CLUSTAL format seed alignment for MF_01643

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

PURT_NITSB      -------MQFPAPLKSNSIKFLLLGSGELGKEVAIEAQRLGIEVVAVDRYPNAPAHLVAH
PURT_SULDN      -------MLFSAPLKSNSKKIMLLGSGELGREVAIEAQRLGLEVIAVDRYQNAPAHSVAH
PURT_SULNB      -------MTFTAPLQKDAIRIMLLGSGELGKEVAIEAQRLGIEVIAVDKYENAPAHLVAN
PURT_WOLSU      -------MKFPSPFTPNSIKIMLLGSGELGKEVIIEAQRLGLETIAVDKYENAPAHGVAH
PURT_METM5      --------MVGTPLFSNAKKILLLGSGELGKEVIIEAQRFGVECIAVDSYENAPAMQVAH
PURT_METM7      --------MVGTPLFSNAKKILLLGSGELGKEVIIEAQRFGVECIAVDSYENAPAMQVAH
PURT_METMP      --------MVGTPLFSNAKKILLLGSGELGKEVIIEAQRFGVECIAVDSYENAPAMQVAH
PURT_METVS      --------MVGTPLFSNAKKILLLGSGELGKEVIIEAQRLGVECIAVDSYENAPAMQVAH
PURT_META3      -------MLLGTPLFSNGTKILLLGSGELGKEVIIEAQRLGIECVAVDSYDNAPAMQVAH
PURT_METJA      -------MAIGTPLLKGSIKFLLLGSGELGKEVVIEAQRLGIECIAVDRYQNAPAMQVAH
PURT_BACSU      --------------MYQSKKVLLLGSGELGKEVVIEAQRLGVQTVAVDSYEHAPAMQVAH
PURT_BACVZ      --------------MYQAKKMLLLGSGELGKEVVIEAQRLGVVTVAVDSYEHAPAMQAAH
PURT_HALWD      -MSPAHGNRLGTPESPNATTLLLLGSGELGKEVVLAAQRLGIETVAVDRYEHAPAMQVAH
PURT_ECOLI      ------MTLLGTALRPAATRVMLLGSGELGKEVAIECQRLGVEVIAVDRYADAPAMHVAH
PURT_SHISS      ------MTLLGTALRPAATRVMLLGSGELGKEVAIECQRLGVEVIAVDRYADAPAMHVAH
PURT_SHIBS      ------MTLLGTALRPAATRVMLLGSGELGKEVAIECQRLGVEVIAVDRYADAPAMHVAH
PURT_ECOUT      ------MTLLGTALRPAATRVMLLGSGELGKEVAIECQRLGVEVIAVDRYADAPAMHVAH
PURT_ECOK1      ------MTLLGTALRPAATRVMLLGSGELGKEVAIECQRLGVEVIAVDRYADAPAMHVAH
PURT_ECOL5      ------MTLLGTALRPAATRVMLLGSGELGKEVAIECQRLGVEVIAVDRYADAPAMHVAH
PURT_ECO57      ------MTLLGTALRPAATRVMLLGSGELGKEVAIECQRLGVEVIAVDRYADAPAMHVAH
PURT_SHIDS      ------MTLLGTALRPAATRVMLLGSGELGKEVAIECQRLGVEVIAVDRYADAPAMHVAH
PURT_SHIFL      ------MTLLGTALRPAATRVMLLGSGELGKEVAIECQRLGVEVIAVDRYADAPAMHVAH
PURT_SHIF8      ------MTLLGTALRPAATRVMLLGSGELGKEVAIECQRLGVEVIAVDRYADAPAMHVAH
PURT_SALPA      ------MTLLGTALRPAATRVMLLGAGELGKEVAIECQRLGIEVIAVDRYPDAPAMHVAH
PURT_SALTI      ------MTLLGTALRPAATRVMLLGAGELGKEVAIECQRLGIEVIAVDRYPDAPAMHVAH
PURT_SALCH      ------MTLLGTALRPAATRVMLLGAGELGKEVAIECQRLGIEVIAVDRYPDAPAMHVAH
PURT_SALTY      ------MTLLGTALRPAATRVMLLGAGELGKEVAIECQRLGIEVIAVDRYPDAPAMHVAH
PURT_CROS8      ------MAMLGTALRPSATRVMLLGSGELGKEVAIECQRLGIEVIAVDRYADAPAMQVAH
PURT_YERPE      ------MLTIGTALRPGATRVMLLGAGELGKEVAIECQRLGLEVIAVDRYADAPAMHVAH
PURT_YERPA      ------MLTIGTALRPGATRVMLLGAGELGKEVAIECQRLGLEVIAVDRYADAPAMHVAH
PURT_YERPN      ------MLTIGTALRPGATRVMLLGAGELGKEVAIECQRLGLEVIAVDRYADAPAMHVAH
PURT_YERPP      ------MLTIGTALRPGATRVMLLGAGELGKEVAIECQRLGLEVIAVDRYADAPAMHVAH
PURT_YERPS      ------MLTIGTALRPGATRVMLLGAGELGKEVAIECQRLGLEVIAVDRYADAPAMHVAH
PURT_YERE8      ------MLTIGTALRPNATRVMLLGSGELGKEVAIECQRLGLEVIAVDRYADAPAMHVAH
PURT_PECAS      ------MLTIGTALRADATRVMLLGSGELGKEVAIECQRLGIEVIAVDRYADAPAMQVAH
PURT_SODGM      ------MITIGTALRPAATRVMLLGAGELGKEVAIECQRLGIEVIAVGHYADAPAMHIAH
PURT_WIGBR      ------MVTINTALCKNSTRVMILGSGELGKEIAIECQRLGIEVISVDSYSNAPAMHVSH
PURT_AERHH      --------MFGTATRPGATRALLLGSGELGKEVAIELQRFGIEVIAADRYADAPAMQVAH
PURT_AERS4      --------MFGTATRPSATRALLLGSGELGKEVAIELQRFGIEVIAADRYPNAPAMQVAH
PURT_PSYIN      ----MSVSIFGSAKANSATKALLLGSGELGKEVAIELQRFGIEVIAADSYENAPAMQVAH
PURT_VIBCB      --------MFGTATRTHATRVLLLGSGELGKEVAIECQRLGLEVIACDRYANAPAMQVAH
PURT_VIBPA      --------MFGTATSANATRVLLLGSGELGKEVAIECQRLGLEVIACDRYADAPAMQVAH
PURT_VIBVU      --------MFGTATRESATRVLLLGSGELGKEVAIECQRLGLEVIACDRYPDAPAMQVAH
PURT_VIBVY      --------MFGTATRESATRVLLLGSGELGKEVAIECQRLGLEVIACDRYPDAPAMQVAH
PURT_VIBCH      --------MFGTATRDNATRVLLLGSGELGKEVAIECQRLGLEVIACDRYADAPAMQVAH
PURT_ALIF1      --------MFGTALSSSATKVLLLGSGELGKEVAIECQRLGFEVIAVDRYLNAPAMQVAH
PURT_PHOPR      --------MFGSATRSDATRVLLLGSGELGKEVAIECQRLGLEVIAVDRYDNAPAMQVAH
PURT_SHEB5      --------MIGTPYTEGARRAMLLGCGELGKEVAIELQRLGVEVIGVDRYANAPAMQVAH
PURT_SHEB8      --------MIGTPYTEGARRAMLLGCGELGKEVAIELQRLGVEVIGVDRYANAPAMQVAH
PURT_SHEPC      --------MIGTPYTEGARRAMLLGCGELGKEVAIELQRLGVEVIGVDRYANAPAMQVAH
PURT_SHESW      --------MIGTPYTEGARRAMLLGCGELGKEVAIELQRLGVEVIGVDRYANAPAMQVAH
PURT_SHESM      --------MIGTPYTEGARRAMLLGCGELGKEVAIELQRLGVEVIGVDRYPNAPAMQIAH
PURT_SHESR      --------MIGTPYTEGARRAMLLGCGELGKEVAIELQRLGVEVIGVDRYPNAPAMQIAH
PURT_SHESA      --------MIGTPYTEGARRAMLLGCGELGKEVAIELQRLGVEVIGVDRYPNAPAMQIAH
PURT_SHEON      --------MIGTPYTEGARRAMLLGCGELGKEVAIELQRLGVEVIGVDRYPNAPAMQIAH
PURT_SHEFN      ---MSIATTFGTANTSGTIKAMLLGCGELGKEVAIELQRYGIEVIGVDRYPNAPAMQIAH
PURT_SHEAM      --------MIGTPYTQGATRAMLLGSGELGKEVAIELQRLGVEVIAVDRYPNAPAMQVAH
PURT_PSEAE      ------MTRIGTPLSPSATRVLLCGSGELGKEVAIELQRLGCEVIAVDRYGNAPAMQVAH
PURT_PSEAB      ------MTRIGTPLSPSATRVLLCGSGELGKEVAIELQRLGCEVIAVDRYGNAPAMQVAH
PURT_AZOSB      ------MPRIGTPLSPTATRVLLCGSGELGKEVVIELQRLGCEVIAVDRYPNAPAMQVAH
PURT_PSEE4      ------MTRIGTPLSPTATRVLLCGCGELGKEVVIELQRLGVEVIAVDRYANAPAMQVAH
PURT_PSEPK      ------MTRIGTPLSPTATRVLLCGCGELGKEVVIELQRLGVEVIAVDRYANAPAMQVAH
PURT_PSEF5      ------MTRIGTPLSPTATRVLLCGCGELGKEVVIELQRLGVEVIAVDRYANAPAMQVAH
PURT_PSEPF      ------MTRIGTPLSPTATRVLLCGCGELGKEVVIELQRLGVEVIAVDRYANAPAMQVAH
PURT_PSE14      ------MTQIGTPLSPTATRVLFCGSGELGKEVVIELQRLGVEVIAVDRYENAPAMQVAH
PURT_PSEU2      ------MTQIGTPLSPTATRVLFCGSGELGKEVVIELQRLGVEVIAVDRYENAPAMQVAH
PURT_PSESM      ------MTRIGTPLSPTATRVLFCGSGELGKEVVIELQRLGVEVIAVDRYENAPAMQVAH
PURT_PSEU5      ------MPRIGTPLSPSATRILLCGCGELGKELVIELQRFGVEVIAVDRYANAPAMQVAH
PURT_XANAC      ------MTTLGTPLSPSATRVLLLGSGELGKEVAIELQRFGVEVIAADRYANAPAMQVAH
PURT_XANC5      ------MTTFGTPLSPSATRVLLLGSGELGKEVAIELQRFGVEVIAADRYANAPAMQVAH
PURT_XANOR      ------MTTLGTPLSPSATRVLLLGSGELGKEVAIELQRFGVEVIAADRYANAPAMQVAH
PURT_XANOM      ------MTTLGTPLSPSATRVLLLGSGELGKEVAIELQRFGVEVIAADRYANAPAMQVAH
PURT_XANCP      ------MTTLGTPLSPSATRVLLLGSGELGKEVAIELQRFGVEVIAADRYANAPAMQVAH
