KFEAISVRVPTVNVTAMDLSVTINTNVKVNDINQTIVNASRCT-LHNIVDYTEAPLVSID
E4PD_PHOPR      KFEAISVRVPTINVTAMDLSVTVKTNVKVNDVNQALSEVSRCT-LEGIVDYTEAPLVSID
E4PD_PSEHT      RFEAIAVRVPTINVTAMDLSVTVNTDVDLNAVNNALKAQAKDR-LEGILSYTAEPLVSID
E4PD_COLP3      RFEAIAVRVPTINVTAMDLSLTVNNDVCICDINQAIQAATSNHDLYGVLSYTEEPLVSVD
E4PD_IDILO      RFEAIAVRVPTTNVTAMDLSVTLNSDATIEQINQVLRE-QSERQLAGILDYTEEPLVSID
                :****:***** **:*:*:*:::   .    :*  :          .::.::  **** *

E4PD_AERHH      FNHDAHSCIIDGTQTRVSDANLVKMLMWCDNEWGFANRMLDTTRAMMAAG----------
E4PD_AERS4      FNHDAHSCIIDGTQTRVSDANLVKMLMWCDNEWGFANRMLDTTRAMMAAG----------
E4PD_PSYIN      FNHDPRSCIIDGTQTRVSDGNLVKLLVWCDNEWGFANRLLDTSFYLANLAEQKRLQSTET
E4PD_SHESM      FNHDPRSSIVDGTQTRVSAGQLVKLLLWCDNEWGFANRMLDTSLAMIAAKQS--------
E4PD_SHESR      FNHDPRSSIVDGTQTRVSAGQLVKLLLWCDNEWGFANRMLDTSLAMIAAKQS--------
E4PD_SHESA      FNHDPRSSIIDGTQTRVSAGQLVKLLLWCDNEWGFANRMLDTSLAMIAAKQS--------
E4PD_SHEON      FNHDPRSSIVDGTQTRVSAGQLVKLLLWCDNEWGFANRMLDTSLAMIAAKQS--------
E4PD_SHESW      FNHDPRSSIVDGTQTRVSAGQLVKLLLWCDNEWGFANRMLDTSLAMIAAKQS--------
E4PD_SHEFN      FNHDPRSSIVDGTQTRVSAGHLVKLLLWCDNEWGFANRMLDTSLAMIQAKLDR-------
E4PD_SHEDO      FNHDPRSSIVDATQTRVSDGHLVKLLLWCDNEWGFANRMLDTSLAMIRAKSAKSVK----
E4PD_SHELP      FNHDPRSSIVDGTQTRVSDGHLVKLLLWCDNEWGFANRMLDTSLEMIKAVRA--------
E4PD_SHEAM      FNHDPRSSVVDGTQTRVSAGHLVKMLLWCDNEWGFANRMLDTALAMAATQAE--------
E4PD_PSEA6      FNHDAHSCIVDGTQTRVSHKQLVKLLVWCDNEWGFSNRMIDIVLVMNTLSLGNTGK----
E4PD_SHIFL      FNHDPHSAIVDGTQTRVSGAHLIKTLVWCDNEWGFANRMLDTTLAMATVAFR--------
E4PD_SHIDS      FNHDPHSAIVDGTQTRVSGAHLIKTLVWCDNEWGFANRMLDTTLAMATVAFR--------
E4PD_ECO57      FNHDPHSAIVDGTQTRVSGAHLIKTLVWCDNEWGFANRMLDTTLAMATVAFR--------
E4PD_ECOLI      FNHDPHSAIVDGTQTRVSGAHLIKTLVWCDNEWGFANRMLDTTLAMATVAFR--------
E4PD_ECOL5      FNHDPHSAIVDGTQTRVSGAHLIKTLVWCDNEWGFANRMLDTTLAMATVAFR--------
E4PD_SHIBS      FNHDPHSAIVDGTQTRVSGAHLIKTLVWCDNEWGFANRMLDTTLAMATVAFR--------
E4PD_SHISS      FNHDPHSAIVDGTQTRVSGAHLIKTLVWCDNEWGFANRMLDTTLAMATVAFR--------
E4PD_SHIF8      FNHDPHSAIVDGTQTRVSGAHLIKTLVWCDNEWGFANRMLDTTLAMATVAFR--------
E4PD_ECOL6      FNHDPHSAIVDGTQTRVSGAHLIKTLVWCDNEWGFANRMLDTTLAMATVAFR--------
E4PD_ECOK1      FNHDPHSAIVDGTQTRVSGAHLIKTLVWCDNEWGFANRMLDTTLAMATVAFR--------
E4PD_ECOUT      FNHDPHSAIVDGTQTRVSGAHLIKTLVWCDNEWGFANRMLDTTLAMATVAFR--------
E4PD_SALTI      FNHDPHSAIVDGTQTRVSGAHLIKTLVWCDNEWGFANRMLDTTLAMAAVGFRLDASASTK
E4PD_SALTY      FNHDPHSAIVDGTQTRVSGAHLIKTLVWCDNEWGFANRMLDTTLAMAAVGFRLDASASTK
E4PD_SALCH      FNHDPHSAIVDGTQTRVSGAHLIKTLVWCDNEWGFANRMLDTTLAMAAVGFRLDASASTK
E4PD_SALPA      FNHDPHSAIVDGTQTRVSGAHLIKTLVWCDNEWGFANRMLDTTLAMAAVDFRLDASASTK
E4PD_YERPA      FNHDPHSAIVDGTQTRVSGQHLIKTLVWCDNEWGFANRMLDTTLAMAKSGF---------
E4PD_YERPE      FNHDPHSAIVDGTQTRVSGQHLIKTLVWCDNEWGFANRMLDTTLAMAKSGF---------
E4PD_YERPN      FNHDPHSAIVDGTQTRVSGQHLIKTLVWCDNEWGFANRMLDTTLAMAKSGF---------
