CLUSTAL format seed alignment for MF_01642

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

DAPAT_CHLCV      --MQRNNNFSKLETSYLFSSIRQKIRAFREAHPDVSIIDLSIGDTTQPLHTAVMDTFTKS
DAPAT_CHLFF      --MRRNSNFSSLETNYLFSSIRQKIRSFREKHPEISIIDLSIGDTTQPLHASVIDTFSTS
DAPAT_CHLAB      --MRRNTNFSNLEANYLFSGIRQKIQAFRKQHPEASIIDLSIGDTSYPLHTSVIHTFTQS
DAPAT_CHLTB      --MKRNPHFVSLTKNYLFADLQKRVAQFRLENPQHTVINLSIGDTTQPLNASVAEAFASS
DAPAT_CHLT2      --MKRNPHFVSLTKNYLFADLQKRVAQFRLENPQHTVINLSIGDTTQPLNASVAEAFASS
DAPAT_CHLTA      --MKRNPHFVSLTKNYLFADLQKRVAQFRLENPQHTVINLSIGDTTQPLNASVAEAFASS
DAPAT_CHLTR      --MKRNPHFVSLTKNYLFADLQKRVAQFRLENPQHTVINLSIGDTTQPLNASVAEAFASS
DAPAT_CHLMU      --MKRNPNFTSLTQNYLFSDLRNRIAQFHSENPQHQVINLSIGDTTQPLDTSVAEAFSQA
DAPAT_CHLPN      --MRRNPHFSLLKPQYLFSEISKKLAQFRKENPEISVIDLSIGDTTQPLCRSITQAIKEF
DAPAT_PARUW      -MVKRNVHLTKLQSGYLFPEINRRKNEFLKKHPSAQLINLGIGDTTQPIPLYISEAMQNF
DAPAT_BACFR      -MALVNEHFLKLPGSYLFSDIAKKVNTFKITHPKRDIIRLGIGDVTRPLPKACIEAMHKA
DAPAT_BACFN      -MALVNEHFLKLPGSYLFSDIAKKVNTFKITHPKRDIIRLGIGDVTRPLPKACIEAMHKA
DAPAT_BACTN      -MALVNEHFLKLPGSYLFSDIAKKVNTFKITHPKQDIIRLGIGDVTQPLPKACIEAMHKA
DAPAT_BACV8      -MALVNEHFLKLPNNYLFSDIAKKVNAFKVSHPKTDLIRLGIGDVTRPLPQTSIEAMYKA
DAPAT_PARD8      -MALINEHFLKLQNNYLFSDIAKKVNSFKVTHPKDKIIRMGIGDVTQPLAPAVIEAMHKA
DAPAT_LAWIP      -MAHTNKHYLDLPGSYFFTEINQRVNTYKKTHPEKSIIRLSIGDVTRPLVPAVIKALHDA
DAPAT_LACP7      -MFKINENYLKLQGSYLFSTIGKKVRTYKEENPDKNVISLGIGDVTLPLAPSIISALHKA
DAPAT_METST      MAVKVNEYYSLIQNNYLFVEIARRVDEYQKENPDANLIKMGIGDVTRPLAKSVVEAFKRA
DAPAT_METS3      MVVKINENYLKLKSSYLFVEVARREAEFQKNNPDADIIKMGIGDVTKPLAPSVIKAFQGA
DAPAT_METTH      -MVTVNENYLLLKSSYIFSEINRRVEEFQRKNPDADIIRMGIGDVTRPLPEAVVEAFHRA
DAPAT_HELMI      -MALVNENYLKLPGSYLFSEIARRVNQFKKANPEADIIRLGIGDVTRPLVPAVVEAMKKA
DAPAT_DESHY      -MAQINENYLKLPGSYLFSEIARRVNEFKVQNPDADIIRLGIGDVTRPLAPVVVEAMKQA
DAPAT_HUNT2      -MAFINENYLKLPGSYLFSEIARRVDNFRKENPNAKIIRLGIGDVTKPLAPAVIDALHKA
DAPAT_MICAN      -MATINSNYLKLKAGYLFPEIARRVQAFAAANPDANIIRLGIGDVTEPLPLACREAMIKA
DAPAT_SYNY3      -MASINDNYLKLKAGYLFPEIARRVNAFTTANPNAQVIKLGIGDVTEPLPLACRQAMAKA
DAPT1_NOSS1      -MATINDNYLKLKAGYLFPEIARRVNAFAEANPDAKIIRLGIGDVTEPLPAACRSAMIQA
DAPT1_TRIV2      -MATINDNYLKLKAGYLFPEIARRVNAFAEANPDAKIIRLGIGDVTEPLPEACRTAMIQA
DAPAT_TRIEI      -MATINDNYLKLKAGYLFPEIARRVNTFAEAHPEAQIIKLGIGDVTEPLPKACIQAMTKA
DAPAT_ACAM1      -MATINDNYLKLKAGYLFPEIGRRVSAFAEANPDAPIIKLGIGDVTEPLPEACRSAMVTA
DAPAT_SYNP6      -MATINDNYLKLKAGYLFPEIARRVNAFAQSNPEAAIIRLGIGDVTEPLPVACRQAMIQA
DAPAT_SYNE7      -MATINDNYLKLKAGYLFPEIARRVNAFAQSNPEAAIIRLGIGDVTEPLPVACRQAMIQA
DAPAT_SYNJB      -MARINDHFLKLKTGYLFPEIARRVQAFATAHPEAQIIKMGIGDVTEPLPEACRTAMIRA
DAPAT_SYNJA      -MARINDHFLKLKAGYLFPEIARRVQAFAAAHPEAQIIKMGIGDVTEPLPEACRTAMIRA
DAPAT_THEEB      -MAFVNANYLKLKAGYLFPEIARRVNQFLQAHPDAPLIRLGIGDVTEPLPAACREAMIKA
DAPAT_PROM1      -MVKVNADYLKLKAGYLFPEISRRITEFSSKNPNANLIRLGIGDVTEPLPLACREAMKAA
DAPAT_PROMT      -MVKVNADYLKLKAGYLFPEISRRITEFSSKNPNADLIRLGIGDVTEPLPLACREAMKAA
DAPAT_PROMA      -MVQVNSNYLKLKAGYLFPEISRRVNAFCELNPTASLIRLGIGDVTEPLPQACCKAMKTA
DAPAT_PROMS      -MVQVNENYLKLKAGYLFPEIAKRVKLYSQSNKNAEIIKLGIGDVTEPLPRACIEAMGKA
DAPAT_PROM9      -MVQVNENYLKLKAGYLFPEIAKRVKIYSQSNKSAEIIKLGIGDVTEPLPRACIDAMSKA
DAPAT_PROM0      -MVQVNENYLKLKAGYLFPEIAKRVKAYSQSNKSADIIKLGIGDVTEPLPRACIEAMGKA
DAPAT_PROM5      -MVQINENYLKLKAGYLFPEISKRVNSYTQANQGSEVIKLGIGDVTEPLPNACINAMSKA
DAPAT_PROMP      -MVKVNENYLKLKAGYLFPEISKRVNNYTQANSSSKVIKLGIGDVTEPLPKACVKAMGEA
DAPAT_PROM3      -MVQVNSNYLKLKAGYLFPEIARRIKSFSEANPDAALIRLGIGDVTEPLPLACRNAMKVA
DAPAT_PROMM      -MVQVNSNYLKLKAGYLFPEIARRIKSFSEANPDAALIRLGIGDVTEPLPLACRNAMKVA
DAPAT_SYNPW      -MVQVNGNYLKLKAGYLFPEIGRRVKAFSAANPDAALIRLGIGDVTEPLPQACRDAMKTA
DAPAT_SYNPX      -MVQVNGNYLKLKAGYLFPEIGRRVKAFSAANPDAALIRLGIGDVTEPLPLACREAMKTA
DAPAT_SYNSC      -MVQVNGNYLKLKAGYLFPEIGRRVKAFSSANPDAALIRLGIGDVTEPLPLACREAMKTA
DAPAT_SYNS9      -MVKVNGNYLKLKAGYLFPEIGRRVKAFSAANPEAALIRLGIGDVTEPLPLACREAMKTA
DAPAT_SYNS3      -MVKVNGNYLKLKAGYLFPEIGRRVKAFSSANPEAQLIRLGIGDVTEPLPQACRDAMKSA
DAPAT_SYNR3      -MALVNGNYLKLKAGYLFPEIGRRVKAFSEANPDAALIRLGIGDVTEPLPQACRDAMKNA
DAPAT_GEOSL      -MAKINDHYLKLKAGYLFPEIGRRVREFAAANPSAKVIRLGIGDVTRPLAPAVIKAFHEA
DAPAT_GEOMG      -MAKINDNYLKLKAGYLFPEIGRRVREFSAANPEAKVIRLGIGDVTRPLAPAIIKAFHDA
DAPAT_GEOUR      -MALINDNYLKLKAGYLFPEIGRRVRAFAEANPSAKVIRLGIGDVTRPLAPAVLKAFHAA
DAPAT_PELPD      -MAKINDNYLKLKAGYLFPEIGRRVRAFAEANPQANVIRLGIGDVTRPLPPAILKAFHDA
DAPAT_PELCD      -MAQLNDNYLKLKAGYLFPEIGRRVKAFSQANPEAKIIRLGIGDVTQPLAPAVLKAFHDG
DAPAT_LEPIN      -MANINENYLKLKAGYLFPEISKRVKIYSEKNPSAKIIRLGIGDVTLPIVPSVVDAMVEA
DAPAT_LEPIC      -MANINENYLKLKAGYLFPEISKRVKIYSEKNPSAKIIRLGIGDVTLPIVPSVVDAMVEA
DAPAT_LEPBL      -MANINENYLKLKAGYLFPEISKRVKTYSEKNPSAKIIRLGIGDVTLPIVPSVVDAMIAA
DAPAT_LEPBJ      -MANINENYLKLKAGYLFPEISKRVKTYSEKNPSAKIIRLGIGDVTLPIVPSVVDAMIAA
DAPAT_LEPBA      -MTQINENYLKLKAGYLFPEIGRRVKAYSDANQNAKIIRLGIGDVTLPLAPTIVNAMVDA
DAPAT_DESVH      MAAFKLADRLATLPPYLFAGIDKVKAEVAARG--VDIISLGIGDPDMATPGFIIEAMKEA
DAPAT_DESVV      MAAFKLADRLATLPPYLFAGIDKVKAEVAARG--VDIISLGIGDPDMATPGFIIEAMKEA
DAPAT_DESAG      MTQFTLADRLATLPPYLFAQIDKVKAEVAARG--VDIISLGIGDPDMPTPDFVIEALKKA
DAPAT_SYNFM      -MAFVKAERLKLLPPYLFQEIDRLKAELTAKG--VDVINLGVGDPDLPTPDHIIARLKTA
DAPAT_AQUAE      --MFEFSDRLKVLPPYLFAELDRKKQEKIEQG--VDVIDLGVGDPDMPTPKPIVEAAKKA
DAPT2_NOSS1      ---MQFAKRLEKIPPYLFAEINRKREALIAKG--VDIINIGVGDPDKPTPAHILQAMREA
DAPT2_TRIV2      ---MQFAKRLEKIPPYLFAEINRKREALIAQG--VDIINIGVGDPDKPTPAHILQAMREA
DAPAT_GLOVI      ---MKTAARLDRIPPYLFAEIDRRRDEAVARG--VDIINMGIGDPDKPTPPVVLEAMHAA
DAPAT_DESAP      -MSFVEAKRIRNLPPYLFARIEQLIADKKAQG--VDVISLGIGDPDVPTPDHIIEAAEKE
DAPAT_CARHZ      ---MLEATRVRNLPPYLFARIERLIAEKKEAG--VDVISLGIGDPDTPTPKHIIEELYLA
DAPAT_MOOTA      ---MQEARRIRELPPYLFARIEKKIAEARERG--VDIISLGIGDPDMPTPSHVIDKLVAE
DAPAT_DEHMC      ---MKLSKRIENLPPYLFVQISKKIAEKRAKG--EEVISFAIGDPDLPTPKHILAELCKA
DAPAT_DEHMB      ---MKLSKRIENLPPYLFVQISKKIAEKRAKG--EDVISFAIGDPDLPTPKHILAELCKA
DAPAT_DEHM1      ---MKLSKRIENLPPYLFVQISKKIAEKRAKG--EEVISFAIGDPDLPTPKHILAELCKA
DAPAT_NATTJ      ---MQSAHRLNNLPPYLFADLDKMVQKEQAKG--KEIIKLGIGDPGMKPPEGIIKAATQE