PURT_XANC8      ------MTTLGTPLSPSATRVLLLGSGELGKEVAIELQRFGVEVIAADRYANAPAMQVAH
PURT_ALCBS      ------MTVIGTPFTDNATRVMLLGSGELGREVALELIRYGCEVIAVDRYAHAPAMQVAQ
PURT_MARHV      ---------MGTPLKSNSFRVLFCGSGELGKEVVIELQRFGVEVIAIDRYADAPAMQVAH
PURT_DESVH      ------MASIGTPLTPTATRILLLGSGELGREVALEAMRLGVEVVAVDRYPNAPAMQVAH
PURT_DESVV      ------MASIGTPLTPTATRILLLGSGELGREVALEAMRLGVEVVAVDRYPNAPAMQVAH
PURT_DESAG      ------MTVIGTPLSPVRTRIMLLGSGELGKEVAIEAMRLGAEVVAVDRYAGAPAMQVAH
PURT_ACTP2      ------MTTIGTPLRPNATKVMMLGSGELGKEVVIELQRLGVEVIAVDRYENAPAQQVAH
PURT_HAEDU      ------MTTMGTPLTPNATKVMMLGSGELGKEVVIELQRLGVEVIAVDRYANAPAQQVAH
PURT_MANSM      ------MTTLGTALTPKATKVMMLGSGELGKEVVIELQRLGVEVIAVDRYKNAPAQQVAH
PURT_PASMU      ------MTTIGTPLTPKATKVMMLGSGELGKEVVIELQRLGVEVIAVDRYANAPAQQVAH
PURT_HAES1      ------MTILGTALTPKATKVMLLGSGELGKEVVIELQRLGVEVIAVDRYENAPAQQVAH
PURT_PARD8      ------MVTIGTPKSATATKVVLCGSGELGKEFVIELQRYGVEVIALDKYPDAPAMQVAH
PURT_HYDCU      ------MLQIGTTFSKTATKILLCGAGELGKEVAIEAQRLGLEVIALDRYENAPAMQVAD
PURT_HAHCH      ------MVRIGTPLTDVATRAMLLGSGELGKEVAIELQRFGVEVIAVDRYSNAPAMQVAH
PURT_POLNA      ------MTTFGTPLSPHATKVMLLGSGELGKEVLIALQRLGVETIAVDRYENAPGQQVAH
PURT_POLSJ      ------MTTFGTPLSPHATKVMLLGSGELGKEVLIALQRLGVETIATDRYDNAPGQQVAH
PURT_RHOFT      ------MTTLGTPLSHHATKVMLLGSGELGKEVIIALQRLGVETIAVDRYNHAPGQQVAH
PURT_CUPNH      ------MTTLGTPLSPSATKVMLLGSGELGKEVLIALQRLGVETIAVDRYDNAPGQQVAH
PURT_CUPPJ      ------MTTIGTPLSPSATKVMLLGSGELGKEVLIALQRLGVETIAVDRYDNAPGQQVAH
PURT_CUPMC      ------MTTLGTPLSPSATKVMLLGSGELGKEVLIALQRLGVETIAVDRYENAPGQQVAH
PURT_ACIAC      -----MPITLGTPLSPSATKVMLLGSGELGKEVLIALHRLGVETTAVDRYDNAPGQQVAH
PURT_MYCS2      ------MTTIGTPLSPRATKVMLLGSGELGREVLIALQRLGVETIAVDRYENAPGHQVAH
PURT_MYCVP      ------MTTIGTPLSPRATKVMLLGSGELGREVLIALQRLGVETIAVDRYDNAPGQQVAH
PURT_BORBR      -MSTFPAPVLGTPLSPTATRVMLLGAGELGKEVVIALQRLGVEVIAVDRYADAPGHQVAH
PURT_BORPA      -MSTFPAPVLGTPLSPTATRVMLLGAGELGKEVVIALQRLGVEVIAVDRYADAPGHQVAH
PURT_BORPE      -MSTFPAPVLGTPLSPTATRVMLLGAGELGKEVVIALQRLGVEVIAVDRYADAPGHQVAH
PURT_BORA1      -MSSFPAPVLGTPLSPSATRVMLLGSGELGKEVIIALQRLGVEVIAVDRYADAPGHQVAH
PURT_BURCA      ---MQIGQRLGTPLSPSATRVMLLGAGELGKEVIIALQRLGVEVVAVDRYPDAPGHQVAH
PURT_BURCH      ---MQIGQRLGTPLSPSATRVMLLGAGELGKEVIIALQRLGVEVVAVDRYPDAPGHQVAH
PURT_BURL3      ---MQIGQRLGTPLSPSATRVMLLGAGELGKEVIIALQRLGVEVVAVDRYPDAPGHQVAH
PURT_BURCM      ---MQIGQRLGTPLSPSATRVMLLGAGELGKEVIIALQRLGVEVVAVDRYPDAPGHQVAH
PURT_BURVG      ---MQIGQRLGTPLSPSATRVMLLGAGELGKEVIIALQRLGVEVIAVDRYPDAPGHQVAH
PURT_BURMA      ---MQIGQRLGTPLSPSATRVMLLGAGELGKEVIIALQRLGVEVIAVDRYPNAPGHQVAH
PURT_BURM9      ---MQIGQRLGTPLSPSATRVMLLGAGELGKEVIIALQRLGVEVIAVDRYPNAPGHQVAH
PURT_BURM7      ---MQIGQRLGTPLSPSATRVMLLGAGELGKEVIIALQRLGVEVIAVDRYPNAPGHQVAH
PURT_BURMS      ---MQIGQRLGTPLSPSATRVMLLGAGELGKEVIIALQRLGVEVIAVDRYPNAPGHQVAH
PURT_BURPS      ---MQIGQRLGTPLSPSATRVMLLGAGELGKEVIIALQRLGVEVIAVDRYPNAPGHQVAH
PURT_BURP0      ---MQIGQRLGTPLSPSATRVMLLGAGELGKEVIIALQRLGVEVIAVDRYPNAPGHQVAH
PURT_BURP1      ---MQIGQRLGTPLSPSATRVMLLGAGELGKEVIIALQRLGVEVIAVDRYPNAPGHQVAH
PURT_BURP6      ---MQIGQRLGTPLSPSATRVMLLGAGELGKEVIIALQRLGVEVIAVDRYPNAPGHQVAH
PURT_BURTA      ---MQIGQRLGTPLSPSATRVMLLGAGELGKEVIIALQRLGVEVIAVDRYPNAPGHQVAH
PURT_PARXL      ---MQIGQRIGTPLSESATRVMLLGAGELGKEVIIALQRLGVEVIAVDRYPNAPGHQVAH
PURT_DECAR      -------MKIGTPLSPSALRVMLLGAGELGKEVIIALQRLGVEVIAVDRYENAPGHQVAH
PURT_THIDA      -------MRLGTPLSPSATRVMLLGAGELGKEVIIALQRLGVEVVAVDRYEHAPGHQVAH
PURT_METFK      -------MNIGTPLSPVATRVMLLGSGELGKEVIIALQRLGVEVIAVDRYQNAPGHQVAH
PURT_HERAR      MNKSNTISRIGTPLTHNATKVMLLGSGELGKEVIISLQRLGIEVIAVDRYANAPGHQVAH
PURT_JANMA      MTKSNTINRIGTPLSATATKVMLLGSGELGKEVIISLQRLGVEVIAVDRYSNAPGHQVAH
PURT_RHOJR      -MREQAPVRFGTPLTAGATRVMLLGSGELGKEVIIALQRLGVEVIAVDRYDNAPGHQVAH
PURT_METCA      -------MRIGTPNSPSAVRVMLLGSGELGKEVAISLQRYGVEVIAVDRYAGAPAQQVAH
PURT_CORGL      ---MYIPESIGTPLTPNATKVMLLGSGELGKEVAIAFQRLGLEVHAVDRYEHAPAHQVAH
PURT_CORGB      ---MYIPESIGTPLTPNATKVMLLGSGELGKEVAIAFQRLGLEVHAVDRYEHAPAHQVAH
PURT_COREF      ---MFIPEKIGTPLSPNATKVMILGSGELGKEVTIAFQRLGVEVHAVDRYDNAPAHQVAH
PURT_CORJK      ---MYTPEAIGTPLTPSSLKVLLLGASELGRELAIALQRLGIEVHAADRYAGAPAHLVAN
PURT_ACIBT      -----MSVTLGTPLQSSAFKVLLLGSGELGKEVVISLQRLGVEVHAADRYDHAPAMQVAH
PURT_ACIAD      -----MSVTIGTPLQSSAFKVLLLGSGELGKEVVISLQRLGVEVHAADRYDHAPAMQVAH
PURT_GEOMG      --------MIGTPLKKSATRVMLLGSGELGKEVVLEAQRLGVEVIAVDRYADAPAMQVAH
PURT_PELPD      -------MNLGTPLKPGATRVLLLGSGELGKEVAIEAQRLGVEVIAVDRYADAPAMQVAH
PURT_PELCD      --------MIGTPLKKSATKLMMLGCGELGKEVVIEAQRFGIETIAVDRYADAPAMQVAH
PURT_FRATF      -------------MNISNIKIMLLGSGELGKEFIIAAQRLGIHTIAVDRYKNAPAMQVAH
PURT_FRATH      -------------MNISNIKIMLLGSGELGKEFIIAAQRLGIHTIAVDRYKNAPAMQVAH
PURT_FRATO      -------------MNISNIKIMLLGSGELGKEFIIAAQRLGIHTIAVDRYKNAPAMQVAH
PURT_FRATT      -------------MNISNIKIMLLGSGELGKEFIIAAQRLGIHTIVVDRYKNAPAMQVAH
PURT_FRAT1      -------------MNISNIKIMLLGSGELGKEFIIAAQRLGIHTIVVDRYKNAPAMQVAH
PURT_FRATW      -------------MNISNIKIMLLGSGELGKEFIIAAQRLGIHTIVVDRYKNAPAMQVAH
PURT_FRATN      -------------MNISNIKIMLLGSGELGKEFIIAAQRLGIHTIAVDRYKNAPAMQVAH
PURT_NOSS1      ----------MSKAIKLPQKLMLLGSGELGKEFVIAAQRLGNYVIAVDRYANAPAMQVSD
PURT_TRIV2      ----------MSKAIKLPQKLMLLGSGELGKEFVIAAQRLGNYVIAVDRYANAPAMQVAD
PURT_SYNP6      ----------MTFADRLPRRLMLLGSGELGKEFAIAAQRLGNTVIAVDRYAHAPAMQVAD
PURT_SYNE7      ----------MTFADRLPRRLMLLGSGELGKEFAIAAQRLGNTVIAVDRYAHAPAMQVAD
PURT_SYNY3      ----------MANPVTLPQTFLLLGSGELGKEFTIAAQRLGNRVIAVDRYPDAPAMQVAQ
PURT_PROM3      -------------MTVLPKTLLLLGSGELGKEITIAAQRLGCHVIACDRYSGAPAMQVAD
PURT_PROMM      -------------MTVLPKTLLLLGSGELGKEITIAAQRLGCHVIACDRYSGAPAMQVAD
PURT_SYNSC      -------------MPSFPRTVMLLGSGELGKEVAIAAQRLGCRVIACDRYAGAPAMQVAD