E4PD_YERPS      FNHDPHSAIVDGTQTRVSGQHLIKTLVWCDNEWGFANRMLDTTLAMAKSGF---------
E4PD_YERE8      FNHDPHSAIVDCTQTRVSGQHLIKTLVWCDNEWGFANRMLDTTLAMARSGF---------
E4PD_PHOLL      FNHDPHSAIVDGTQTRVSGQHLIKTLVWCDNEWGFANRMLDTTLAMAAMGFK--------
E4PD_PECAS      FNHDPHSAIVDGTQTRVSGQHLIKTLVWCDNEWGFANRMLDTTRAMAACGF---------
E4PD_VIBVU      FNHDPHSAIVDGSQTRVSNGHLVKMLVWCDNEWGFANRMLDTALAMQAAQ----------
E4PD_VIBVY      FNHDPHSAIVDGSQTRVSNGHLVKMLVWCDNEWGFANRMLDTALAMQAAK----------
E4PD_VIBPA      FNHDPHSAIVDGTQTRVSNGQLVKMLVWCDNEWGFANRMLDTALAMKASSQVEL------
E4PD_VIBCH      FNHDPHSAIVDGTQTRVSNGQLVKMLVWCDNEWGFANRMLDTALAMQATQ----------
E4PD_ALIF1      FNHDPHSAIVDGSQTRVSNGHLVKMLVWCDNEWGFANRMLDTALAMSK------------
E4PD_PHOPR      FNHDPHSAIVDGTQTRVSNKHLIKLLVWCDNEWGFANRMLDTALAMHASDAAQHSNKELR
E4PD_PSEHT      FNHDPHSCIIDGTQTRVSHKRLIKLLVWCDNEWGFANRMLDTARAMVALEKITNIK----
E4PD_COLP3      FNHDPHSCIVDGNQTRVSHKRLIKMLVWCDNEWGFANRMLDTAMAMHQAEN---------
E4PD_IDILO      FNHDPHSSIVDGTQTRVSHKRLVKLLCWCDNEWGFANRLLDTAKTMAEQTEH--------
                ****.:*.::* .*****  .*:* * ********:**::*    :              

E4PD_AERHH      ------------------------
E4PD_AERS4      ------------------------
E4PD_PSYIN      VKSLEDTGISNEIKDELQDRRKII
E4PD_SHESM      ------------------------
E4PD_SHESR      ------------------------
E4PD_SHESA      ------------------------
E4PD_SHEON      ------------------------
E4PD_SHESW      ------------------------
E4PD_SHEFN      ------------------------
E4PD_SHEDO      ------------------------
E4PD_SHELP      ------------------------
E4PD_SHEAM      ------------------------
E4PD_PSEA6      ------------------------
E4PD_SHIFL      ------------------------
E4PD_SHIDS      ------------------------
E4PD_ECO57      ------------------------
E4PD_ECOLI      ------------------------
E4PD_ECOL5      ------------------------
E4PD_SHIBS      ------------------------
E4PD_SHISS      ------------------------
E4PD_SHIF8      ------------------------
E4PD_ECOL6      ------------------------
E4PD_ECOK1      ------------------------
E4PD_ECOUT      ------------------------
E4PD_SALTI      L-----------------------
E4PD_SALTY      L-----------------------
E4PD_SALCH      L-----------------------
E4PD_SALPA      L-----------------------
E4PD_YERPA      ------------------------
E4PD_YERPE      ------------------------
E4PD_YERPN      ------------------------
E4PD_YERPS      ------------------------
E4PD_YERE8      ------------------------
E4PD_PHOLL      ------------------------
E4PD_PECAS      ------------------------
E4PD_VIBVU      ------------------------
E4PD_VIBVY      ------------------------
E4PD_VIBPA      ------------------------
E4PD_VIBCH      ------------------------
E4PD_ALIF1      ------------------------
E4PD_PHOPR      SKIAIKNS----------------
E4PD_PSEHT      ------------------------
E4PD_COLP3      ------------------------
E4PD_IDILO      ------------------------