                                *:*  : .             :* :.:**                

DAPAT_CHLCV      VQKLGNPETYRGYGPELGLSTLREKLSEVFYQGK---VSPEEIFISDGAKMDIFRLLSLF
DAPAT_CHLFF      VRKLGNPKTYRGYGPELGLPALKEKLSEVCYRGK---VSPEEIFISDGAKTDIFRLFSLF
DAPAT_CHLAB      VEKLGNPKTYRGYGPELGLPALREKLSEVFYHGQ---VSPEEIFISEGAKMDIFRIFSLF
DAPAT_CHLTB      IARLSSPTTCRGYGPDFGLPALRQKLSEDFYRGC---VDAKEIFISDGAKADLFRLLSFF
DAPAT_CHLT2      IARLSSPTTCRGYGPDFGLPALRQKLSEDFYRGC---VDAKEIFISDGAKADLFRLLSFF
DAPAT_CHLTA      IARLSSPTTCRGYGPDFGLPALRQKLSEDFYRGF---VDAKEIFISDGAKVDLFRLLSFF
DAPAT_CHLTR      IARLSSPTTCRGYGPDFGLPALRQKLSEDFYRGF---VDAKEIFISDGAKVDLFRLLSFF
DAPAT_CHLMU      IARFSSPSTYCGYGPDFGLPSLRQKLSEKLYHGC---VNAEEIFISDGAKVDLFRLLSFF
DAPAT_CHLPN      CVSQEKQETYRGYGPETGLEKLRTKIASEVYENR---ISPEEIFISDGAKPDIFRLFSFF
DAPAT_PARUW      AKQLASEKTYRGYGTEQGSILLREAIAEQYYQGK---IDPQEVFVSDGSKCDVGRLQILF
DAPAT_BACFR      VEEMTSAETFRGYGPEQGYDFLIEAIIKNDYAPRGIHLSPTEVFVNDGAKSDTGNIGDIL
DAPAT_BACFN      VEEMTSAETFRGYGPEQGYDFLIEAIIKNDYAPRGIHLSPTEVFVNDGAKSDTGNIGDIL
DAPAT_BACTN      VEELASKDTFRGYGPEQGYDFLIEAIIKNDFAPRGIHFSPSEIFVNDGAKSDTGNIGDIL
DAPAT_BACV8      VDELANKETFHGYGPEQGYDFLIDAVIRNDYAPRGVYLEPGEVFISDGAKSDTGNIGDIL
DAPAT_PARD8      VEEMASKDTFHGYGPEQGYPFLIDAIIKNDYASRGVFIEPSEVFISDGAKSDCGNIGDML
DAPAT_LAWIP      TDEMGQPSSFHGYGPEHGYEFLIGEIIANDYTSRNVHIEADEIFVSDGTKCDIANIQELF
DAPAT_LACP7      TDEMAAKETFKGYSPDLGYEFLRSAIAKHDYEARGVQIALDEIFISDGAKSDSGNIGDIF
DAPAT_METST      VDELGDADTFRGYGPEQGYDFLIEDVIENDYKPLGVELKNSEVFISDGAKCDTGNFQELF
DAPAT_METS3      VDEMGNADTFRGYGPEQGYDFLAEEIIKNDFEPFGVSLDTDEVFISDGAKCDTGNIQEIF
DAPAT_METTH      VDEMAEEETFRGYGPEQGYPFLREAIAENDYASRGVDITADEIFISDGAKCDTGNIQEIF
DAPAT_HELMI      VDEMGRAETFRGYGPEQGYDFLIGQIIENDYKPRGIDLGMDEVFVSDGSKCDTANFQEIL
DAPAT_DESHY      VEEMGRAETFRGYGPEQGYDFLIEKIIANDYAPRGVQLGMDEVFVSDGAKSDTANFQEIF
DAPAT_HUNT2      VDEMAKEETFKGYGPEQGYSFLVSKIIEYDYMPRGIRLDEDEVFVSDGAKSDTGNFQEIF
DAPAT_MICAN      VEEMGDRSSFKGYGPEQGYAWLREKIAVHDFQARGCEISADEIFISDGSKCDTGNILDIF
DAPAT_SYNY3      IDDMGDRQTFKGYGPEQGYAWLREKIAQHDFQARGCEVNAEEIFISDGSKCDTGNILDIF
DAPT1_NOSS1      VEEMGDRSSFKGYGPEQGYAWLREKIATQDFQARGADVDAAEIFISDGSKCDTGNILDIF
DAPT1_TRIV2      VEEMGDRSSFKGYGPEQGYAWLREKIATQDFQARGADVDASEIFISDGSKCDTGNILDIF
DAPAT_TRIEI      VAEMGDRSTFKGYGPEQGYAWLREKIAAQDFQGRGCDIDASEIFISDGSKCDSGNILDII
DAPAT_ACAM1      VEDMGNRDSFKGYGPEQGYGWLREKIAAHDFQARGCDVDAGEIFISDGSKCDCGNILDIF
DAPAT_SYNP6      VEDMGQRENFKGYGPEQGYAWLREKIAAHDFQSRGCEVDASEIFISDGSKCDCGNILDIF
DAPAT_SYNE7      VEDMGQRENFKGYGPEQGYAWLREKIAAHDFQSRGCEVDASEIFISDGSKCDCGNILDIF
DAPAT_SYNJB      VEEMGERATFRGYGPEQGYEWLRQAIARHDFQARNCDIDASEIFVSDGSKCDCGNILDIL
DAPAT_SYNJA      VEEMGERATFRGYGPEQGYEWLRQAIARHDFQARGCDIDASEIFISDGSKCDCGNILDIL
DAPAT_THEEB      VEEMGDRATFKGYGPEQGYPWLREKIAAHDFQARGCDIDASEIFISDGSKCDTGNILDIF
DAPAT_PROM1      IEEMGTEDGFRGYGPEQGYKWLREIISENDYISRGCEISAEEIFVSDGSKCDSSNILDIL
DAPAT_PROMT      IEEMGTKDGFRGYGPEQGYKWLREIISENDYISRGCEISAEEIFVSDGSKCDSSNILDIL
DAPAT_PROMA      IEEMGSTSGFRGYGPEQGYLWLREAIAKNDFQSRGCQISADEIFVSDGSKCDSSNILDIL
DAPAT_PROMS      LDDMGTTDGFRGYGPEQGYAWLREKISEHDFISRGCQISPEEIFVSDGSKCDSSNILDIL
DAPAT_PROM9      LDDMGTAEGFRGYGPEQGYSWLREKISEHDFISRGCQILPEEIFVSDGSKCDSSNILDIL
DAPAT_PROM0      LDEMGTTDGFKGYGPEQGYSWLREKISEHDFISRGCQISSEEIFVSDGSKCDSSNILDIL
DAPAT_PROM5      LNEMGTHEGFKGYGPEQGYEWLREKISKNDFISRGCQITPEEIFVSDGSKCDSSNILDIL
DAPAT_PROMP      LNEMGTNNGFKGYGPEQGYGWLREKISVNDFISRGCQISSEEIFVSDGSKCDSSNILDIL
DAPAT_PROM3      IDEMGTNTGFHGYGPEQGYDWLREAIAKHDFQNKGCQINAEEIFVSDGSKCDSSNILDIL
DAPAT_PROMM      IDEMGTNTGFHGYGPEQGYDWLRKAIAKHDFQTKGCQINAEEIFVSDGSKCDSSNILDIL
DAPAT_SYNPW      IDAMGTAEGFHGYGPEQGYGWLREAIATHDFKARGCDISAEEIFVSDGSKCDSSNILDIL
DAPAT_SYNPX      IDAMGTAEGFHGYGPEQGYGWLREAIAKHDFQARGCDISAEEIFVSDGSKCDSSNILDIL
DAPAT_SYNSC      IDAMGTAEGFHGYGPEQGYGWLREAIAKNDFQARGCDISAEEIFVSDGSKCDSSNILDIL
DAPAT_SYNS9      IDAMGTAEGFHGYGPEQGYAWLREAIAQQDFQSRGCEINADEIFVSDGSKCDSSNILDIL
DAPAT_SYNS3      IDEMGTAEGFHGYGPEQGYAWLREAIARDDFQARGCEISAEEIFVSDGSKCDSSNILDIL
DAPAT_SYNR3      IDEMGTREGFHGYGPEQGYAWLREAIAKHDFQSRGCDISAEEIFVSDGSKCDSSNILDIL
DAPAT_GEOSL      VDDLATTENFAGYGPEQGYDWLINAIIEKSYKPLGVDLKTEEMFISDGSKCDCANILDIF
DAPAT_GEOMG      VDDLATIDNFAGYGPEQGYDWLINAIIEKSYKPLGVSLKTEEMFISDGSKCDCANILDIF
DAPAT_GEOUR      VDDLGTTDNFAGYGPEQGYDWLINAIIEKSYKPLGVSLKTDEMFISDGSKCDCANILDIF
DAPAT_PELPD      VDDLAKVETFAGYGPEQGYDWLINSVIEKSYNKLGVELKTSEIFVSDGSKCDCANILDIF
DAPAT_PELCD      VDDLANKDKFMGYGPEQGYEFLIDTLIEKAYKPLGVELKTSEIFISDGSKCDCANILDIF
DAPAT_LEPIN      SKEMGTVGGFHGYGPEQGYSFLLKSIADHDYGSLGIKIDESEIFVSDGSKCDCGNIQEIF
DAPAT_LEPIC      SKEMGTVGGFHGYGPEQGYSFLLKSIADHDYGSLGIKIDESEIFVSDGSKCDCGNIQEIF
DAPAT_LEPBL      SKEMGTAGGFHGYGPEQGYSFLLKSIANNDYGSLGIKIDESEIFVSDGSKCDCGNIQEIF
DAPAT_LEPBJ      SKEMGTAGGFHGYGPEQGYSFLLKSIANNDYGSLGIKIDESEIFVSDGSKCDCGNIQEIF
DAPAT_LEPBA      AKEMGSAGGFHGYGPEQGYSFLIQKIIAHDYTARGVQIAEDEVFVSDGSKCDCGNIQEIF
DAPAT_DESVH      IAR-PANHQYPSYVGMLAFRQEVANWYDRRFGV-SLDPATEVIGLIGSKEGIAHFPFAFI
DAPAT_DESVV      IAR-PANHQYPSYVGMLAFRQEVANWYDRRFGV-SLDPATEVIGLIGSKEGIAHFPFAFI
DAPAT_DESAG      AEK-PANHQYPSYTGMLAFRQEVANWYKRRYAV-ELDPKTEVLTLIGSKEGIAHFPTAFV
DAPAT_SYNFM      AED-PSTHQYPSYSGMNDFKVSVAGWYKRRFGV-ELDPLSEVLTLIGSKEGLAHFPLAVI
DAPAT_AQUAE      LEN-PENHKYPSYVGKYEFRKAVADWYKRRFDV-DLDPNTEVITLIGSKEGIAHFPLAFV
DAPT2_NOSS1      IDD-ASNHNYPPYEGTQEFREAAVEWMERRFGVMDLNPNTEVVSSIGSKEAIHNTFLAFV
DAPT2_TRIV2      IDE-ASNHNYPPYEGTQEFREAAVKWMERRFGVVDLNPNTEVVSSIGSKEAIHNTFLAFV
DAPAT_GLOVI      IDD-PSTHNYPPYKGTKAYREAAAAWFERRFGVGGFHPDTEVISSIGSKEAIHNTFLAFV
DAPAT_DESAP      LKI-PANHQYPSSAGMPAYRRAVADWYARRFGV-ELDPQREVVSLIGSKEGIAHLPWCFV
DAPAT_CARHZ      AQN-PENHQYPSSVGMLSYRQAVAAWYARRFGV-ELDPKTEVVSLLGSKEGIAHISWCYV
DAPAT_MOOTA      AHN-PENHRYPTSEGLLAFRQAVADWYQRLYGV-DLDPRREVVTLIGSKEGIAHISLCYV
DAPAT_DEHMC      AED-PSNHRYPETEGLPVLRKAMAEWYQKRFGV-KLNPDTEVLPLIGSKEGIGHAAWCFL
DAPAT_DEHMB      AED-PSNHRYPETEGLPVLRKAMAEWYQKRFGV-KLNPDTEVLPLIGSKEGIGHAAWCFL
DAPAT_DEHM1      AED-PANHRYPETEGLPVLRKAMAEWYEKRFGV-KLNPDTEVLPLIGSKEGIGHAAWCFL
DAPAT_NATTJ      MYK-GENHGYPAYDGIDKLKHAIKEYYQSRFGV-ELNPDREILTLIGSKEGIANISQAIL
                                               :           :    . :         .