PURT_SYNPX      -------------MTQFPKTVMLLGSGELGKEVAISAQRIGCHVIACDRYADAPAMQVAD
PURT_SYNS9      -------------MTAFPRTVMLLGSGELGKEVAIAAQRLGCRVIACDRYANAPAMQVAD
PURT_SYNPW      -------------MTTLPAKVLLLGSGELGKEVAIAAQRLGCHVIACDRYADAPAMQVAD
PURT_SYNS3      -------------MTNFPKTVMLLGSGELGKEVAIAAQRLGCHVIACDRYADAPAMQVAD
PURT_SYNR3      -----------MTSTHLPATLLLLGSGELGKEVAIAAQRLGCRVVAVDRYANAPAMQVAD
PURT_PROM1      -------------MNVFPKKIMLLGSGELGKEVAIAAKRLGCYVIACDRYNDAPAMQIAD
PURT_PROMT      -------------MNVFPKKIMLLGSGELGKEVAIAAKRLGCYVIACDRYNDAPAMQIAD
PURT_PROMA      -------------MTIFPKTLMLLGSGELGKEVAIAGKRLGCKVIACDRYEEAPAMQVAD
PURT_PROMS      ----------MKESIFSKKRILLLGSGELGKELVIESKRLGLEVIAIDRYEKAPAMQVAD
PURT_PROM0      ----------MKESIFSKKRILLLGSGELGKELVIESKRLGLEVIAIDRYEKAPAMQVAD
PURT_PROM9      ----------MNDSVFSKKRILLLGSGELGKELVIESKRLGLEVIAIDRYEKAPAMQVAD
PURT_PROM5      ----------MDSFKFIQKKILLLGSGELGKELVVEAKRLGLEVIAIDKYENAPAMQLAD
PURT_PROMP      ----------MSSFKFIPKKILLLGSGELGKELVVEAKRLGLEVIAIDKYENAPAMQLAD
PURT_BACFR      -----------------MKKILLLGSGELGKEFVISAQRKGQHIIACDSYAGAPAMQVAD
PURT_BACFN      -----------------MKKILLLGSGELGKEFVISAQRKGQHIIACDSYAGAPAMQVAD
PURT_BACTN      -----------------MKKILLLGSGELGKEFVISAQRKGQHVIACDSYAGAPAMQVAD
PURT_BACV8      ----------------MTKKILLLGSGELGKEFVIAAKRKGQYVIACDSYAGAPAMQVAD
PURT_CHLPD      ----------------MQKKIMLLGSGELGKEFVIAVKRLGHFVIAVDSYNDAPAQQVAD
PURT_CHLTE      ----------------MPKTIMLLGSGELGKEFVIAVKRLGQRVVAVDSYDDAPAQQVAD
PURT_LEPBJ      ----------------MKKKILLLGSGELGKEFIIAAQRLGQYVIAVDFYDGAPAMQVAH
PURT_LEPBL      ----------------MKKKILLLGSGELGKEFIIAAQRLGQYVIAVDFYDGAPAMQVAH
PURT_LEPIN      ----------------MKKKILLLGSGELGKEFVIAAQRLGQYVIAVDSYDDAPAMQVAH
PURT_LEPIC      ----------------MKKKILLLGSGELGKEFVIAAQRLGQYVIAVDSYDDAPAMQVAH
PURT_FLAPJ      ------------------MKILLLGSGELGKEFAIAAQRIGQTIIAVDNYPNAPAMQVAH
PURT_ANADE      ----------------MRKKILLLGSGELGKEFTIAAQRLGQEIIAVDAYDGAPAQQVAH
PURT_ERYLH      --------------MPHTAKILLLGSGELGREFVISAKRLGAYVVACDAYAAAPAMQVAD
PURT_BIFAA      --------------------MLFLGSGELGKEVTIELMRLGAWVCAADSYAGAPAQQVAH
PURT_BIFLO      --------------------MLFLGAGELGKEVAIELMRLGAWVCAADSYAGAPAQQVAH
PURT_SULAC      -------MEIGTPLFEGAKKLLWLGGGELGKEMVIEAQRMGVETVVIDRYDLAPAMHVAH
PURT_SULTO      -------MEIGTPLFEGAKKLLWLGGGELGKEMVIEAQRMGIETVVVDRYDMAPAMHVAH
PURT_SACS2      -------MEIGTPLFEGSKKILLLGSGELGKEMAIEAQRMGLEVVALDRYDLAPAMHVAH
PURT_IGNH4      -----MREVLGTALTSSSQKALLLGSGELGKEVVIELQRLGVEVVAVDRYDRAPAMHVAH
PURT_PYRAB      --MIEPRDELGTATTDSAQKILLLGSGELGKEIAIEAQRLGVEVIAVDRYANAPAMQVAH
PURT_PYRFU      --MIKLRDELGTATTDSAQKILLLGSGELGKEIAIEAQRLGVEVVAVDRYANAPAMQVAH
PURT_PYRHO      --MIKLRDELGTATTDSAQKILLLGSGELGKEIAIEAQRLGVEVVAVDRYANAPAMQVAH
PURT_THEKO      --MIRPRDELGTATTDSAQKIVLLGSGELGKEIAIEAQRLGVEVIAVDRYANAPAMQIAH
PURT_METAR      -MGITARKVLGTPYANGA-KLMFLGAGELGKETMIEAQRMGIEIVAVDRYANSPGMQVAH
                                     :  * .***:*  :   * *      . *  :*.   :.

PURT_NITSB      RSYVIDMKSKEQVLEVIFREKPDYILPEIEAINIEALFEAEER-GFRVIPNAEAVNKTMN
PURT_SULDN      RSYVVNMQDKDALLEIIYREKPDYILPEIEAISIDALFEAEDK-GYNVIPNANAVSKTMN
PURT_SULNB      RSYAIDMQDKSAVLELIEKEQPSYILPEVEAISISALFEAEKR-GFHVIPNAEAVNKTMN
PURT_WOLSU      RSYVVNMQDKEALLDLIQKENPTYILPEVEAISLEALLEAEEK-GFCVIPSAKAVSLTMN
PURT_METM5      RFHVIDMKDAGALREVIEREKPDLIVPEIEAINTDTLKEMETE-GYHVVPTANATKLTMD
PURT_METM7      RFHVIDMKDGGALRAVIEREKPDLIVPEIEAINTDTLKELETE-GYHVVPTANATKLTMD
PURT_METMP      KYHIIDMKDAGALRAVIEKEKPDLIVPEIEAINTDTLKEMESE-GYHVVPTANATKLTMD
PURT_METVS      RYHVIDMKDSGSLRAVIEREKPDLIVPEIEAINTDTLKEMETE-GYHVVPTANAAKLTMD
PURT_META3      RSYVIDMKDGDALKAILEKEVPDYIIPEIEAINTDILIEMEEF-GHQVVPTANAAKITMD
PURT_METJA      KSYVIDMKDYDALMAIIEREEPDYIVPEIEAINTDALIDAEKM-GYTVIPTAEATKITMN
PURT_BACSU      NSYVVDMLDPEQIRTIIEKENPDLIVPEVEAIATDELLKLEEE-GFHVIPNARAAKLTMD
PURT_BACVZ      KSYVIDMLDKAQVREVIEKEKPDLIVPEVEAIATDELLKLEEE-GFHVIPNARAAKLTMD
PURT_HALWD      RDYIIDMTDATALREVVQQEDPTIIIPEIEAIATDELKRLETQ-GYDVVPTAQATRLTMD
PURT_ECOLI      RSHVINMLDGDALRRVVELEKPHYIVPEIEAIATDMLIQLEEE-GLNVVPCARATKLTMN
PURT_SHISS      RSHVINMLDGDALRRVVELEKPHYIVPEIEAIATDMLIQLEEE-GLNVVPCARATKLTMN
PURT_SHIBS      RSHVINMLDGDALRRVVELEKPHYIVPEIEAIATDMLIQLEEE-RLNVVPCARATKLTMN
PURT_ECOUT      RSHVINMLDGDALRRVVELEKPHYIVPEIEAIATDMLIQLEEE-GLNVVPCARATKLTMN
PURT_ECOK1      RSHVINMLDGDALRRVVELEKPHYIVPEIEAIATDMLIQLEEE-GLNVVPCARATKLTMN
PURT_ECOL5      RSHVINMLDGDALRRVVELEKPHYIVPEIEAIATDMLIQLEEE-GLNVVPCARATKLTMN
PURT_ECO57      RSHVINMLDGDALRRVVELEKPHYIVPEIEAIATDMLIQLEEE-GLNVVPCARATKLTMN
PURT_SHIDS      RSHVINMLDGDALRRVVELEKPHYIVPEIEAIATDMLIQLEEE-GLNVVPCARATKLTMN
PURT_SHIFL      RSHVINMLDGDALRRVVELEKPHYIVPEIEAIATDMLIQLEEE-GLNVVPCARATKLTMN
PURT_SHIF8      RSHVINMLDGDALRRVVELEKPHYIVPEIEAIATDMLIQLEEE-GLNVVPCARATKLTMN
PURT_SALPA      RSHVINMLDGEALRHVITEEKPHYIVPEIEAIATDTLRELEGE-GLNVVPCARATQLTMN
PURT_SALTI      RSHVINMLDGEALRHVITEEKPHYIVPEIEAIATDTLRELEGE-GLNVVPCARATQLTMN
PURT_SALCH      RSHVINMLDGEALRHVITEEKPHYIVPEIEAIATDTLRELEDE-GLNVVPCARATQLTMN
PURT_SALTY      RSHVINMLDGEALRHVITEEKPHYIVPEIEAIATDTLRELEGE-GLNVVPCARATQLTMN
PURT_CROS8      RSHVINMLDGAALKKLVAQEMPDFIVPEIEAIATDALVELEQQ-GQRVVPTARAARLTMN
PURT_YERPE      RSHVINMLDGAALKQLVAQEKPHYIVPEIEAIATDMLVELEKM-GQHVVPCAEATRLTMN
PURT_YERPA      RSHVINMLDGAALKQLVAQEKPHYIVPEIEAIATDMLVELEKM-GQHVVPCAEATRLTMN
PURT_YERPN      RSHVINMLDGAALKQLVAQEKPHYIVPEIEAIATDMLVELEKM-GQHVVPCAEATRLTMN
PURT_YERPP      RSHVINMLDGAALKQLVAQEKPHYIVPEIEAIATDMLVELEKM-GQHVVPCAEATRLTMN
PURT_YERPS      RSHVINMLDGAALKQLVAQEKPHYIVPEIEAIATDMLVELEKM-GQHVVPCAEATRLTMN
PURT_YERE8      RSHVINMLDGAALKRLVAQEKPHYIVPEIEAIATDMLVELENM-GQKVVPCAQATRLTMN
PURT_PECAS      RSHVINMLDGDALKALVEAERPDYIVPEIEAIATDMLVTLENQ-GHHVVPCAEATRLTMN
PURT_SODGM      RHHVINMLDGAALRAVIEHERPHFIVPEIEAIATDMLVTLEQE-GHHVVPCANATRLTMN
PURT_WIGBR      RHHVIDMLNPKEIKRCINLEHPDFIVPEIEAISTNALIELEKN-GYNIVPSAKTIHITMN
PURT_AERHH      KAHVLDMLDGAALRALVNEVKPDLIIPELEAIATDTLAALEQE-GVKVVPNARATQLTMN
PURT_AERS4      KAHVLDMLDGNALRALVTLVKPDLIIPEIEAIATDTLAQLEQE-GVKVVPNARATQLTMN
PURT_PSYIN      SSHVVSMLDGEKLATIIRAEKPDFIIPEVEAIATDTLLALEAE-GFNVVPTARAAKLTMD
PURT_VIBCB      RSYVIDMLDGQALEEIINKEQPAYVVPEIEAIATDKLVELEEQ-GLNVVPTAKATKLTMN
PURT_VIBPA      RSYVLDMLDGKALEEIINKEQPAYVVPEIEAIATDKLVDLEEK-GLNVVPTAKATKLTMN
PURT_VIBVU      RSYVFDMLDASELEKVIAAEQPAFVVPEIEAIATDKLVELEEQ-GLNVVPSAKATKLTMN
PURT_VIBVY      RSYVFDMLDASELEKVIAAEQPAFVVPEIEAIATDKLVELEEQ-GLNVVPSAKATKLTMN
PURT_VIBCH      RSHVFDMLDADALQQVIDLEKPHFVVPEIEAIATSKLVELEAQ-GLNVVPTANATRLTMN
PURT_ALIF1      RSYAIDMLDANALEEVINKEQPDFVVPEIEAIATDKLVELEKQ-GLNVVPTANATKLTMN
PURT_PHOPR      RSHVIDMLDGDALRKLIELEQPHYVVPEIEAIATDTLVSLEAE-GVNIVPTANATKLTMN
PURT_SHEB5      RSHVINMLDANALRAVIELEKPHLVIPEIEAIATQTLVDMEAE-GVNIIPTARATKLTMD
PURT_SHEB8      RSHVINMLDANALRAVIELEKPHLVIPEIEAIATQTLVDMEAE-GVNIIPTARATKLTMD
PURT_SHEPC      RSHVINMLDAKALRAIIELEKPHLVIPEIEAIATQTLVEMEAE-GVNIIPTARATKLTMD
PURT_SHESW      RSHVINMLDAKALRAIIELEKPHLVIPEIEAIATQTLVEMEAE-GVNIIPTARATKLTMD
PURT_SHESM      RSHVINMLDAKALRAIIELEKPHLVIPEIEAIATQTLVEMEAE-GLNVVPTARATQLTMD
PURT_SHESR      RSHVINMLDAKALRAIIELEKPHLVIPEIEAIATQTLVEMEAE-GLNVVPTARATQLTMD
PURT_SHESA      RSHVINMLDAKALRAIIELEKPHLVIPEIEAIATQTLVEMETE-GLNVVPTARATQLTMD
PURT_SHEON      RSHVINMLDAKALRAVIELEKPHLVIPEIEAIATQTLVEMEAE-GLNVVPTARATKLTMD
PURT_SHEFN      RFHVINMLDAKALKAVIELEKPDLVIPEIEAIATQTLVELEQQ-GLHVVPTANAAKLTMD
PURT_SHEAM      RSHVINMLDGEALKALIASEKPHLVIPEIEAIATQTLVELEAE-GLKVVPTARATRLTMD
PURT_PSEAE      RSHVISMLDGAALRAVIEQEKPHYIVPEIEAIATATLVELEAE-GYTVVPTARAAQLTMN
PURT_PSEAB      RSHVISMLDGAALRAVIEQEKPHYIVPEIEAIATATLVELEAE-GYTVVPTARAAQLTMN
PURT_AZOSB      RNHVISMLDGAALRAVIEQEKPHYIVPEIEAIATATLVELEAE-GYTVIPTARAAQLTMN
PURT_PSEE4      RSHVINMLDGVALRAVIEAEKPHYIVPEIEAIATATLVELENE-GFNVVPTARATQLTMN
PURT_PSEPK      RSHVVNMLDGVALRAVIEAEKPHYIVPEIEAIATATLVELENE-GFTVVPTARATQLTMN
PURT_PSEF5      RSHVINMLDGAALRAVIEAEKPHFIVPEIEAIATATLVELEAE-GFTVIPTARATSLTMN
PURT_PSEPF      RSHVINMLDGAALRAVIEAEKPHFIVPEIEAIATATLVALEAE-GFTVIPTARAAQLTMN
PURT_PSE14      RSHVINMLDGAALRAVIEAEKPDFIVPEIEAIATATLVELEAE-GFTVIPTARAAQLTMN
PURT_PSEU2      RSHVINMLDGAALRAVIEAEKPHFIVPEIEAIATATLVELEAE-GFTVIPTARAAQLTMN
PURT_PSESM      RSHVINMLDGAALRAVIELEKPHFIVPEIEAIATATLVELEAE-GFTVIPTARAAQLTMN
PURT_PSEU5      RSHVLDMLDGAALRAVIEQERPHYIVPEIEAIATATLVELERE-GYTVIPTARAAQLTMN
PURT_XANAC      RSHVLDMLDPIALRTLIANERPHLIVPEIEAIHTEALVALEREQGQKVIPTARAARLTMD
PURT_XANC5      RSHVLDMLDPAALRALIASEQPHLIVPEIEAIHTETLVALEREQGQKVIPTARAARLTMD
PURT_XANOR      RSHVLDMLDPAALRVLIASERPHVIVPEIEAIHTETLVALEREQGQKVIPAARAARLTMD
PURT_XANOM      RSHVLDMLDPAALRVLIASERPHVIVPEIEAIHTETLVALEREQGQKVIPAARAARLTMD
PURT_XANCP      RSHVLDMLDPQALRALIAQEQPHLIVPEIEAIHTETLVALEHEQGQKVIPTARAARLTMD
PURT_XANC8      RSHVLDMLDPQALRALIAQEQPHLIVPEIEAIHTETLVALEHEQGQKVIPTARAARLTMD
PURT_ALCBS      HSHVINMLDGTALRAVVEQVKPALIVPEIEAIATDELVKLEAE-GYTVVPTARAAQLTMN
PURT_MARHV      RSHVVDMLDPVALRSVIEKERPNLIVPEIEAIATPELVKLEQE-GYRVIPSARAVNLTMN
PURT_DESVH      RSHVVSMLDGAALRAIIEAEKPYCIVPEIEAIATGTLLELEQE-GYRVVPTARAARLTMD
PURT_DESVV      RSHVVSMLDGAALRAIIEAEKPYCIVPEIEAIATGTLLELEQE-GYRVVPTARAARLTMD
PURT_DESAG      RSHVISMLDADALRRLIAEERPDFVVPEIEAIATDVLEELESD-SLTVVPTARAARLTMN
PURT_ACTP2      RAYTISMLDGAALRALVEKEKPDFIVPEVEAIATATLVELEQE-GYNVVPTAKATQLTMN
PURT_HAEDU      RAYTISMLDDDALRAVVEQEKPDFIVPEVEAIATETLVELEQK-GYQVVPTAKATQLTMN
PURT_MANSM      RSYTISMLDGEALKALVEKERPDYIVPEVEAIATATLVELEQK-GFTVVPTAKATQLTMN
PURT_PASMU      RAYTISMLDGEALKALVEKEKPDYIVPEVEAIATATLVELEQA-GFTVIPTAKATQLTMN
PURT_HAES1      RSYTISMLDGNALKALIEKEKPDYIVPEVEAIATSTLVELEQA-GFNVVPTAKATQLTMN
PURT_PARD8      RSYVVSMLDGDALREIIEKEKPDYIVPEVEAIATRTLMELEEE-GYHVIPTARATWLTMN
PURT_HYDCU      RSYTLSMLDGEALRHIIEKEKPDYIVPEIEAIATDTLAKLEQE-GFNIVPSAKATQLTMN
PURT_HAHCH      RAHVIDMLDPKQLRALIELERPDFIIPEIEAIATAELLELERS-GFNVVPSARAANLTMN
PURT_POLNA      HARTITMSDPAQLKALIEQEKPDLVVPEIEAIATGMLEELEAAGTVRVIPTARAARLTMD
PURT_POLSJ      HARTITMSDPAQLKSLIEKERPHLVVPEIEAIATAMLEELEAAGTVRVIPTARAARLTMD
PURT_RHOFT      HTRTITMSDPALLKALIQAEKPDLVVPEIEAIATPMLEVLEATGVVRVIPTARAARLTMD
PURT_CUPNH      HARTIAMSDPDQLKALIEAEKPHLVVPEIEAIATPMLETLEAAGTVRVIPTARAARLTMD
PURT_CUPPJ      HARTIAMSDPEQLKALIEAEKPQLVVPEIEAIATPMLESLEAAGVVRVIPTARAARLTMD
PURT_CUPMC      HARTITMSDGEQLKALIEAERPDLVVPEIEAIATPMLEALEAAGVVRVIPTARAARLTMD
PURT_ACIAC      HARTITMSDPAQLKALIEAERPHLVVPEIEAIATPMLEELEAAGTVRVIPTARAARLTMD
PURT_MYCS2      HARTIAMSDPDQLRALIEAERPDLVVPEIEAIATPVLEALEAEGVTTVIPTARATRLTMD
PURT_MYCVP      HARTIAMTDPDQLRALIEAERPDLVVPEIEAIATPALEALEAEGVTTVIPTARAARLTMD
PURT_BORBR      RAHVVSMTDPQALRQVIEQERPHVVVPEIEAIATDLLVALEDEGAVRVTPTARAAHLTMN
PURT_BORPA      RAHVVSMTDPQALRQVIEQERPHVVVPEIEAIATDLLVALEDEGAVRVTPTARAAHLTMN
PURT_BORPE      RAHVVSMTDPQALRQVIEQERPHVVVPEIEAIATDLLVALEDEGAVHVTPTARAAHLTMN
PURT_BORA1      RAHVVSMTDPAALRAVIEQERPHIIVPEIEAIATDLLVELEQEGVARVTPTARAARLTMN
PURT_BURCA      RAHVIDMTDPAALRAIVEAERPHLIVPEIEAIATDALAAIEAAGLAEVIPTARATQLTMN
PURT_BURCH      RAHVIDMTDPAALRAIVEAERPHLIVPEIEAIATDALAAIEAAGLAEVIPTARATQLTMN
PURT_BURL3      RAHVIDMTDAAALRAIVEAERPHLIVPEIEAIATDALAAIEAAGLAEVIPTARATQLTMN
PURT_BURCM      RAHVIDMTDAAALRAVVEAERPHLIVPEIEAIATDALAAIEAAGLAEVIPTARATQLTMN
PURT_BURVG      RAHVIDMTDAAALRALVEAERPHLIVPEIEAIATDALAAIEAAGLAEVIPTARATQLTMN
PURT_BURMA      RAHVIDMTDPDALRALVDAERPHLVVPEIEAIATDALAAIEAAGVCEVIPTARATQLTMN
PURT_BURM9      RAHVIDMTDPDALRALVDAERPHLVVPEIEAIATDALAAIEAAGVCEVIPTARATQLTMN
PURT_BURM7      RAHVIDMTDPDALRALVDAERPHLVVPEIEAIATDALAAIEAAGVCEVIPTARATQLTMN
PURT_BURMS      RAHVIDMTDPDALRALVDAERPHLVVPEIEAIATDALAAIEAAGVCEVIPTARATQLTMN
PURT_BURPS      RAHVIDMTDPDALRALVDAERPHLVVPEIEAIATDALAAIEAAGVCEVIPTARATQLTMN