DAPAT_CHLCV      GPGKTIAVQDPSYPVYIDTALLAGA-----------KKVIKLPCRKETDFFPVIPQG---
DAPAT_CHLFF      GPGKTIAVQDPSYPAYIDAAILAGA-----------RKIVKLPCTKETDFFPVIPQE---
DAPAT_CHLAB      GPGKTIAVQDPSYPVYIDTALLTGS-----------RKIIKLPCTKETHFFPEIPQD---
DAPAT_CHLTB      GPNQTVAIQDPSYPAYLDIARLTGA-----------KEIIALPCLQENAFFPEFPED---
DAPAT_CHLT2      GPNQTVAIQDPSYPAYLDIARLTGA-----------KEIIALPCLQENAFFPEFPED---
DAPAT_CHLTA      GPNQTVAIQDPSYPAYLDIARLTGA-----------KEIIALPCLQENAFFPEFPED---
DAPAT_CHLTR      GPNQTVAIQDPSYPAYLDIARLTGA-----------KEIIALPCLQENAFFPEFPED---
DAPAT_CHLMU      GPNQIVAVQDPSYPAYIDIARLTGA-----------KEIVSLPCLQENDFLPVFPEN---
DAPAT_CHLPN      GSEKTLGLQDPVYPAYRDIAHITGI-----------RDIIPLACRKETGFIPELPNQ---
DAPAT_PARUW      GSDATIAVQNPTYPAYVDTGVINGQASFFQTSTKQYQRITYMSCLPENNFFPDLANL---
DAPAT_BACFR      RHDNSVGVTDPIYPVYIDSNVMCGRAGVLDTESGKWSNVTYMPCTAENHFIPAIPE----
DAPAT_BACFN      RHDNSVGVTDPIYPVYIDSNVMCGRAGVLDTESGKWSNVTYMPCTAENHFIPAIPE----
DAPAT_BACTN      RHDNSVGVTDPIYPVYIDSNVMCGRAGVLEEGTGKWSNVTYMPCTSENDFIPEIPD----
DAPAT_BACV8      RHDNSIGVTDPIYPVYIDSNVMCGRAGILED--GRWSNVVYLPCLSENNFVPEIPD----
DAPAT_PARD8      RHDNSIGVTDPVYPVYIDSNVMSGRTGVLEN--GKWSDVVYIPCTAENNFVPDLPS----
DAPAT_LAWIP      DPSDTVAIIDPVYPVYIDSNVMSGRLGKLIN--GIWSKLIYLPCTIENNFIPELPT----
DAPAT_LACP7      AENNKIAVCDPVYPVYVDTNVMAGRTGEFNYTTGKWSNVIYMPCTKENKFVPSLPA----
DAPAT_METST      SKDNIIAVTDPVYPVYVDSNVMAGRSGKMG-EDGFYENIVYLPATSENDFVPSLPS----
DAPAT_METS3      DLGNKIAVTDPVYTVYVDTNVMAGRTGEMK-DDGMYEGLTYLKCNAENGFVPELPE----
DAPAT_METTH      GLDNVVAVTDPVYPVYVESNVMAGRAGPAD-DDGRYSGLVYLPCTEENSFIPSLPE----
DAPAT_HELMI      GIGNIVAVTDPVYPVYVDSNVMAGRSGAFN-EKGQFDDIVYLPCTEANGMKPELPK----
DAPAT_DESHY      GVDNIMAVTDPVYPVYVDSNVMAGRTGNYDIEKGQYGRIIYLPCTEEGDMKPELPT----
DAPAT_HUNT2      GLDNKVAVTDPVYPVYVDSNVMAGRTGKYL-ANGYFENITYLPCTAENNFIPELPK----
DAPAT_MICAN      GDNNSIAVTDPVYPVYVDTNVMAGHTGEAN-DRGEYEGLIYLPITAENNFTAQIPA----
DAPAT_SYNY3      GKDNTIAVTDPVYPVYVDTNVMAGHTGDAN-EKGEYGGLVYLPISAENDFVAAIPS----
DAPT1_NOSS1      GDNNIIAVTDPVYPVYVDTNVMAGHTGAAN-EKGEFEGLVYLPVTAENNFTAEIPS----
DAPT1_TRIV2      GDNNIIAVTDPVYPVYVDTNVMAGHTGVAN-DKGEFEGLVYLPVTAENNFTAEIPS----
DAPAT_TRIEI      GNNNTIAVTDPVYPVYVDTNVMAGNTGAVN-EKGEYEGLVYLPIRAENNFTAEIPT----
DAPAT_ACAM1      GDNNTIAVTDPVYPVYVDTNVMAGHTGPCN-DQGEYEGLTYLPINAGNNFTAQIPS----
DAPAT_SYNP6      GNNNRIAVTDPVYPVYVDTNVMAGHTGDAN-DRGEYDGLVYLPISAENNFTAEIPS----
DAPAT_SYNE7      GNNNRIAVTDPVYPVYVDTNVMAGHTGDAN-DRGEYDGLVYLPISAENNFTAEIPS----
DAPAT_SYNJB      GHDNTIAITDPVYPVYVDTNVMAGHTGPAN-ERGEYEGLVYLPITAENHFTASLPS----
DAPAT_SYNJA      GHDNTIAITDPVYPVYVDTNVMAGHTGPAN-ERGEYEGLVYLPLTAENHFTASLPQ----
DAPAT_THEEB      GDSNRIAVTDPVYPVYVDTNVMAGHTGEAN-ERGEYAGLVYLPITAENHFTATLPS----
DAPAT_PROM1      GKENKIAVTDPVYPVYVDTNVMTGRTGEAN-SVGEYTGLSYIPINSENGFEASIPK----
DAPAT_PROMT      GKENKIAVTDPVYPVYVDTNVMTGRTGEAN-SVGEYKGLSYIPINSENGFEASIPK----
DAPAT_PROMA      GTGNKIAVTDPVYPVYVDSNVMAGQTGIAA-SSGHYEGLVYIPLNAENGFEAELPS----
DAPAT_PROMS      GKDNSIAVTDPVYPVYVDSNVMTGRTGDAL-ENGTYQGLTYLAINEANNFLPELPE----
DAPAT_PROM9      GKDNSIAVTDPVYPVYVDSNVMTGRTGDAL-ENGTYQGLTYLAINEGNNFLPELPQ----
DAPAT_PROM0      GKDNSIAVTDPVYPVYVDSNVMTGRTGDSL-ENGTYKGLTYLAINEDNNFLPELPE----
DAPAT_PROM5      GHDNLIAVTDPVYPVYVDSNVMTGRTGETL-KNGTYQGLLYLAINEDNNFLPEIPK----
DAPAT_PROMP      GSDNLIAVTDPVYPVYVDTNVMTGRTGETL-QNGTYQGLVYLAINEENKFQPEIPK----
DAPAT_PROM3      GSSNRIAVTDPVYPVYVDSNVMAGRTGEAN-QSGRYAGLSYLPINAENGFAAKIPS----
DAPAT_PROMM      GSSNRIAVTDPVYPVYVDSNVMAGRTGDAN-QSGRYAGLSYLPINAENGFAAKIPS----
DAPAT_SYNPW      GEGNRVAVTDPVYPVYVDSNVMAGRTGDAG-DEGRYAGLTYLPISADNGFAAQIPS----
DAPAT_SYNPX      GEGNRIAVTDPVYPVYVDTNVMAGRTGEAG-EEGRYGGLTYLPISADNGFAAQIPS----
DAPAT_SYNSC      GEGNKVAVTDPVYPVYVDSNVMAGRTGEAG-EIGRYAGLTYLPISADNGFAALIPS----
DAPAT_SYNS9      GEGNRVAVTDPVYPVYVDSNVMAGRTGDAG-AEGRYAGLTYLPISADNNFSAEIPS----
DAPAT_SYNS3      GSGNRIAVTDPVYPVYVDSNVMAGRTGESG-DDGRYGGLTYLPISADNGFAAQIPS----
DAPAT_SYNR3      GEGNRIAVTDPVYPVYVDSNVMAGRTGDAN-EGGQYGGLSYLPITAANDFTAPLPS----
DAPAT_GEOSL      ALDNVVAIGDPVYPVYNDTNVMIGRTGEAD-DKGYYKGIVYMPCTEENGFIPSLPT----
DAPAT_GEOMG      ALDNVVAIGDPVYPVYNDTNVMIGRTGDAD-EKGYYKGIVYMPCTEANGFIPSLPT----
DAPAT_GEOUR      ALDNVVAIGDPVYPVYNDTNVMIGRTGEAD-DKGYYKGIVYMPCNEENHFIPSLPT----
DAPAT_PELPD      AMDNVVAIGDPVYPVYNDTNVMIGRTGEAD-DRGYYKGIVYMPCTEANGFIPTLPT----
DAPAT_PELCD      ALDNKVAICDPVYPVYNDTNVMVGRTGEAD-DKGYYEGLTYLACTEENGFTPAIPK----
DAPAT_LEPIN      STDSKIAVADPVYPVYVDTNVMAGRTGEIG-PDGRYSNLIYMPATKENGFQPEIPK----
DAPAT_LEPIC      STDSKIAVADPVYPVYVDTNVMAGRTGEIG-PDGRYSNLIYMPATKENGFQPEIPK----
DAPAT_LEPBL      STDAKIAVSDPVYPVYVDTNVMAGRTGEIG-ADGRYSNLIYMPATKENGFQPEIPK----
DAPAT_LEPBJ      STDAKIAVSDPVYPVYVDTNVMAGRTGEIG-ADGRYSNLIYMPATKENGFQPEIPK----
DAPAT_LEPBA      SLDSKIAVVDPVYPVYVDTNVMAGRTGEVG-PDGRYANIVYMPATEENNFEPDFPK----
DAPAT_DESVH      NPGDLVLVCTPNYPVYHIATGFAGG------------EVQFVPLLEENDFLPDLDAIPED
DAPAT_DESVV      NPGDLVLVCTPNYPVYHIATGFAGG------------EVQFVPLLEENDFLPDLDAIPED
DAPAT_DESAG      NPGDLVLVCPPCYPVYAIASRFMGG------------VVQELPLLEENDFLPDLDAVDEA
DAPAT_SYNFM      NPGDLALVPTPAYPVYHVATMFAGG------------ESYFMPLVRENGFLPDLDSIPAD
DAPAT_AQUAE      NPGDIVLCPDPAYPVYRIGAIFAGG------------TPYTVPLKEENNFLPDLDSIPED
DAPT2_NOSS1      EAGDYTLIPDPGYPVYRTSTIFAGG------------EAFSMPLKAENKFLPDLDLIPEE
DAPT2_TRIV2      EAGDYTLIPDPGYPVYRTSTIFAGG------------EPFTMPLKAENKFLPDLDLIPEE