PURT_BURP0      RAHVIDMTDPDALRALVDAERPHLVVPEIEAIATDALAAIEAAGVCEVIPTARATQLTMN
PURT_BURP1      RAHVIDMTDPDALRALVDAERPHLVVPEIEAIATDALAAIEAAGVCEVIPTARATQLTMN
PURT_BURP6      RAHVIDMTDPDALRALVDAERPHLVVPEIEAIATDALAAIEAAGVCEVIPTARATQLTMN
PURT_BURTA      RAHVIDMTDPDALRALVDAERAHLVVPEIEAIATDALAEIEAAGVAEVIPTARATQLTMN
PURT_PARXL      RAHVIDMTDRAALRALVEQERPHLIVPEIEAIATDELAAIESAGLAEVIPTARATQLTMN
PURT_DECAR      RAHVISMTDGAALRQLVEQEKPHLIVPEIEAIATDMLVEIEAAGLAEVIPTARAAKLTMN
PURT_THIDA      RAHVIDMTDGAALRALIEAEKPLLVVPEIEAIATEALLEIERAGLAEVIPTARAVNLTMN
PURT_METFK      RAYAIDMTDPVALRELIDKENPHLIVPEIEALNTQLLAEVELAGHTRVVPTVKAVQLTMN
PURT_HERAR      RAYVIDMTDGVALAALINQEKPDLVVPEIEAIATATLLEMENAGNVRVIPTARAAWLTMD
PURT_JANMA      RSYVIDMTDEVALAELINQEKPDLIVPEIEAIATAKLVELENAGTIRVIPTARAAWLTMD
PURT_RHOJR      RAHTIDMSDPEALLRLVEEERPHFVVPEIEAIATDALATVEERGTAVVIPTARATQLTMN
PURT_METCA      RSHVVDMTDPGAIHRLVEFERPHFVVPEIEAIATDALVEIERAGLAEVVPNARAVQLTMN
PURT_CORGL      FSYVIDMTDAAQVRELVERVRPDFVIPEIEALATDELVKIEEEGLATIVPTARAAKLTMN
PURT_CORGB      FSYVIDMTDAAQVRELVERVRPDFVIPEIEALATDELVKIEEEGLATIVPTARAAKLTMN
PURT_COREF      FSYVIDMTDAAAVRELVTTIKPDFIIPEIEALATDELVRIEQEGLATVVPTARATQLTMN
PURT_CORJK      KAHVLDIHDEDAIRQLVREVGPHFVIPDSETIPAEVLQEIETNEVASVVPTALANRLTMN
PURT_ACIBT      FSYVLNMADPAQLKQLIEKVKPNLIVPEIEAIATEVLLEIEANKTATVIPSAKAVNLTMN
PURT_ACIAD      YSYTLNMADPVELKKLIESIQPDLIVPEIEAIATEVLIEVENNKLATVIPSAKAVNLTMN
PURT_GEOMG      RAHVVNMLDRVELGRIVARERPHLIVPEIEAIDTPYLLELEQE-GYTVIPTARAANLTMN
PURT_PELPD      RSHVISMQDREELKRVIGLERPDLIVPEIEAIDTEFLLELEQG-GQRVIPTARATNLTMN
PURT_PELCD      RSHVANMLDRDALERIIKQESPDLIVPEIEAINTTFLLELEQQ-GFRIIPTARATNLTMN
PURT_FRATF      ESYVIDMLNSDALEQLILAKNPTYIVPEIEAINTDSLVKLEAH-NFNIIPCAKATKLTMD
PURT_FRATH      ESYVIDMLNSDALEQLILAKNPTYIVPEIEAINTDSLVKLEAH-NFNIIPCAKATKLTMD
PURT_FRATO      ESYVIDMLNSDALEQLILAKNPTYIVPEIEAINTDSLVKLEAH-NFNIIPCAKATKLTMD
PURT_FRATT      ESYVIDMLNSDALEQLILAKNPTYIVPEIEAINTDSLVKLEAH-NFNIIPCAKAAKLTMD
PURT_FRAT1      ESYVIDMLNSDALEQLILAKNPTYIVPEIEAINTDSLVKLEAH-NFNIIPCAKAAKLTMD
PURT_FRATW      ESYVIDMLNSDALEQLILAKNPTYIVPEIEAINTDSLVKLEAH-NFNIIPCAKATKLTMD
PURT_FRATN      ESYVIDMLNADALEQLILAKNPTYIVPEIEAINTDSLVKLEAH-NFNIIPCAKATKLTMD
PURT_NOSS1      CCEVISMLSADDLEAVVTKYEPDFIIPEIEAIRTEKLQEFEDR-GITVIPTAAATNYTMN
PURT_TRIV2      FCEVISMLSADDLEAVVTKYQPDFIIPEIEAIRTEKLQEFEDR-GITVIPTAAATNYTMN
PURT_SYNP6      ASAVISMLDGEALEAVVQEFQPDLIIPEIEAIRTEKLQEFEDR-GLTVIPTARATHFTMN
PURT_SYNE7      ASAVISMLDGEALEAVVQEFQPDLIIPEIEAIRTEKLQEFEDR-GLTVIPTARATHFTMN
PURT_SYNY3      VAEVISMLDGNALEAVVKKYQPDWIVPEVEAIRTEKLLELEAG-GYRVIPTAQATNLTMN
PURT_PROM3      QAEVLDMNNSEALTAIIRHHQPDVVIPEIEALAVNALAELENE-GITVIPTARATAVTMN
PURT_PROMM      QAEVLDMNNSEALTAIIRHHQPDVVIPEIEALAVNALAELENE-GITVIPTARATAITMN
PURT_SYNSC      VAEVLPMTDADALLEVVRRHQPDVVIPEIEALAVHALAELEQE-GITVIPTARATAVTMN
PURT_SYNPX      QAEVLAMTDTDALLATVRRHRPDVVIPEIEALAVSALAELEQD-GITVIPTARATAVTMN
PURT_SYNS9      TAEVFQMTDATALKEVVQRHRPDVVIPEIEALAVEALAELEQD-GITVIPTARATAFTMN
PURT_SYNPW      EAEVLAMTDREALLEVVRRHKPTVVIPEIEALAVNALAELEDE-GLTVIPTARATAVTMN
PURT_SYNS3      QAEVLTMTDPNALKTVVNKHQPDVLIPEIEALAVDALQALEDT-GICVIPTARATAVTMN
PURT_SYNR3      TAVVIPMTDAEALKQVIREHQPALVIPEIEALAVDALAELEAE-GITVIPTARATAITMN
PURT_PROM1      QFNVFNMNNGSELKEVIYKCNPDIIIPEIEALAVDVLKEIEQK--ITVIPNSRATATTMN
PURT_PROMT      QFNVFNMNNGSELKEVIYKCNPDIIIPEIEALAVDVLKEIEQK--ITVIPNSRATAITMN
PURT_PROMA      LAIVLDMNNHNSLQKTIRDYKPDVVIPEIEALAVEALKDIEKE-GINVIPNARATAITMN
PURT_PROMS      YSRVIEMGDKNILKNVIKEFKPDYVVPEIEALSIEALKELEDE-GFNIVPNARTVEITMN
PURT_PROM0      YSRVIDMGDKNILKNVIKEFNPDYVVPEIEALSIEALKELEDE-GFNIVPNARTVEITMN
PURT_PROM9      YSKVIDMGDKNILKNSIKEFTPDFVVPEIEALSIEALKELEDE-GFKIVPNARTVEITMN
PURT_PROM5      HSFVINMNDKKTLINTIKKIEPDFVVPEIEALSIEALKELEEE-GINIVPNARTVEITMN
PURT_PROMP      NSFVIDMSDKEILKKKIKELNPDFVVPEIEALSIEALKELEDE-GINIVPNARTVEITMN
PURT_BACFR      ECEVFDMLNGEELERIVKKHRPDIIVPEIEAIRTERLYDFEKE-GIQVVPSARAVNYTMN
PURT_BACFN      ECEVFDMLNGEELERIVKKHRPDIIVPEIEAIRTERLYDFEKE-GIQVVPSARAVNYTMN
PURT_BACTN      EFEVFDMLDGEALERVVEKHHPDIIVPEIEAIRTERLYDFEKE-GIQVVPSARAVNFTMN
PURT_BACV8      EFEVFSMLDGDALDAVVAKHKPDIIVPEIEAIRTERLYHLEQE-GIQVVPSARAVNFTMN
PURT_CHLPD      RREVINMLDGAALDAIVARHQPDVIVPEIEAIRTERFYDYEKE-GIQVVPSARAANFTMN
PURT_CHLTE      RREVIDMLDGRALDAIVAKHRPDIIVPEIEAIRTERFYDYEKQ-GIQVVPSARAANFTMN
PURT_LEPBJ      EKEIINMLDGNLLDQVVKKHKPDLIVPEIEAIRTERFYEYEKQ-GYQIVPSAKAANFTMN
PURT_LEPBL      EKEIINMLDGNLLDQVVKKHKPDLIVPEIEAIRTERFYEYEKQ-GYQIVPSAKAANFTMN
PURT_LEPIN      EKEIINMLDGNLLDQIIAKHKPDLIVPEIEAIKTERFYEYEKQ-GYQVVPSAKAANFTMN
PURT_LEPIC      EKEIINMLDGNLLDQIIAKHKPDLIVPEIEAIKTERFYEYEKQ-GYQVVPSAKAANFTMN
PURT_FLAPJ      QFEVINMLDGSELDRIVAKHQPDFIVPEIEAIRTERFYEYEKQ-GITVVPSAKAANFTMN
PURT_ANADE      AREVVSMLDGAALDALVAKHRPDVIVPEIEAIRTERLQAYEAQ-GVQVVPSARAAAFTMN
PURT_ERYLH      ASEVLSMLDADALRAVVAKHHPDYVVPEIEAIRTEVLAEIEAD-GFNVVPSAYATQMTMN
PURT_BIFAA      EYRVLDMANADQLRALFDEIQPDIIVPEVEAIATSELAAAAAR-GAQVVPSAEIAAICMD
PURT_BIFLO      EYRALDMANAAELQALFDEIKPDIIVPEVEAIATDVLAGTAAA-GAQVVPSAEIAAICMD
PURT_SULAC      RKYVVNMHDGGAIESIIRKERPDAVIAEIEAINTETLSKIEMD-GIKVMPNARAVKICMD
PURT_SULTO      RKYVVNMLDGNAIKSIIKKENPDAIITEIEAINTDALLELESE-GYKVIPNAKAVKICMN
PURT_SACS2      RKYVVDMMNPNAIKAVVKRERPDAIIAEIEAINTDALIELESN-GFRVVPNANAVKACMN
PURT_IGNH4      RRYVIDMLDYDQVVDVVRRERPDVIIPEVEAINTDALVDLEKE-GYFVVPNARAVKITMN
PURT_PYRAB      RSYVGNMMDKDFLWSVVEREKPDAIIPEIEAINLDALFEFEKE-GYFVVPNARATWIAMH
PURT_PYRFU      RSYVGNMMDKDFLWSVVEREKPDAIIPEIEAINLDALFEFEKE-GYFVVPNAKATWIAMH
PURT_PYRHO      RSYVGNMMDKDFLWSVVEREKPDAIIPEIEAINLDALFEFEKD-GYFVVPNARATWIAMH
PURT_THEKO      RSYVGDMRKADFLFSVVEREKPDAIIPEIEAINLDALFELEKD-GYFVVPNAKATWIAMH
PURT_METAR      RSYVTNMKSERALLAIVEKEKPDAIIPEIEAINTDTLFKLEKE-GFFVAPCANAVWTAMH
                      : .   :   .    .  ::.: *::    :          : *        *.

PURT_NITSB      RKNIRKFAAEELGLKTSQYRFVSSFEGLQEAARTL------GFPCVIKPVMSSSGHGQSI
PURT_SULDN      RKNIRTFAAEVLELKTGAYEFVTTKEMLVSAAGRL------GFPCVIKPVMSSSGHGQSV
PURT_SULNB      RKNIRVFAAETLDLKTSGYEFVTTLDGLKAAGERI------GFPCVIKPVMSSSGHGQSI
PURT_WOLSU      RKGIRTFAAEEVGVKTSQYRFVKTLDELRSAAEEI------GYPCVIKPVMSSSGHGQSV
PURT_METM5      REGIRRLAFEKLGLRTAKYEFAENLEELKEAVQRI------GIPCIIKPIMSSSGKGQST
PURT_METM7      REGIRRLAFEKLGLRTAKYEFAESLEELKEAVQRI------GIPCVIKPIMSSSGKGQST
PURT_METMP      REGIRRLAFEKLGLRTAKYEFAENLEELKEAVTRI------GIPCIIKPIMSSSGKGQST
PURT_METVS      REGIRRLASEKLGLRTAKYEFADSLDELKEAVKRI------GIPCIIKPIMSSSGKGQST
PURT_META3      REGIRRLASEQLNIPTAKYEFAESLEELKKAVKKI------GAPCIVKPIMSSSGKGQST
PURT_METJA      RELIRRLAAEKLGLKTAKYEFADSLEELRDAVEKL------GLPCVVKPIMSSSGKGQSV
PURT_BACSU      REGIRRLAAETLGLATAGYEFANTYDEFIQAAAQI------GFPCVVKPLMSSSGKGQSV
PURT_BACVZ      REGIRRLAAETLHLPTAGYEFANTYEEFKEAAETI------GFPCVVKPLMSSSGKGQSV
PURT_HALWD      REWIREFAAEEVGVTTNEYAFADNYDTYRKAVEDI------GIPVVVKPTMSSSGKGQSI
PURT_ECOLI      REGIRRLAAEELQLPTSTYRFADSESLFREAVADI------GYPCIVKPVMSSSGKGQTF
PURT_SHISS      REGIRRLAAEELQLPTSTYRFADSESLFREAVADI------GYPCIVKPVMSSSGKGQTF
PURT_SHIBS      REGIRRLAAEELQLPTSTYRFADSESLFREAVADI------GYPCIVKPVMSSSGKGQTF
PURT_ECOUT      REGIRRLAAEELQLPTSTYRFADSENLFREAVAAI------GYPCIVKPVMSSSGKGQTF
PURT_ECOK1      REGIRRLAAEELQLPTSTYRFADSENLFREAVAAI------GYPCIVKPVMSSSGKGQTF
PURT_ECOL5      REGIRRLAAEELQLPTSTYRFADSENLFREAVAAI------GYPCIVKPVMSSSGKGQTF
PURT_ECO57      REGIRRLAAEELQLPTSTYRFADSESLFREAVAAI------GYPCIVKPVMSSSGKGQTF
PURT_SHIDS      REGIRRLAAEELQLPTSTYRFSDSESLFREAVAAI------GYPCIVKPVMSSSGKGQTF
PURT_SHIFL      REGIRRLAAEELQLPTSTYRFADSKSLFREAVAAI------GYPCIVKPVMSSSGKGQTF
PURT_SHIF8      REGIRRLAAEELQLPTSTYRFADSKSLFREAVAAI------GYPCIVKPVMSSSGKGQTF
PURT_SALPA      REGIRRLAAEELGLPTSTYRFADSEASFHDAVAAV------GFPCIVKPVMSSSGKGQSF
PURT_SALTI      REGIRRLAAEELGLPTSTYRFADSEASFHDAVAAV------GFPCIVKPVMSSSGKGQSF
PURT_SALCH      REGIRRLAAEELGLPTSTYRFADSEASFHDAVAAV------GFPCIVKPVMSSSGKGQSF
PURT_SALTY      REGIRRLAAEELGLPTSTYRFADSEASFHDAVAAV------GFPCIVKPVMSSSGKGQSF
PURT_CROS8      REGIRRLAAEELGLPTSAYRFAENEAEFREAVAEI------GLPCIVKPVMSSSGKGQSF
PURT_YERPE      REGIRRLAAETLQLPTSSYRFADTDSAFFQAVRDI------GYPCIVKPVMSSSGKGQSL
PURT_YERPA      REGIRRLAAETLQLPTSSYRFADTDSAFFQAVRDI------GYPCIVKPVMSSSGKGQSL
PURT_YERPN      REGIRRLAAETLQLPTSSYRFADTDSAFFQAVRDI------GYPCIVKPVMSSSGKGQSL
PURT_YERPP      REGIRRLAAETLQLPTSSYRFADTDSAFFQAVRDI------GYPCIVKPVMSSSGKGQSL
PURT_YERPS      REGIRRLAAETLQLPTSSYRFADTDSAFFQAVRDI------GYPCIVKPVMSSSGKGQSL
PURT_YERE8      REGIRLLAAETLQLPTSSYRFADTESAFRQAVSEI------GYPCIVKPVMSSSGKGQSL
PURT_PECAS      REGIRRLAAETLGVPTSTYRFADSEERFHQAVEAI------GYPCIVKPVMSSSGKGQSL
PURT_SODGM      REGIRRLAAETLSLPTSRYRFAADRAELDKAVEAI------GYPFIIKPVMSSSGKGQSL
PURT_WIGBR      RKLIRVLVSKKLNILTSEYQFASSFDELKIKTKVI------GYPCLIKPIMSSSGKGQSV
PURT_AERHH      REGIRRLAAETLGLPTSPYHFAQSKEEFVAAVDTI------GLPCVVKPVMSSSGKGQSV
PURT_AERS4      REGIRRLAAEELGLPTSPYRFAQSKEEFIAAVEAI------GLPCVVKPVMSSSGKGQSV
PURT_PSYIN      REGIRRLAAETLGIKTSPYIFADSKEEYLSAIEKI------GKPCVIKPVMSSSGKGQSI
PURT_VIBCB      REGIRRLAAEELALNTSPYQFADSFEDFKAAVEHV------GIPCVVKPVMSSSGKGQSV
PURT_VIBPA      REGIRRLAAEELDLSTSPYRFADNYDDFKAAVEHV------GIPCVVKPVMSSSGKGQSV
PURT_VIBVU      REGIRRLAAEELGLTTSPYRFADNYQQFVEAVEAV------SIPCVVKPVMSSSGKGQSV
PURT_VIBVY      REGIRRLAAEELGLTTSPYRFADNYQQFVEAVEAV------SIPCVVKPVMSSSGKGQSV
PURT_VIBCH      REGIRRLAAEELGLPTSAYQFADSYESFAAAVETI------GLPCVCKPVMSSSGKGQSV
PURT_ALIF1      REGIRRLAAEELQLPTSPYRFVDSYEELVEAVKFV------GMPCVIKPVMSSSGKGQSV
PURT_PHOPR      REGIRRLAAEDLQIPTSPFEFADQYDDFVAAVERV------GTPCVVKPIMSSSGKGQSV
PURT_SHEB5      REGIRRLAAETLGLPTSPYFFCDTETEFNQAISEI------GVPCVVKPVMSSSGKGQSV
PURT_SHEB8      REGIRRLAAETLGLPTSPYFFCDTETEFNQAISEI------GVPCVVKPVMSSSGKGQSV
PURT_SHEPC      REGIRRLAAETLGLPTSPYFFCDTETEFNQAIREI------GVPCVVKPVMSSSGKGQSV
PURT_SHESW      REGIRRLAAETLGLPTSPYFFCDTETEFNQAIREI------GVPCVVKPVMSSSGKGQSV
PURT_SHESM      REGIRRLAAETLGLPTSPYFFCDTETEFNQAIGKI------GVPCVVKPVMSSSGKGQSV
PURT_SHESR      REGIRRLAAETLGLPTSPYFFCDTETEFNQAIGKI------GVPCVVKPVMSSSGKGQSV
PURT_SHESA      REGIRRLAAETLGLPTSPYFFCDTETEFNQAIGKI------GVPCVVKPVMSSSGKGQSV
PURT_SHEON      REGIRRLAAETLGLPTSPYFFCDTETEFNQAISKI------GVPCVVKPVMSSSGKGQSV
PURT_SHEFN      REGIRRLAAETLAIPTSKYFFCDTLAEFEQAVTDI------GIPCVVKPVMSSSGKGQSV
PURT_SHEAM      REGIRRLAAETLALPTSPYVFCDSLTELQAALKVT------GIPCVVKPVMSSSGKGQSV
PURT_PSEAE      REGIRRLAAEELGLPTSPYHFADTFEDYRRGVERV------GYPCVVKPIMSSSGKGQSV
PURT_PSEAB      REGIRRLAAEELGLPTSPYHFADTFEDYRRGVERV------GYPCVVKPIMSSSGKGQSV
PURT_AZOSB      REGIRRLAAEELGLPTSPYRFADSYEDYAAAVAAL------GFPCVVKPIMSSSGKGQSL
PURT_PSEE4      REGIRRLAAEELDLPTSPYHFADTFEDYSKAVADL------GYPCVVKPVMSSSGKGQSL
PURT_PSEPK      REGIRRLAAEELDLPTSPYHFADTYEDYAKAVADL------GYPCVVKPVMSSSGKGQSL
PURT_PSEF5      REGIRRLAAEELDLPTSPYHFADTFEDYSRAVQDL------GFPCVVKPVMSSSGKGQSL
PURT_PSEPF      REGIRRLAAEELDLPTSPYHFADTFEDYSKAVQDL------GFPCVVKPVMSSSGKGQSL
PURT_PSE14      REGIRRLAAEELKLPTSPYHFADTFEAYSKAVEDL------GFPCVVKPVMSSSGKGQSL
PURT_PSEU2      REGIRRLAAEELKLPTSPYHFADTFEAYSKAVEDL------GFPCVVKPVMSSSGKGQSL
PURT_PSESM      REGIRRLAAEELKLPTSPYHFADTFEAYSKAVEDL------GFPCVVKPVMSSSGKGQSL
PURT_PSEU5      REGIRRLAAEELGLPTSPYRFADTLDECRAAAMAL------GFPCLVKPVMSSSGKGQSV
PURT_XANAC      REGIRRLAAETLGLPTSPYRFVDTVEEYRDAIAAV------GLPCVVKPVMSSSGKGQST