DAPAT_GLOVI      DPGDYTLIPDPAYPVYRTSTIFAGG------------EFFAMPLLPENQLLPDLEAVPET
DAPAT_DESAP      DPGDVVLVPDPGYPVYAGGTILAGG------------IPHPVPLTAGNGFLPDLAAIPAE
DAPAT_CARHZ      DPGDLVLVPDPGYPVYEGGTILAGG------------TTYKMPLKPENGFLPDLDSIPEE
DAPAT_MOOTA      DPGDINLVPDPGYPVYNIGTLLAGG------------ESYFMPLTAANGFLPDLGAIPSD
DAPAT_DEHMC      DPGDIALVPNPAYPVYAISSQLAGA------------EVFNLPLNKGNNFLPNLEAIPQN
DAPAT_DEHMB      DPGDIALVPNPAYPVYAISSQLAGA------------EVFNLPLNKGNNFLPNLEAIPQN
DAPAT_DEHM1      DPGDVALVPDPAYPVYAISSQLAGA------------EVFYMPLNKENNFLPDFNAIPQD
DAPAT_NATTJ      NPGDINFIPDPSYPVYKNGTILAGG------------TPHSMPLKQDNGFIPELESIPQS
                           * *..*     : *                 :       : . :      

DAPAT_CHLCV      --EEIDIFCLCSPNNPTGTVLTKEQLEELITYANSHGSIILFDAAYSAFISD-PSLPKSI
DAPAT_CHLFF      --ENIDIFCLCSPNNPTGTVLNREQLKELIDYANSHGSIILFDAAYSAFISD-PSLPTSI
DAPAT_CHLAB      --EAIDIFCICSPNNPTGTVLNREQLKELVDYANAQGSIILFDAAYSAFISD-PTLPTSI
DAPAT_CHLTB      --THIDILCLCSPNNPTGTVLNKDQLRAIVHYAIEHEILILFDAAYSTFISD-PSLPKSI
DAPAT_CHLT2      --THIDILCLCSPNNPTGTVLNKDQLRAIVHYAIEHEILILFDAAYSTFISD-PSLPKSI
DAPAT_CHLTA      --THIDILCLCSPNNPTGTVLNKDQLRAIVHYAIEHEILILFDAAYSTFISD-PSLPKSI
DAPAT_CHLTR      --THIDILCLCSPNNPTGTVLNKDQLRAIVHYAIEHEILILFDAAYSTFISD-PSLPKSI
DAPAT_CHLMU      --THIDILCLCSPNNPTGTALNKNQLRAIVRYAIEHNILILFDAAYSAFISA-PSLPKSI
DAPAT_CHLPN      --QSLDILCLCYPNNPTGTVLTFQQLQALVNYANQHGTVLIFDAAYSAFVSD-PSLPKSI
DAPAT_PARUW      --PKTDLIYFCSPNNPTGSAATNEQLRELVQFAKKRQSIIIFDAAYASFVRS-SHIPRSI
DAPAT_BACFR      --KRIDIVYLCYPNNPTGTTLTKAELKKWVDYALANDTLILFDAAYEAYIRE-PDIPHSI
DAPAT_BACFN      --KRIDIVYLCYPNNPTGTTLTKAELKKWVDYALANDTLILFDAAYEAYIRE-PDIPHSI
DAPAT_BACTN      --KRIDIVYLCYPNNPTGTTLTKPELKKWVDYALANDTLILFDAAYEAYIQD-ADVPHSI
DAPAT_BACV8      --RRIDILYLCYPNNPTGTVISKAELKKWVNYALENDTLILYDAAYEAYIQD-PDIPHSI
DAPAT_PARD8      --RRVDILYLCYPNNPTGTTLTKDELKKWVNYALANDVLIMYDSAYEAYIQD-PNIPHSI
DAPAT_LAWIP      --QHPDIIYLCYPNNPTGTVLSKDQLTIWVNYAKKEGAIILFDAAYEAYITD-PTIPHSI
DAPAT_LACP7      --ETPDIIYLCFPNNPTGSAITKMKLQKWVDYAIEKGAVIIYDAAYEAYISE-ENCPHTI
DAPAT_METST      --EKVDIIYLCYPNNPTGTTLTKEQLKEWVDYAHENDALILFDAAYESFIKT-PGIPHSI
DAPAT_METS3      --EDVDIIYLCYPNNPTGTTLTYDQLKVFVDYAIEHKAIILFDAAYECFIRE-DDVPHTI
DAPAT_METTH      --ERVDLIYLCYPNNPTGTTLTEKQLAEWVDYARDSGSLILFDAAYEAYIQE-DGIPHSI
DAPAT_HELMI      --TRVDMIYLCFPNNPTGMTLTKEELKQWVDYARENKSIILYDAAYEAFIQE-AHIPRSI
DAPAT_DESHY      --APVDMIYLCFPNNPTGMTLTKEELKVWVDYARENKAIILFDSAYEAFIRE-EGVPRSI
DAPAT_HUNT2      --EKVDIIYLCFPNNPTGMTLSREELKKWVDYARENRAIILFDSAYEAYIRE-KDVPHSI
DAPAT_MICAN      --EKVDLIYLCFPNNPTGATATKEHLTAWVNYARANGSIIFFDAAYEAFITD-ASLPHSI
DAPAT_SYNY3      --KKVDLIYLCFPNNPTGATATKAYLKQWVDYALAHGSIIFFDAAYEAFITD-PTLPHSI
DAPT1_NOSS1      --QKVDLIYLCFPNNPTGATATKEHLQAWVDYAKAHNSIIFFDAAYESYITD-PSLPHSI
DAPT1_TRIV2      --QKVDLIYLCFPNNPTGATATKEHLQAWVDYAKAHNSIIFFDAAYESYITD-PSLPHSI
DAPAT_TRIEI      --QKVDLIYLCFPNNPTGATATKEYLQTWVNYARANDAIILFDAAYEAFITD-ASLPHSI
DAPAT_ACAM1      --QKVDLIYLCFPNNPTGAVASKSHLQDWVNYAKSHGSIILFDAAYEAFITD-PEIPHSI
DAPAT_SYNP6      --EKVDLIYLCFPNNPTGAVASREYLQAWVDYARANGAIILFDAAYEAFITD-PAIPHSI
DAPAT_SYNE7      --EKVDLIYLCFPNNPTGAVASREYLQAWVDYARANGAIILFDAAYEAFITD-PAIPHSI
DAPAT_SYNJB      --QKVDVIYLCFPNNPTGAVATREHLQNWVDYARAHGSLILFDAAYEAYITE-PGIPHSI
DAPAT_SYNJA      --QKVDVIYLCFPNNPTGAVATREHLQAWVDYARAHNSLILFDAAYEAYITE-PGIPHSI
DAPAT_THEEB      --EPVDLIYLCFPNNPTGAVASREHLQAWVDYARAHKAILFFDAAYEAFITD-PAIPHSI
DAPAT_PROM1      --DKFDLIYLCFPNNPTGAVATKEQLVSWVKYAKENNSLILFDAAYEAFIKD-ESIPHSI
DAPAT_PROMT      --DKFDLIYLCFPNNPTGAVATKEQLVSWVKYAKENNSLILFDAAYEAFIKD-ESIPHSI
DAPAT_PROMA      --EPVDLIYLCFPNNPTGAVASKVQLTKWVEYAKKNHALILFDAAYESFIQD-PLLPHSI
DAPAT_PROMS      --KKVDILYLCFPNNPTGATINKEELKKWVDYALQNKSLILFDAAYEAFIQD-NDIPHSI
DAPAT_PROM9      --KKVDILYLCFPNNPTGATITKEELKKWVDYALQNKSLILFDAAYEAFIQD-NDIPHSI
DAPAT_PROM0      --KKVDILYLCFPNNPTGATINKADLKKWVDYALQNKSLILFDAAYEAFIQD-DNIPHSI
DAPAT_PROM5      --NKVDIVYLCFPNNPTGATITKDELKKWVDYANHNKSLILFDAAYEAFIQD-KDVPHSI
DAPAT_PROMP      --KKVDIVYLCFPNNPTGATITKQELKKWVDYAIENKSLILFDAAYEAFIQD-KNIPHSI
DAPAT_PROM3      --EPVDLIYLCFPNNPTGAVATRAQLQEWVNYARTNSVLILFDAAYEAFIQN-PDLPHSI
DAPAT_PROMM      --EPVDLIYLCFPNNPTGAVATRAQLQEWVNYARTNSVLILFDAAYEAFIQN-PDLPHSI
DAPAT_SYNPW      --DPVDLIYLCFPNNPTGAVATKEQLKAWVDYARANDALILFDAAYEAFIQD-PSLPHSI
DAPAT_SYNPX      --EPVDLIYLCFPNNPTGAVATKGQLKAWVDYARSNGSLILFDAAYEAFIQD-PSLPHSI
DAPAT_SYNSC      --EPVDLIYLCFPNNPTGAVATREQLQAWVNYARANGALILFDAAYEAFIQD-PELPRSI
DAPAT_SYNS9      --EPVDLIYLCFPNNPTGAVATRAQLKAWVDYARSHNALILFDAAYEAFIQD-PEIPHSI
DAPAT_SYNS3      --EPVDLIYLCYPNNPTGAVATKAQLKKWVDYARANKALILFDAAYEAFIQD-PELPHSI
DAPAT_SYNR3      --TPVDLIYLCFPNNPTGAVASREQLKSWVDYALEHKALILFDAAYEAFIQD-PAIPHSI
DAPAT_GEOSL      --EKVDIIYLCFPNNPTGTVATKAELKKWVDYAIANDAVIFFDAAYEAFITD-PAIPHSI
DAPAT_GEOMG      --EKVDIIYLCFPNNPTGTVATKAELKKWVDYANANDAVIFFDAAYEAFITD-PAIPHSI
DAPAT_GEOUR      --EKVDIIYLCFPNNPTGTVASRAELKKWVDYANANDAVIFFDAAYEAFITD-PEIPHSI
DAPAT_PELPD      --EKVDIIYLCFPNNPTGTVASREELKKWVDYAIANNAVIFFDAAYEAFITD-PAIPHSI
DAPAT_PELCD      --EKVDIIYLCYPNNPTGTVATKEVLKAWVDYALANDAVIFFDAAYEAFITE-PGIPHSI
DAPAT_LEPIN      --EKADIVYLCYPNNPTGTVTTKESLKAWVEYAKKNNSIILYDSAYEAFISE-PGVPRSI
DAPAT_LEPIC      --EKADIVYLCYPNNPTGTVTTKESLKAWVEYAKKNNSIILYDSAYEAFISE-PGVPRSI
DAPAT_LEPBL      --EKADIIYLCYPNNPTGTVTTKKALRAWVEYAKKNNSIILYDSAYEAFISE-PGVPRSI
DAPAT_LEPBJ      --EKADIIYLCYPNNPTGTVTTKEALRAWVEYAKKNNSIILYDSAYEAFISE-PGVPRSI
DAPAT_LEPBA      --EKADIIYLCYPNNPTGMVATKARLTEWVNYAKKMGSIILYDSAYESFIQD-PEIPKSI
DAPAT_DESVH      TWKRAKMIFVNYPNNPTAATAPLGFYEKLVDICRRFDVIIAHDTAYTEIYYDEDNRPPSI
DAPAT_DESVV      TWKRAKMIFVNYPNNPTAATAPLGFYEKLVDICRRFDVIIAHDTAYTEIYYDEDNRPPSI
DAPAT_DESAG      TWEKARCIFVNYPNNPTAAMAPRSFFEKLIGIARKHNVIVVHDAAYTEMYYNENNRPLSI
DAPAT_SYNFM      VARRAKVMFINYPNNPTGATAERDFFEKVIAFAREYDVIVCHDAAYTEMAFG-GYRPLSF
DAPAT_AQUAE      VAKKAKIIWINYPNNPTSAPPTLEFYKKLVDWAKEYNVIIASDNAYSEIYTG-QEKPPSI
DAPT2_NOSS1      VARKAKMLWINYPNNPTGALATLEFFEELVALCQQYSILLCHDHAYSEMAYD-GYKPPSV
DAPT2_TRIV2      VARKAKMLWVNYPNNPTGALATLEFFEELVAFCQQHSILLCHDHAYSEMAYD-GYKPPSV
DAPAT_GLOVI      VARKAKLLWLNYPNNPTGAVASLEFFEKVVHFAKKHDILVCHDNAYSEMAYD-GYKPPSI
DAPAT_DESAP      TARRAKVMFINYPNNPTGAVASKEFFARVVDFAREYGILVCHDAAYSEIAFD-GYRPPSF
DAPAT_CARHZ      VARKAKLMFINYPNNPTGAVADLGFFEKVVHFAKKYEILVCHDAAYSEITFD-GYRAPSF
DAPAT_MOOTA      VARRAKLMFINYPNNPTGAVADLKFFQEVVEFARSYDLIVCHDAAYSEITYD-GYRAPSF
DAPAT_DEHMC      ILSKAKVLWINYPNNPTGAVAGLSFFQEVANFAAKHNLAVCHDGPYSEIAFD-GYKPVSF
DAPAT_DEHMB      ILSKAKVLWINYPNNPTGAVAGLSFFQEVANFAAKHNLAVCHDGPYSEIAFD-GYKPVSF
DAPAT_DEHM1      VLSKAKILWINYPNNPTGAVAGLDFFKEAAEFAAKHNLAVCHDGPYSEIAFD-GYRPVSF
DAPAT_NATTJ      RLSKGKIVFMNYPNNPTSAVASKDFYSHAVKFCQKNKLLLCNDAAYSEIAFD-DYQPQSL
                        . .  *****.              .      :  * .*          . :.

DAPAT_CHLCV      FEIPEARSCAIEINSFSKSLGFSGVRLGWNVVPKDLRYSN----GLPIIDDWKRFLHTTF
DAPAT_CHLFF      FEIPEARFCAIEINSFSKSLGFAGVRLGWNIVPKDLKYSD----GSLIIRDWERFLCTTF
DAPAT_CHLAB      FDIPGARSCAIEVNSFSKSLGFAGVRLGWNVVPKDLQYND----GLPVIRDWERLLFTTF
DAPAT_CHLTB      FEIPDARFCAIEINSFSKPLGFAGIRLGWTVIPQELTYAD----GHFVIQDWERFLSTTF
DAPAT_CHLT2      FEIPDARFCAIEINSFSKPLGFAGIRLGWTVIPQELTYAD----GHFVIQDWERFLSTTF
DAPAT_CHLTA      FEIPDARFCAIEINSFSKPLGFAGIRLGWTVIPQELTYAD----GHFVIQDWERFLSTTF
DAPAT_CHLTR      FEIPDARFCAIEINSFSKPLGFAGIRLGWTVIPQELTYAD----GHFVIQDWERFLSTTF
DAPAT_CHLMU      FEIPDARFCAIEINSFSKSLGFAGIRLGWTVIPKELTYED----GQPIIRDWKRFLSTTF
DAPAT_CHLPN      FEIPEAKYCAIEINSFSKSLGFTGMRLAWNVIPKELTYDN----NEPMINDWKRLFATTF
DAPAT_PARUW      YEIEGAKEVAIEVGSFSKMIGFTGVRLGWSVVPKQLRFED----GHSVQQDWERIVCTFF
DAPAT_BACFR      YEIKGAKKCAIEFRSFSKTAGFTGVRCGYTVVPKELTAATLEGERIPLNRLWNRRQCTKF
DAPAT_BACFN      YEIKGAKKCAIEFRSFSKTAGFTGVRCGYTVVPKELTAATLEGERIPLNRLWNRRQCTKF
DAPAT_BACTN      YEIKGAKKCAIEFRSFSKTAGFTGVRCGYTVVPKELTAATLEGDRIPLNKLWNRRQCTKF
DAPAT_BACV8      YEIKGAKKVAIEFRSFSKTAGFTGVRCGYTVVPKELTAATLEGERIPLNRMWNRRQCTKF
DAPAT_PARD8      YEIKGAKKVAIEFRSFSKTAGFTGIRCGYTVVPKELNAFTLDGQRVQLNKLWNRRQCTKF
DAPAT_LAWIP      YEIDGAKEVAIEFRSFSKTAGFTGLRCAYTVIPKELKANTREGNEQYLNMMWNRRQTTKY
DAPAT_LACP7      YECDGAKKCAIELRSFSKNAGFTGTRLGFTIVPKELTSDG-----VSLNSLWARRHGTKF
DAPAT_METST      FEIEGAKDVAVEFRSYSKVAGFTGTRCAYCVVPEEVYVKDANGNKVQLNPLWNRRQSTKF
DAPAT_METS3      YEIEGAKNVAIEFRSFSKMAGFTGTRCAYTVVPKEVAGYDSKGNEVQLNQLWNRRQTTKF
DAPAT_METTH      YEVEGAREVAIEFRSFSKNAGFTGTRCAFTVVPEELEVPDSSGRMHSVRELWNRRQTTKF
DAPAT_HELMI      YEIEGAREVAVEFRSFSKTAGFTGTRCAFTVVPKEVMAYDREGRAYSLNGLWLRRQTTKF
DAPAT_DESHY      YEVEGAREVAVEFRSFSKTAGFTGTRCAYTVVPKDIMIYDSTGEGHSLNKLWLRRQTTKF
DAPAT_HUNT2      YEVEGADEVAIEFRSFSKTAGFTGTRCAYTVVPKKVVAYTKNGEAHQLNSLWNRRQTTKF
DAPAT_MICAN      YEIEGARQCAIEFRSFSKNAGFTGTRCALTVVPQSLTAKAADGSDVQLWKLWNRRQSTKF
DAPAT_SYNY3      YEIEGARDCAIEFRSFSKNAGFTGTRCALTVVPKTLTAKAADGSDVELWKLWNRRQSTKF
DAPT1_NOSS1      YEIEGAREVAIEFRSFSKNAGFTGTRCALTVVPKTLKAKAADGSDVELWKLWNRRQSTKF
DAPT1_TRIV2      YEIEGAREVAIEFRSFSKNAGFTGTRCALTVVPKTLKAKAADGSDVELWKLWNRRQSTKF
DAPAT_TRIEI      YEIEGAKECAIEFRSFSKNAGFTGTRCALTVVPKTLKGKAADGSDVELWKLWNRRQSTKF
DAPAT_ACAM1      YEIEGARDCAIEFRSFSKNAGFTGTRCALTVVPKTLMAKAADESDVELWKLWNRRQSTKF
DAPAT_SYNP6      FEIPGARDCAIEFRSFSKNAGFTGTRCAFTVVPKGLKGKAADGSEVELWGLWNRRQSTKF
DAPAT_SYNE7      FEIPGARDCAIEFRSFSKNAGFTGTRCAFTVVPKGLKGKAADGSEVELWGLWNRRQSTKF
DAPAT_SYNJB      YEIPGARECAIEFRSFSKTAGFTGTRCAFTVVPKSLRGQAADGSWVDLWSLWYRRQSTKF
DAPAT_SYNJA      YEIPGARECAIEFRSFSKTAGFTGTRCAFTVVPKSLRGQAADGSWVDLWSLWYRRQSTKF
DAPAT_THEEB      YEIPGARECAIEFRSFSKNAGFTGTRCAFTVVPKGLKGQTPSGDAVELWSLWQRRQSTKF
DAPAT_PROM1      FEIEGARDCAIEFRSFSKNAGFTGTRCAFTVIPKSLKGKA-GIETVDLWSLWNRRQSTKF
DAPAT_PROMT      FEIEGARDCAIEFRSFSKNAGFTGTRCAFTVIPKSLKGKA-GIETVDLWSLWNRRQSTKF
DAPAT_PROMA      FEIDGATDCAIEFRSFSKNAGFTGTRCAFTVIPKSLKGKTLDGAEVDFWSLWNRRQSTKF
DAPAT_PROMS      YEIEGAKDCAIEFRSFSKNAGFTGVRCAFTVIPKNLKGLSSTNEEIELWPLWNRRQSTKF
DAPAT_PROM9      YEIEGAKDCAIEFRSFSKNAGFTGVRCAFTVIPKNLKGLSSTNEEIDLWPLWNRRQSTKF
DAPAT_PROM0      YEIEGAKDCAIEFRSFSKNAGFTGVRCAFTVIPKNLKGLSSTNEEIDLWPLWNRRQSTKF
DAPAT_PROM5      YEIDGAKSCAIEFRSFSKNAGFTGVRCAYTVIPKCLTGQNSKGDKVDLWPLWNRRQCTKF
DAPAT_PROMP      YEIEGAKNCAIEFRSFSKNAGFTGVRCAYTVIPKNLSGQNSKGDKIDLWSLWNRRQCTKF
DAPAT_PROM3      YEIEGARECAIEFRSFSKNAGFTGTRCAFTVVPKGLKGKSDDGSDVELWNLWNRRQSTKF
DAPAT_PROMM      YEIEGARECAIEFRSFSKNAGFTGTRCAFTVVPKGLKGKSDDGSDVELWNLWNRRQSTKF
DAPAT_SYNPW      FEIEGARDCAIEFRSFSKNAGFTGTRCAFTVVPKGLKGKAANGEAVELWSLWNRRQSTKF
DAPAT_SYNPX      FEIEGARECAIEFRSFSKNAGFTGTRCAFTVVPKGLKGTASNGEAVELWGLWNRRQSTKF
DAPAT_SYNSC      FEIEGARDCAIEFRSFSKNAGFTGTRCAFTVVPKGLKGKAANGEAVELWGLWNRRQSTKF
DAPAT_SYNS9      FEIEGARECAIEFRSFSKNAGFTGTRCAFTVVPKGLKGTAANGELVELWGLWNRRQSTKF
DAPAT_SYNS3      YEIEGARDCAIEFRSFSKNAGFTGTRCALTVVPKGLKGKADDGSEVELWGLWNRRQSTKF
DAPAT_SYNR3      FEIEGARQCAIEFRSFSKNAGFTGTRCALTVVPKGLMGTSATGEQVELWGLWNRRQSTKF