PURT_XANC5      REGIRRLAAETLCLPTSPYRFVDTVEEYRNAIAAV------GVPCVVKPVMSSSGKGQST
PURT_XANOR      REGIRRLAAETLGLPTSPYRFVDTAADYREAIAAV------GLPCVVKPVMSSSGKGQST
PURT_XANOM      REGIRRLAAETLGLPTSPYRFVDTAADYREAIAAV------GLPCVVKPVMSSSGKGQST
PURT_XANCP      REGIRRLAAETLGLPTSPYRFVDTAAEYREAIATV------GLPCVVKPVMSSSGKGQST
PURT_XANC8      REGIRRLAAETLGLPTSPYRFVDTAAEYREAIATV------GLPCVVKPVMSSSGKGQST
PURT_ALCBS      REGIRCLAAEELSLPTSPYRFADSLAGYQQAVREI------GFPCVVKPVMSSSGKGQST
PURT_MARHV      REGIRRLAAEELGLPTSPYRFAGTREEYLQAVAEV------GLPLVVKPVMSSSGKGQST
PURT_DESVH      REGIRRLAAEELGLPTSPYRFASTEEEYRAAIETV------GLPCVVKPVMSSSGKGQSL
PURT_DESVV      REGIRRLAAEELGLPTSPYRFASTEEEYRAAIETV------GLPCVVKPVMSSSGKGQSL
PURT_DESAG      REGIRRLAAEELGLRTSPYRFAQTEDEYRRAVEEL------GMPCVVKPVMSSSGKGQSV
PURT_ACTP2      REGIRRLAAEELGLKTSPYRFVDNLEDFKQAVAEI------GIPCVVKPIMSSSGHGQSV
PURT_HAEDU      REGIRRLAAEELGLPTSPYRFVDNFADFQQAVLAV------GVPCVVKPIMSSSGHGQSI
PURT_MANSM      REGIRRLAAEELGLPTSNYQFVDNFTDFKSAVENI------GIPCVVKPIMSSSGHGQSI
PURT_PASMU      REGIRRLAAEELGLPTSNYQFVDNFDDFKRAVEKI------GIPCVVKPIMSSSGHGQSI
PURT_HAES1      REGIRRLAAEKLKLPTSNYQFVDNFDDFQSAVENL------GIPCVIKPIMSSSGHGQSI
PURT_PARD8      REGIRRLAAEELGLPTSPYRFAETEEEFKEAVKVI------GMPCVVKPIMSSSGHGQSV
PURT_HYDCU      REGIRRLAAEDLGIPTSPYAFADNKEDFTAAVDAI------GIPCVVKPIMSSSGKGQSV
PURT_HAHCH      REGIRRLAAEELGLSTSPYAFAADFESFRDAVSSI------GVPCVVKPIMSSSGKGQSV
PURT_POLNA      REGIRRLAAETLALPTSPYVFCDSLEELQTAIDSK-----IGYPCVVKPVMSSSGKGQSK
PURT_POLSJ      REGIRRLAAETLGLPTSPYVFCDSLQELQAAIDTN-----IGYPCIVKPVMSSSGKGQSK
PURT_RHOFT      REGIRRLAAETLGLPTSPYQFCDSFEELQAAIEGG-----IGYPCIVKPVMSSSGKGQSK
PURT_CUPNH      REGIRRLAAESLGLPTSPYKFCDSLDELQAAIDGG-----IGYPCVVKPVMSSSGKGQSK
PURT_CUPPJ      REGIRRLAAETLGLPTSPYKFCDSLEELQTAIDGG-----IGYPCVVKPVMSSSGKGQSK
PURT_CUPMC      REGIRRLAAETLGLPTSPYKFCDSLEELQAAIDGG-----IGYPCVVKPVMSSSGKGQSK
PURT_ACIAC      REGIRRLAAETLGLPTSPYRFCDSAEELQAAIDGTDGQPAIGFPCVVKPVMSSSGKGQSK
PURT_MYCS2      REGIRRLAAETLGVPTSPYRFCDSLAELQAAIDDE-----IGYPCVVKPVMSSSGKGQSK
PURT_MYCVP      REGIRRLAAETLGLPTSPYRFCDSLEELTAAIEGG-----IGYPCVVKPVMSSSGKGQSK
PURT_BORBR      REGIRRLAAETLGLPTSPYRFVDTEQALREAIDGG-----IGYPCVIKPVMSSSGKGQSI
PURT_BORPA      REGIHRLAAETLGLPTSPYRFVDTEQALREAIDGG-----IGYPCVIKPVMSSSGKGQSI
PURT_BORPE      REGIRRLAAETLGLPTSPYRFVDTEQALREAIDGG-----IGYPCVIKPVMSSSGKGQSI
PURT_BORA1      REGIRRLAAETLGLPTSPYQFVDTQDALQQAIDGG-----IGYPCVIKPVMSSSGKGQSV
PURT_BURCA      REGIRRLAAEELGLPTSPYAFADSFEAFSAAV-AK-----IGMPCVVKPVMSSSGKGQSV
PURT_BURCH      REGIRRLAAEELGLPTSPYAFADSFEAFSAAV-AK-----IGMPCVVKPVMSSSGKGQSV
PURT_BURL3      REGIRRLAAEELGLPTSPYAFADSFEAFSAAI-AK-----IGMPCVVKPVMSSSGKGQSV
PURT_BURCM      REGIRRLAAEELGLATSPYAFADSFDAFSAAV-AK-----IGMPCVVKPVMSSSGKGQSV
PURT_BURVG      REGIRRLAAEELGLATSPYAFADSFDAFSAAV-AK-----IGMPCVVKPVMSSSGKGQSV
PURT_BURMA      REGIRRLAAEELGLPTSPYAFAQSFDEFAAAV-AR-----IGFPCVVKPVMSSSGKGQSV
PURT_BURM9      REGIRRLAAEELGLPTSPYAFAQSFDEFAAAV-AR-----IGFPCVVKPVMSSSGKGQSV
PURT_BURM7      REGIRRLAAEELGLPTSPYAFAQSFDEFAAAV-AR-----IGFPCVVKPVMSSSGKGQSV
PURT_BURMS      REGIRRLAAEELGLPTSPYAFAQSFDEFAAAV-AR-----IGFPCVVKPVMSSSGKGQSV
PURT_BURPS      REGIRRLAAEELGLPTSPYAFAQSFDEFAAAV-AR-----IGFPCVVKPVMSSSGKGQSV
PURT_BURP0      REGIRRLAAEELGLPTSPYAFAQSFDEFAAAV-AR-----IGFPCVVKPVMSSSGKGQSV
PURT_BURP1      REGIRRLAAEELGLPTSPYAFAQSFDEFAAAV-AR-----IGFPCVVKPVMSSSGKGQSV
PURT_BURP6      REGIRRLAAEELGLPTSPYAFAQSFDEFAAAV-AR-----IGFPCVVKPVMSSSGKGQSV
PURT_BURTA      REGIRRLAAEELGLPTSPYAFAQSFDAFRAAV-AQ-----IGFPCVVKPVMSSSGKGQSV
PURT_PARXL      REGIRRLAAEELGLPTSPYAFADSLDELRAGI-AK-----VGYPCVVKPVMSSSGKGQSV
PURT_DECAR      REGIRRLAAEELGLPTSPYKFADSLAELQAAIDGG-----IGYPCIVKPTMSSSGKGQSL
PURT_THIDA      REGIRRLAAETLGLPTSPYAFVDSYAEMCAAA-ER-----LGYPVIVKPVMSSSGKGQSR
PURT_METFK      REGIRRLAAEELKLPTSPYAFADSEQSLRTAIESG-----IGYPCFIKPTMSSSGKGQSR
PURT_HERAR      REGIRRLAAEELGVATSPYRFADSLKELKAGCAD------IGYPCVVKPVMSSSGKGQSK
PURT_JANMA      REGIRRLAAEELGCATSPYRFADNLKELQAGCAE------IGFPCIVKPVMSSSGKGQSK
PURT_RHOJR      REGIRRLAAEELGLPTSPYEFAESLEEVRAATER------IGFPCVIKPVMSSSGKGQST
PURT_METCA      REGIRRLAAEKLGLPTSPYAFADSCAALAEAAAK------IGFPCFVKPVMSSSGKGQSL
PURT_CORGL      REGIRKLAAEELGLPTSNYEFCSTFEEFSAAAEKL------GYPNVVKPVMSSSGKGQSV
PURT_CORGB      REGIRKLAAEELGLPTSNYEFCSTFEEFSAAAEKL------GYPNVVKPVMSSSGKGQSV
PURT_COREF      REGIRRLASEELGLPTSGYEFCSTFEEFTAAAERL------GYPNVVKPVMSSSGKGQSV
PURT_CORJK      REGIRTFAHDKLGLPNSTFRFASTADELARAAEEI------GYPCVVKPVMSSSGAGQSY
PURT_ACIBT      REGIRRLAAEELGLPTSAYRFADTLESFRAACDDI------GYPNFVKPVMSSSGKGQSR
PURT_ACIAD      REGIRRLAAEELGLPTSAYRFADSLESFRAACDDI------GYPNFVKPVMSSSGKGQSR
PURT_GEOMG      REGIRRLAAEELGLPTAAYRFAASIESFRAAVKDI------GLPCVVKPIMSSSGKGQSV
PURT_PELPD      REGIRRLAAEELGLPTARYAFAASLEEMRGHVAQI------GCPCVIKPIMSSSGKGQSV
PURT_PELCD      REGIRRLAAEDLNLPTAAYRFASSYEEFCQAVEEI------GLPCVIKPIMSSSGKGQST
PURT_FRATF      RQGIRALAVQQLNLQTSKFAFANSEQEYLDVIQSI------GLPFVIKPVMSSSGKGQSI
PURT_FRATH      RQGIRALAVQQLNLQTSKFAFANSEQEYLDVIQSI------GLPFVIKPVMSSSGKGQSI
PURT_FRATO      RQGIRALAVQQLNLQTSKFAFANSEQEYLDVIQSI------GLPFVIKPVMSSSGKGQSI
PURT_FRATT      RQGIRALAAQQLNLQTSKFAFANSEQEYLDVIQSI------GLPFVIKPVMSSSGKGQSI
PURT_FRAT1      RQGIRALAAQQLNLQTSKFAFANSEQEYLDVIQSI------GLPFVIKPVMSSSGKGQSI
PURT_FRATW      RQGIRALAAQQLNLQTSKFAFANSEQEYLDVIQSI------GLPFVIKPVMSSSGKGQSI