DAPAT_GEOSL      YEIEGAKKCAIEFRSFSKTAGFTGVRCGLVVVPEEVMGTTPTGEKYSFNKLWLRRTTTKF
DAPAT_GEOMG      YEIEGAKKCAIEFRSFSKTAGFTGVRCGLVVVPEEVMGTTPTGEKYSFNKLWLRRTTTKF
DAPAT_GEOUR      YEIEGAKKCAIEFRSFSKTAGFTGVRCGLVVVPEEVMGTTSTGERYSFNKLWLRRTTTKF
DAPAT_PELPD      YEIEGAKKCAIEFRSFSKTAGFTGVRCGLVVVPEEVMGSTATGEAYSFNKLWLRRTTTKF
DAPAT_PELCD      YEIEGANRCAIEFRSFSKTAGFTGVRCALTVVPEELLAATGNGEKVSLNKLWNRRQSTKF
DAPAT_LEPIN      YEVEGAKEVAIEFRSFSKTAGFTGLRCAYIVIPKELKGKTRSGEEVSLNSLWNRRHTTKF
DAPAT_LEPIC      YEVEGAKEVAIEFRSFSKTAGFTGLRCAYIVIPKELKGRTRSGEEVSLNSLWNRRHTTKF
DAPAT_LEPBL      YEVAGAKEVAIEFRSFSKTAGFTGLRCAYIVIPKELKGRTRGGEEVSINSLWSRRHTTKF
DAPAT_LEPBJ      YEVAGAKEVAIEFRSFSKTAGFTGLRCAYIVIPKELKGRTRGGEEVSINSLWSRRHTTKF
DAPAT_LEPBA      YEIPGAKEVAMEFRSFSKTAGFTGTRCAYLVIPKDLKGKTKSGEEVSFNSLWNRRHTTKF
DAPAT_DESVH      LSVPGAKDVAIEFHSLSKTYNMTGWRVGMAVG------------NPTLVAGLGKIKENMD
DAPAT_DESVV      LSVPGAKDVAIEFHSLSKTYNMTGWRVGMAVG------------NPTLVAGLGKIKENMD
DAPAT_DESAG      MEIPGAMDVAIEFNSLSKPYNMTGWRIAMAVG------------NASLVAGLGKVKENMD
DAPAT_SYNFM      LELPGAGEVGVEFHSLSKTYNMTGWRLGFAVG------------NADILAGLGQVKSNID
DAPAT_AQUAE      LQVPGAKDVAIEFHSLSKTYNMTGWRIGMAVG------------NKELVAGLGKVKTNVD
DAPT2_NOSS1      LQIPGAKDIAIEFHSLSKSYNMTGWRIGFAVG------------NAYAIKGLSQVKTNVD
DAPT2_TRIV2      LQIPGAKDIAIEFHSLSKSYNMTGWRIGFAVG------------NAYAIQGLSQVKTNVD
DAPAT_GLOVI      LQVPGARDVAIEFLSCSKAYNMTGWRVGFVIG------------NRTGIAGLGQVKTNID
DAPAT_DESAP      LEVAGAREVGIEFHSVSKTYNMTGWRAGWAAG------------NAGAVEALGRLKSNLD
DAPAT_CARHZ      LEVKGAKDVGIEFHSLSKTYNMTGWRIGWAVG------------NAKAIDALGRLKSNID
DAPAT_MOOTA      LQAPGAKEVGIEFNSVSKPYNMTGWRLGWACG------------RADVIEALARIKSNID
DAPAT_DEHMC      LEADGAKDVGIEFHSLSKSYNMTGWRIGMAVG------------NAKMIDALRRFKSNLD
DAPAT_DEHMB      LEADGAKDVGIEFHSLSKSYNMTGWRIGMAVG------------NAKMIDALRRFKSNLD
DAPAT_DEHM1      LEADGAKEVGIEFHSLSKSYNMTGWRIGMAVG------------NAKMIDALRRFKSNLD
DAPAT_NATTJ      LSVPGAKEVAIEFNSLSKTFNMTGWRVGFVVG------------NEKAISALAKYKTNVD
                  .   *   .:*. * **  .::* * .                         :   .  

DAPAT_CHLCV      NGASLPVQEAAITGAS---LFPNLEAIAHYRHNSSLLREALQKAEFSVYGGEHAPYLWVE
DAPAT_CHLFF      NGASLPVQEAAIAGAS---LFPNLEAISKYRYNSSLLREALQKAEFVVHGGEHAPYLWVE
DAPAT_CHLAB      NGVCLPVQESAIAGVS---LFPNLEAISHYRYNSSLLREALQKADFSVYGGEQAPYLWVE
DAPAT_CHLTB      NGASIPAQEAGVAGLS---ILPQLEAIHYYRENSDLLRKALLATGFEVFGGEHAPYLWVK
DAPAT_CHLT2      NGASIPAQEAGVAGLS---ILPQLEAIHYYRENSDLLRKALLATGFEVFGGEHAPYLWVK
DAPAT_CHLTA      NGASIPAQEAGVAGLS---ILPQLEAIHYYRENSDLLRKALLATGFEVFGGEHAPYLWVK
DAPAT_CHLTR      NGASIPAQEAGVAGLS---ILPQLEAIHYYRENSDLLRKALLATGFEVFGGEHAPYLWVK
DAPAT_CHLMU      NGASIPAQEAATAGLS---TLSKLEAVHYYKENSHLLKTSLLKAGFQVFGGEHAPYLWVK
DAPAT_CHLPN      NGASLLMQEAGYYGLD---LFPTPPAISLYLTNAQKLKKSLETAGFSVHGGDHAPYLWVE
DAPAT_PARUW      NGASNIAQAGGLAALQKEGLQAIDELSSYYMKNSNILKKAFEECGYKVYGGENVPYLWVH
DAPAT_BACFR      NGTSYITQRAAEAIYTPEGKEQIQETINYYMTNARIMKEGLESTGLKVYGGVNAPYLWVK
DAPAT_BACFN      NGTSYITQRAAEAIYTPEGKEQIQETINYYMTNARIMKEGLESTGLKVYGGVNAPYLWVK
DAPAT_BACTN      NGTSYITQRAAEAVYSTEGKAQIKETINYYMSNAKIMKEGLEATGLKVYGGVNAPYLWVK
DAPAT_BACV8      NGTSYITQRGAEAIYTPEGKKQVKAIIQYYMANARIMKEALESTGLKVFGGENAPYLWVK
DAPAT_PARD8      NGTSYITQRGAEAVYSTAGKQQVTATINYYMTNAKIMKEGLQNCGLTVYGGDNAPYLWLK
DAPAT_LAWIP      NGCSYIVQKAAAAIYTPEGQKQIQESIQYYMKNALIIQNAITQMGITAVGGINAPYVWIK
DAPAT_LACP7      NGAPYIIQTAGAAVYSPEGIAETREQINYYMNNARVIRDGLLEAGYQVSGGVNAPYIWLH
DAPAT_METST      NGVSYPVQRAAQAIYTPEGKKEIQENLDYYVKNAQVIRESLEKMGLKVYGGVDSPYIWFK
DAPAT_METS3      NGVSYPVQVAAAAVYSDDGKKEIKEIIDYYMENAKVIKSSLEKLGLEVYGGVNSPYIWVK
DAPAT_METTH      NGVSYPVQRAAEAVYTPEGQREIRESIDYYMENARIIRESLERAGLRYYGGVNAPYIWIR
DAPAT_HELMI      NGVSYPVQAAAAAIYTEAGKKQVKETIEYYMENARIIREGLVEAGYKVFGGVNAPYIWLK
DAPAT_DESHY      NGVSYPVQAGAAAVYTEEGKKQIQATIDYYMENARIIREGLQEAGFKVFGGVNAPYIWMK
DAPAT_HUNT2      NGVPYIIQRAAAAVYTPEGQKQTKETIDYYMENAKIIKQGLEDIGLTVFGGVNAPYIWLK
DAPAT_MICAN      NGVSYIVQRGAEAVYSPEGQAQVEELVKFYLQNATIIREKLTAAGLEVHGGVNAPYVWVK
DAPAT_SYNY3      NGVSYIIQRGAEAVYSPEGQAQVQELIAFYLENARIIREKLAAAGLQVYGGINAPYVWVK
DAPT1_NOSS1      NGVSYIVQRGAEAVYSEAGQAQVKALVSFYLDNAKIIREKLTAAGLSVYGGVNAPYVWVK
DAPT1_TRIV2      NGVSYIVQRGAEAVYSEAGQAQVKALVSFYLDNAKIIREKLTAAGLSVYGGVNAPYVWVK
DAPAT_TRIEI      NGVSYIVQRGAEAVYSEEGKAQVKGLIQFYLENAKIICSQLQAAGLTVYGGVNAPYVWVQ
DAPAT_ACAM1      NGVSYIVQRGAEAVYSEAGQAQTKALISFYLENAKIIREKLTAAGLQVFGGVNAPYVWVQ
DAPAT_SYNP6      NGVSYIVQRGAEAVYSAEGQAQIKELVAFYLENARIIREELTAAGLDVHGGVNAPYVWVK
DAPAT_SYNE7      NGVSYIVQRGAEAVYSAEGQAQIKELVAFYLENARIIREELTAAGLDVHGGVNAPYVWVK
DAPAT_SYNJB      NGVSYIVQRGAEAVYSEAGQAQVQGLVQFYLENARIIRQQLAEVGIQVYGGVNAPYVWVK
DAPAT_SYNJA      NGVAYIVQRGAEAVYSEAGQVQVRALVQFYLENARIIREQLATAGIQAYGGVNAPYVWVK
DAPAT_THEEB      NGVSYIVQRGAEAVYSEAGQAQVRELVTFYMENARLIREKLTQAGFEVYGGVNAPYVWLK
DAPAT_PROM1      NGVSYVVQRGAEAVYSKEGKIQIKKLVSFYMDNAEIIKSNLTAAGFEVFGAVNAPYAWIK
DAPAT_PROMT      NGVSYVVQRGAEAVYSKEGKTQIKKLVSFYMDNAEIIKSNLTAAGFEVFGAVNAPYAWIK
DAPAT_PROMA      NGVSYIVQRGAEAVYSLEGQSQTNKLVSFYMKNAEIIRKQLTLAGYKIYGGKHAPYVWLE
DAPAT_PROMS      NGVSYVVQKGAEAVYSLEGKKQVRGLIDFYMENAKIMKNKLQNSGYKVYGGDNAPYIWIK
DAPAT_PROM9      NGVSYVVQRGAEAVYSLEGKKEVRGLIDFYMENAKIMKNKLQTAGYKVYGGDNAPYIWIK
DAPAT_PROM0      NGVSYVVQRGAEAVYSLEGKKQVKGLIDFYMENAKIMKNKLQNAGYKVYGGDNAPYIWIK
DAPAT_PROM5      NGVSYVVQKGAEAVYSSQGKKEVNSLIDFYMENAKIMRNKLRSAGFTVYGGCNAPYVWIK
DAPAT_PROMP      NGVSYIVQRGAEAVYSSQGKKEVNSLIDFYMKNAEIMQNKLRSAGFKVYGGDNAPYVWIK
DAPAT_PROM3      NGVSYIIQRGAEAVYSAQGQGEINALVSFYMRNAAIIRRELTAAGIEVHGGEHAPYVWLK
DAPAT_PROMM      NGVSYIIQRGAEAVYSAQGQGEINALVSFYMRNAAIIRRELTAAGIEVHGGEHAPYVWLK
DAPAT_SYNPW      NGVSYIIQRGAEAVYSEAGQAEVKGLVSFYMENAAIIRRELSAAGLTIYGGEHAPYVWIK
DAPAT_SYNPX      NGVSYIIQRGAEAVYSDAGQAEVKGLVNFYMENAAIIRRELSGAGLTIYGGEHAPYVWIK
DAPAT_SYNSC      NGVSYIIQRGAEAVYSEAGQAEVKALVSFYMENAAIIRRELTAAGLTVYGGEHAPYVWIK
DAPAT_SYNS9      NGVSYIIQRGAEAVYSTAGQAEVKTLVSFYMENASIIRQELTSLGLQIYGGEHAPYVWIK
DAPAT_SYNS3      NGVSYIIQRGAEAVYSDAGKQEVKALVSFYMENAAIIRRELSAAGIEVHGGQHAPYVWLK
DAPAT_SYNR3      NGVSYIVQRGAEAVYSEQGQAEVKALINFYMENAAIIRRELSAAGLTIYGGEHAPYVWIK
DAPAT_GEOSL      NGASYPVQKAAAAVYSDEGWQQNKEIIDYYMENARIIREGLAAAGLTVYGGVNAPYIWLK
DAPAT_GEOMG      NGASYPVQKAAAAVYSDEGWKQNKEIIDYYMENARIIREGLAAAGLTVYGGVNAPYIWLK
DAPAT_GEOUR      NGASYPVQRAAEAVYSDEGWKQTKEIIDYYMENARIIREGMKEAGLTVYGGVNAPYIWLK
DAPAT_PELPD      NGASYPVQRAAAAVYTDEGWAQTKEIIDYYMENARIIREGLAEAGCTVYGGVNAPYIWLK
DAPAT_PELCD      NGVSYPVQKAAAAVYSDEGWAQIKETIDYYMENARLIREGLQEAGLTVYGGVNAPYIWLK
DAPAT_LEPIN      NGVSYVTQKGAEACYSPQGKKEIQTSIAYYMANASKIRDGLKKAGYEVFGGVNAPYIWLK
DAPAT_LEPIC      NGVSYVTQKGAEACYSPQGKKEIQTSIAYYMANASKIRDGLKKAGYEVFGGVNAPYIWLK
DAPAT_LEPBL      NGVSYVTQKGAEACYSPQGKKEIQASIAYYMSNAAKIREGLKKAGYEVFGGVNAPYIWLK
DAPAT_LEPBJ      NGVSYVTQKGAEACYSPQGKKEIQASIAYYMSNAAKIREGLKKAGYEVFGGVNAPYIWLK
DAPAT_LEPBA      NGVSYITQKGAEAVFSAQGQVEIKEQISYYMENAKLIREGLVKAGYTVFGGTNAPYIWLK
DAPAT_DESVH      SGIFQAVQEASIVALR-DGDDFCRELRGIYRQRRDTVINALHKAGIQCRVPQATFYVWAR
DAPAT_DESVV      SGIFQAVQEASIVALR-DGDDFCRELRGIYRQRRDTVITALHKAGIQCRVPQATFYVWAR
DAPAT_DESAG      SGAFQAVQEAAIVALR-DGDAFLAEIRDIYRKRRDTVIAALNKIGITCRVPEASLYVWAR
DAPAT_SYNFM      SGAFNAVQWAGITALE-GDQGCVVEMQRIYKERLDILIEGLKRIGLHPEVPRATFYVWCP
DAPAT_AQUAE      SGQFGAVQDAGIVALN-LPEEEVEKIRDVYRERKKIMTEALEKIGLEIYRSDYTFYLWIK
DAPT2_NOSS1      SGVFKAIQKAAIAAYA-TDEVELQAVMSVYQSRRDIIVKGLQSLGWPIEPPKATLYVWVP
DAPT2_TRIV2      SGVFKAIQKAAIAAYN-TDEVELQAVMSVYQNRRDIIVKGLQSLGWPIEPPKATLYVWVP
DAPAT_GLOVI      SGVFKAIQQAAIAAFG-LDDERLHALMAVYQNRRNIIVEGLRSLGWPLEAPKATLYVWAP
DAPAT_DESAP      SGVFQVVQYAAIAALN-GPQDGVQSLCEMYRERRDLVVDTLNDLGWRLTRPRATFYIWAP
DAPAT_CARHZ      SGVFQAIQYAGIKALE-GPQDVVKELCDLYAQRRDLVIETLNKLGWNLSKPKGTFYIWAP
DAPAT_MOOTA      SGAFQAVQYAGIAALT-GPQEGLAEVRRVYQERRDIIVEGFNSLGWHLEKPKATFYVWAP
DAPAT_DEHMC      SGIPQAIQLMAIAALN-GSQEIINQNCAIYQRRRDRLVESLRNIGMEVTAPKASLYIWAP
DAPAT_DEHMB      SGIPQAIQLMAIAALN-GSQEIINQNCAIYQRRRDRLVEALRNIGMEVTAPKASLYIWAP
DAPAT_DEHM1      SGIPQAIQLMAIAALN-GSQDVISQNCAVYQRRRDRLVEALRNIGMEVTAPKASLYIWAP
DAPAT_NATTJ      SGVFTPLQLAATHALE-NRHEYIPDILKAYKERRDLVIEFLEEAGFHVYHPKATFYVWAQ
                 .*     *  .                  *  .   :   :              * *  

DAPAT_CHLCV      -VPKILPDEDFFDFFLTQYHIAITPGKGFGACGKGYVRFSSLGKIEDIMAACQRLTLTSV
DAPAT_CHLFF      -VPSMIPDEDFFDFFLYQYHIAITPGKGFGSCGTGYVRFSSLGKSENIVAACQRLSQTSV
DAPAT_CHLAB      -VPGHIPDEDVFDFFLHHYHIAITPGKGFGSCGKGYVRFSSLGKTEDIVAACQRLTLTSV
DAPAT_CHLTB      PTQANISDRDLFDFFLREYHIAITPGIGFGRSGSGFVRFSSLGKREDILAACERLQMAPA
DAPAT_CHLT2      PTQANISDRDLFDFFLREYHIAITPGIGFGRSGSGFVRFSSLGKREDILAACERLQMAPA
DAPAT_CHLTA      PTQANISDRDLFDFFLREYHIAITPGIGFGRSGSGFVRFSSLGKREDILAACERLQMAPA
DAPAT_CHLTR      PTQANISDRDLFDFFLREYHIAITPGIGFGRSGSGFVRFSSLGKREDILAACERLQMAPA
DAPAT_CHLMU      PTIETVPYRDLFDFFLQEYHIAITPGIGFGLCGSGFVRFSSLGKREDVLVACERLQMTPA
DAPAT_CHLPN      -LPEGISDEEAFDFFLHQYHIAVTPGHGFGSCGQGFVRFSALTQPQNIALACDRLCTASL
DAPAT_PARUW      --FPQLTSWEAFEILLKQSQLVSVPGSGFGSAGEGFLRFSAFGKQSDITVALPRIKHALL
DAPAT_BACFR      -TPNGTSSWRFFDQMLYEANVVGTPGVGFGPSGEGYIRLTAFGERDDCIEAMRRIKNRL-
DAPAT_BACFN      -TPKGTSSWRFFDQMLYEANVVGTPGVGFGPSGEGYIRLTAFGERDDCIEAMRRIKNRL-
DAPAT_BACTN      -TPNGLSSWRFFEQMLYEANVVGTPGVGFGPSGEGYIRLTAFGDHNDCMEAMRRIKNWL-
DAPAT_BACV8      -APGEVSSWKFFEQMLYEANVVGTPGVGFGPSGEGYIRLTAFGERADCEEAMKRIRKWLL
DAPAT_PARD8      -TPDGLSSWKFFDKLLYEVKIVGTPGVGFGPSGEGYLRLTAFGDRDDTLEAMARLRKWLR
DAPAT_LAWIP      -TPDNLSSWDFFDLLLQNAGVVGTPGVGFGPHGEGYFRLTGFGSYEDTNKAIERIQKALL
DAPAT_LACP7      -TPDGMTSWEYFDYLLQNASVVGTPGSGFGPSGEGYFRLTAFGTYENTLEALRRIKNL--
DAPAT_METST      -TPNDIDSWSFFDILLKEAHVVSTPGAGFGPSGEGYLRLTAFNTYENTVEAMDRISKLEF
DAPAT_METS3      -TPNNMDSWAFFDLLLNEANVVGTPGSGFGPSGEGYLRLTAFNTLENTKEAMDRISKLNF
DAPAT_METTH      -TPEGMDSWQFFDTLLNDAEVVGTPGSGFGPSGEGYFRLTAFNSFRNTVKAMERISELSF
DAPAT_HELMI      -TPDNMSSWDFFDKLISVANVVGTPGAGFGASGEGYFRLTAFGTRENTVKALERIRTRM-
DAPAT_DESHY      -TPGTMGSWEFFDKLMTEAHVVGTPGAGFGANGEGFFRLTAFGTRENTEKAIERIKARMK
DAPAT_HUNT2      -TPDGISSWEFFDIMLKEINVVGTPGSGFGPSGEGYFRLTAFGSRENTLEAVERFKNLKF
DAPAT_MICAN      -TPQGLSSWDFFDKLLHTCNVVGTPGSGFGAAGEGYFRLSAFNSRANVEAAMERIISKFP
DAPAT_SYNY3      -TPHGLSSWDFFDKLLHTVNVVGTPGSGFGAAGEGYFRISAFNSRANVEEAMERITSTLK
DAPT1_NOSS1      -TPNGLSSWDFFDQLLQTVNVVGTPGSGFGAAGEGYFRVSAFNSRENVEEAMKRITEKFK
DAPT1_TRIV2      -TPNGLSSWDFFDKLLQTVNVVGTPGSGFGAAGEGYFRISAFNSRENVEEAMQRITEKFK
DAPAT_TRIEI      -TPTGLSSWDFFDKLLQNCNVVGTPGSGFGAAGEGYFRISSFNSRENVNEAMKRITEKFK
DAPAT_ACAM1      -TPNGISSWDFFDQLLHKTNVVGTPGSGFGAAGEGYFRISAFNSRANVEEAMRRITANL-
DAPAT_SYNP6      -TPAGLTSWDFFDKLLQVCNVVGTPGSGFGAAGEGYFRISAFNSRENVVTAMQRIRSAGL
DAPAT_SYNE7      -TPAGLTSWDFFDKLLQVCNVVGTPGSGFGAAGEGYFRISAFNSRENVVTAMQRIRSAGL
DAPAT_SYNJB      -TPDGLSSWEFFDKLLHTCHVVGTPGSGFGSAGEGYLRLSAFNSRANVEEAMRRIGSVFA
DAPAT_SYNJA      -APEGLSSWEFFDKLLHTCHVVGTPGSGFGSAGEGYLRLSAFNSRANVEEAMRRIVSVFG
DAPAT_THEEB      -TPAGMGSWDFFDKLLHTCFVVGTPGAGFGAAGEGYLRLSAFNSRENVVEAMDRVVTAFA
DAPAT_PROM1      -TPKNMSSWDFFDFLLEKANVVGTPGSGFGAAGEGYFRLSAFNSRENVEKAMERIVKLK-
DAPAT_PROMT      -TPKDMSSWDFFDFLLEKANVVGTPGSGFGAAGEGYFRLSAFNSRENVEKAMQRIVKLK-
DAPAT_PROMA      -APTEMDSWQFFDHLLNKANIVGTPGSGFGVAGEGYFRLSAFNSRSNVEEAMRRITSI--
DAPAT_PROMS      -VPDQMTSWDFFDFLLQKVSVVGTPGSGFGLAGEGYFRLSAFNSRSNVIDAMERIINI--
DAPAT_PROM9      -VPDQMTSWNFFDFLLQNVSVVGTPGSGFGLSGEGYFRLSAFNSRSNVLDAMERIINI--
DAPAT_PROM0      -VPDQMSSWDFFDFLLQKVGVVGTPGSGFGLAGEGYFRLSAFNSRSNVLDAMERIINI--
DAPAT_PROM5      -VPADMTSWDFFDHLLEKANVVGTPGSGFGLAGEGYFRLSAFNSRLNVSNAMERIINI--
DAPAT_PROMP      -VPDRMTSWDFFDYLLEKADVVGTPGSGFGLAGEGYFRLSAFNSRMNVNNAMERIINI--
DAPAT_PROM3      -TPDDMDSWGFFDHLLHNANVVGTPGSGFGAAGEGYFRLSAFNSRVNVDEAMRRIRAL--
DAPAT_PROMM      -TPDDMDSWGFFDHLLQNAHVVGTPGSGFGAAGEGYFRLSAFNSRVNVDEAMRRIRAL--
DAPAT_SYNPW      -TPDGMDSWGFFDHLLNKANVVGTPGSGFGAAGEGYFRLSAFNSRANVDEAMARIKAL--
DAPAT_SYNPX      -TPEGMDSWGFFDHLLNKANVVGTPGSGFGASGEGYFRLSAFNSRANVDAAMARIKAL--
DAPAT_SYNSC      -TPEGMDSWGFFDHLLNKANVVGTPGSGFGAAGECYFRLSAFNSRANVDEAMARIKAL--
DAPAT_SYNS9      -TPNGMDSWGFFDHLLNKANVVGTPGSGFGAAGEGYFRLSAFNSRKNVNEAMARIKSL--
DAPAT_SYNS3      -TPSGMDSWSFFDHLLQKANVVGTPGSGFGAAGEGYFRLSAFNSRSNVDEAMARIRNL--
DAPAT_SYNR3      -TPEGMDSWGFFDHLLNRANVVGTPGSGFGAAGEGYFRLSAFNSRSNVDEAMRRIRAL--
DAPAT_GEOSL      -TPGGMSSWDFFDKLLNECNVVGTPGSGFGPSGEGFFRLSAFGHRENVIEAVERIKKNLK
DAPAT_GEOMG      -TPGGMSSWDFFDKLLTECNVVGTPGSGFGPSGEGFFRLSAFGHRENVIEAVERIKKNLK
DAPAT_GEOUR      -TPAGMTSWDFFDKLLTECNVVGTPGSGFGPSGEGYFRLSAFGHRENVIEAVERIKKNLK
DAPAT_PELPD      -TPGGMSSWEFFDKLLTECNVVGTPGSGFGPSGEGFFRLSAFGNRENVIEAVERIKKNLK
DAPAT_PELCD      -TPNGMSSWDFFDKLLSECHVVGTPGSGFGPSGEGFYRLSAFGDRENVLTAIDRIKKNLA
DAPAT_LEPIN      -TSDNLSSWDFFDKLLNKAQVVGTPGSGFGPAGEGYFRLSAFGKKEDVEEAIARITSL--
DAPAT_LEPIC      -TSDNLSSWDFFDKLLNKAQVVGTPGSGFGPAGEGYFRLSAFGKKEDVEEAIARITSL--
DAPAT_LEPBL      -TSDNLSSWDFFDRLLDKAQVVGTPGSGFGPAGEGYFRLSAFGKKEDVEEAIARISFL--
DAPAT_LEPBJ      -TSDNLSSWDFFDRLLDKAQVVGTPGSGFGPAGEGYFRLSAFGKKEDVEEAIARISFL--
DAPAT_LEPBA      -TPRGLKSWEFFDELLGTAQVVGTPGSGFGPAGEGYFRLSAFGKREDVISAIERIQKM--
DAPAT_DESVH      VPQGH-TSADFVTRVLQETGVVVTPGNGFGTPGEGFFRISLTVDNARLEEAVSRIAKL--
DAPAT_DESVV      VPQGH-TSADFVTRVLQETGVVVTPGNGFGTPGEGFFRISLTVDNARLEEAVSRIAKL--
DAPAT_DESAG      VPEGY-TSSDFVTRVLQETGVVMTPGNGFGAAGEGYFRISLTVNDERLEEAVSRIASL--
DAPAT_SYNFM      TPPGY-SSKDFSSLLLREAGIVATPGSGFGAPGEGYIRMALTVDKERVREAVERMRKLSF
DAPAT_AQUAE      VPEGY-TSAEFVGRLIDEAGIVCTPGNGFGEYGEGYFRISLTVPTERLLEAAERIKNLKL
DAPT2_NOSS1      VPPGY-TSTEFTTLLLDKCGIVVPPGVGYGASGEGYFRVALTISDERLHEAIQRMQDAGI
DAPT2_TRIV2      VPPGY-TSTEFTTLLLDKCGIVVPPGVGYGVSGEGYFRIALTICEERLHEAIQRMQDAGI
DAPAT_GLOVI      IPKSFGSSVEFVGALLDKCGIIVPPGNGYGEHGEGFFRIALTVPDERMREAIGRMEAAGI
DAPAT_DESAP      VPAGH-DASSFAEMVLEKAGVVITPGTGYGTYGEGYFRISLTLPTPRLVEAMERLRGCLG
DAPAT_CARHZ      VPKGF-TSASFAEYLIEKAGVVITPGNGYGTNGEGYFRISLTIPTSRLKEALQRIEQHLG
DAPAT_MOOTA      VPRGY-TSASFAEMVLEKAGVIITPGNGYGNYGEGYFRIALTISKERMQEAIERLRRVLG
DAPAT_DEHMC      VPESY-TSASFATELLDKTGVVVTPGTGYGTAGEGYIRLSLTVPDEQIEKGIAKLAGYKK
DAPAT_DEHMB      VPESY-TSASFATELLDKTGVVVTPGTGYGTAGEGYIRLSLTVPDEQIEKGIAKLAGYKK
DAPAT_DEHM1      VPEGY-TSASFATELLDKTGVVVTPGTGYGTSGEGYIRLSLTVPDEQLEKGIAKLANFKS
DAPAT_NATTJ      VPGNQ-DSFNFTKSLLTKTGVVVTPGIGFGKHGEGYFRIALTVTKDRLKTAMEKICEYFS
                               .:    :   ** *:*  *  : *.:          .  :.     

DAPAT_CHLCV      YDRMV---
DAPAT_CHLFF      YDRTVLSL
DAPAT_CHLAB      YDTMVLSL
DAPAT_CHLTB      LQS-----
DAPAT_CHLT2      LQS-----
DAPAT_CHLTA      LQS-----
DAPAT_CHLTR      LQS-----
DAPAT_CHLMU      LQ------
DAPAT_CHLPN      KETMVLA-
DAPAT_PARUW      KIKPTVY-
DAPAT_BACFR      --------
DAPAT_BACFN      --------
DAPAT_BACTN      --------
DAPAT_BACV8      --------
DAPAT_PARD8      --------
DAPAT_LAWIP      I-------
DAPAT_LACP7      --------
DAPAT_METST      --------
DAPAT_METS3      --------
DAPAT_METTH      --------
DAPAT_HELMI      --------
DAPAT_DESHY      --------
DAPAT_HUNT2      --------
DAPAT_MICAN      G-------
DAPAT_SYNY3      LG------
DAPT1_NOSS1      L-------
DAPT1_TRIV2      L-------
DAPAT_TRIEI      V-------
DAPAT_ACAM1      --------
DAPAT_SYNP6      A-------
DAPAT_SYNE7      A-------
DAPAT_SYNJB      GAGAVG--
DAPAT_SYNJA      S-------
DAPAT_THEEB      --------
DAPAT_PROM1      --------
DAPAT_PROMT      --------
DAPAT_PROMA      --------
DAPAT_PROMS      --------
DAPAT_PROM9      --------
DAPAT_PROM0      --------
DAPAT_PROM5      --------
DAPAT_PROMP      --------
DAPAT_PROM3      --------
DAPAT_PROMM      --------
DAPAT_SYNPW      --------
DAPAT_SYNPX      --------
DAPAT_SYNSC      --------
DAPAT_SYNS9      --------
DAPAT_SYNS3      --------
DAPAT_SYNR3      --------
DAPAT_GEOSL      --------
DAPAT_GEOMG      --------
DAPAT_GEOUR      --------
DAPAT_PELPD      --------
DAPAT_PELCD      --------
DAPAT_LEPIN      --------
DAPAT_LEPIC      --------
DAPAT_LEPBL      --------
DAPAT_LEPBJ      --------
DAPAT_LEPBA      --------
DAPAT_DESVH      --------
DAPAT_DESVV      --------
DAPAT_DESAG      --------
DAPAT_SYNFM      --------
DAPAT_AQUAE      --------
DAPT2_NOSS1      RYA-----
DAPT2_TRIV2      RYS-----
DAPAT_GLOVI      RFEG----
DAPAT_DESAP      RVTF----
DAPAT_CARHZ      KVEF----
DAPAT_MOOTA      KVEF----
DAPAT_DEHMC      SS------
DAPAT_DEHMB      SS------
DAPAT_DEHM1      QA------
DAPAT_NATTJ      --------