PURT_FRATN      RQGIRALAAQQLNLQTSKFAFANSEQEYLDVIQSI------GLPFVIKPVMSSSGKGQSI
PURT_NOSS1      RDRIRELAHEELGIRTAKYGYAVTLEELIAVSDNI------GFPNVVKPVMSSSGKGQSV
PURT_TRIV2      RDRIRELAHEELGIRTAKYGYAITLEELIAVSDEI------GFPNVVKPVMSSSGKGQSV
PURT_SYNP6      RDRIRDLAAQQLGLRTARYAYASCFEELQTVAAAI------GYPNVIKPVMSSSGKGQSI
PURT_SYNE7      RDRIRDLAAQQLGLRTARYAYASCFEELQTVAAAI------GYPNVIKPVMSSSGKGQSI
PURT_SYNY3      RDRIRELAAQQLGVRTARYNYATSLAELEEVSQAI------GFPNVVKPVMSSSGKGQSV
PURT_PROM3      RDRIRDLASEELALLTPKFAYAGSAEELRHAAEPL------GWPVVVKPVMSSSGKGQSV
PURT_PROMM      RDRIRDLASAELALLTPKFAYAGSAEELKHAAEPL------GWPVVVKPVMSSSGKGQSV
PURT_SYNSC      RDRIRDLAAGELNLRTARFAYASSAEELKAVAEPL------GWPVVVKPVMSSSGKGQSV
PURT_SYNPX      RDRIRDLAAGELALRSARFAYAASAEELRAEAPAL------GWPVVVKPVMSSSGKGQSV
PURT_SYNS9      RDQIRDLASGELGLHTARFAYASNAAELKKVAAPL------GWPVVVKPVMSSSGKGQSV
PURT_SYNPW      RDRIRDLAAGELALRTARFAYAASAEELHAEAPAL------GWPVVVKPVMSSSGKGQSV
PURT_SYNS3      RDRIRNLAAGELGLRTARFAYASDAQELQRAAAPL------GWPVVVKPVMSSSGKGQSV
PURT_SYNR3      RDRIRDLAAGELGLRTARFGYASSAEELSSAAEPL------GWPVVVKPVMSSSGKGQSV
PURT_PROM1      RDKIRDLASNELNIRTAKFSYAVNQSELDLHAETI------GYPLLIKPVMSSSGKGQSL
PURT_PROMT      RDKIRDLASNELNIRTAKFSYAVNQSELDLHAETI------GYPLLIKPVMSSSGKGQSL
PURT_PROMA      RDQIRNLAAEKLAIKTANYGYASNIEELKEVSKKV------GFPLLVKPVMSSSGKGQSL
PURT_PROMS      RDKIRDLASKDLKIKTAKFDYIFEFDDLEKKADEI------GFPLLLKPLMSSSGKGQSL
PURT_PROM0      RDKIRDLASKDLKIKTAKFDYIFEFDDLEKKADEI------GFPLLLKPLMSSSGKGQSL
PURT_PROM9      RDKIRELVSRDLKIKTANYDYIYKFEDLEKKADEI------GFPLLLKPLMSSSGKGQSL
PURT_PROM5      RHKIRDLASKELNIKTANFSYVFNAEELEMKSSEI------GFPLLLKPLMSSSGKGQSL
PURT_PROMP      RDKIRDLASKELNIKTAKFSYVFNVDELEIKSSEI------GFPLLIKPLMSSSGKGQSL
PURT_BACFR      RKAIRDLAAKELGLKTAKYYYAKSLEELKEAAEII------GFPCVVKPLMSSSGKGQSL
PURT_BACFN      RKAIRDLAAKELGLKTAKYYYAKSLEELKEAAEKI------GFPCVVKPLMSSSGKGQSL
PURT_BACTN      RKAIRDLAAKELGLKTANYFYAKTLDELKEAAAKI------GFPCVVKPLMSSSGKGQSL
PURT_BACV8      RKAIRDLAAKELGLKTAKYFYAKSLEELQEAAKEI------GFPCVVKPLMSSSGKGQSL
PURT_CHLPD      RKAIRDLASKELGLRTATYRYAASKEELKRAIGEV------GVPCVVKPLMSSSGKGQST
PURT_CHLTE      RKAIRDLAARDLGLRTANYRYASSLEELRSAVGEV------GLPCVVKPLMSSSGKGQST
PURT_LEPBJ      RKSIRDLAAKDLKLLTAKYLYASSEKELAKATKIL------GFPCVVKPLMSSSGKGQSI
PURT_LEPBL      RKSIRDLAAKDLKLLTAKYLYASSEKELAKATKIL------GFPCVVKPLMSSSGKGQSI
PURT_LEPIN      RKSIRDLAAKDLKLLTAKYAYASSIDELIKATEIL------GFPCVVKPLMSSSGKGQSV
PURT_LEPIC      RKSIRDLAAKDLKLLTAKYAYASSIDELIKATEIL------GFPCVVKPLMSSSGKGQSV
PURT_FLAPJ      RKAIRDLAAKELGLKTANYRYATSAEELQKGVQAV------GMPCVVKPLMSSSGKGQST
PURT_ANADE      RRAIRDLAARELGLATARYAYASTPEAFRAAVHEI------GLPCVVKPLMSSSGKGQSV
PURT_ERYLH      RDAIRDLAAQELGITTSRYRYAKNLEEVRAAAEFT------GYPCVIKPVMSSSGKGQST
PURT_BIFAA      RERLRVLAHEELGLPTTPYRFAGSLEELREGAQIV------GYPCVVKPIMSSSGHGQSV
PURT_BIFLO      RERLRVLAHEELGLPTTPYRFAGSLEELRAGASEV------GYPCVVKPVMSSSGHGQSV
PURT_SULAC      RIELRRFAAEKVKVPTTAYGFATSPEEVKKMCKDV------GYPCIIKPQMSSSGHGHEV
PURT_SULTO      RIELRKLAAEKVKVPTTQYGFAENPEEVKKICKDI------GYPCIIKPEMSSSGHGHEV
PURT_SACS2      RIELRRFAAEKLKLPTTKYAFAENEEEVKRACKDI------GFPCLIKPEMSSSGHGHVL
PURT_IGNH4      RIELRRLAAEKVGVPTTRYAFAHNEDEAAEACEKV------GYPCLIKPEMSSSGHGHTL
PURT_PYRAB      RERLRETLVKEAKVPTSRYMYATTLDELYEACEKI------GYPCHTKAIMSSSGKGSYF
PURT_PYRFU      RERLRETLVKEAKVPTSRYMYATTLDELYEACEKI------GYPCHTKAIMSSSGKGSYF
PURT_PYRHO      RERLRETLVKEAKVPTSRYMYATTLDELYEACEKI------GYPCHTKAIMSSSGKGSYF
PURT_THEKO      RERTRETLAREAKVPTSRYTYASTLDELYEACEKI------GYPCHTKAIMSSSGKGSYF
PURT_METAR      RERLREAIASTG-ARTSKYEYATDLESFKAACKKI------GFPCVSKPIMSSSGKGSYV
                *   :          .  : :                    . *   *. ***** *   

PURT_NITSB      ARNEAD--LERSWEIAKEARG-----DASELIVEEFIDFDYEITLLTARNETG------T
PURT_SULDN      ARSASD--IDASWEIAKEARG-----DASELIVEAFVDFDYEITMLTARNGKE------T
PURT_SULNB      AKTAND--IERSWEIAKEARG-----DASELIVEEFVPFDYEITLLTVRNETG------T
PURT_WOLSU      CRMAEE--IEACFEEAKEARG-----DSSELIVEEFIPFDYEITLLTLNNGKK------I
PURT_METM5      IKSEGD--IEKSWDYAKSAAR----GIGTKVIVEEFIKFDYEITLLTARTAEG------T
PURT_METM7      IKSERD--IEKSWDYAKSAAR----GIGTKVIVEEFIKFDYEITLLTARTSEG------T
PURT_METMP      IKSESD--IKTAWNYAKSAAR----GIGTKVIVEEFIKFDYEITLLTARTAEG------T
PURT_METVS      VKSEFD--IEKSWDYAKSATR----GIGTKVIVEEFVNFDYEITLLTARTAFG------T
PURT_META3      VKSEKDEDIEYAWNYAQAGAR----GIGKKVIVEEFINFDYEITLLTARTAHG------T
PURT_METJA      VRSEED--IEKAWKIAKEGAR----GIGNRVIVEEFINFDYEITLLTARTAEG------T
PURT_BACSU      CRSEAD--LESCWETAMEGGR----VKNGRVIVEEFIPFESEITLLTVRAVNG------T
PURT_BACVZ      CRSASG--LKSCWDMAMEGGR----VKNGRVIVEEFIPFESEITLLTVRAANG------T
PURT_HALWD      VRESAE--INGAWETARAGSR----SDTGRVIIEELVEFDSEFTLLTVRHADG------T
PURT_ECOLI      IRSAEQ--LAQAWKYAQQGGR----AGAGRVIVEGVVKFDFEITLLTVSAVDG------V
PURT_SHISS      IRSAEQ--LAQAWKYAQQGGR----AGAGRVIVEGVVKFDFEITLLTVSAVDG------V
PURT_SHIBS      IRSAEQ--LAQAWKYAQQGGR----AGAGRVIVEGVVKFDFEITLLTVSAVDG------V
PURT_ECOUT      IRSAEQ--LAHAWEYAQQGGR----AGAGRVIVEGVVKFDFEITLLTVSAVDG------V
PURT_ECOK1      IRSAEQ--LAHAWEYAQQGGR----AGAGRVIVEGVVKFDFEITLLTVSAVDG------V
PURT_ECOL5      IRSAEQ--LAHAWEYAQQGGR----AGAGRVIVEGVVKFDFEITLLTVSAVDG------V
PURT_ECO57      IRSAEQ--LAQAWEYAQQGGR----AGAGRVIVEGVVKFDFEITLLTVSAVDG------V
PURT_SHIDS      IRSAEQ--LAQAWEYAQQGGR----AGAGRVIVEGVVKFDFEITLLTVSAVDG------V
PURT_SHIFL      IRSAEQ--LAQAWEYAQQGGR----AGAGRVIVEGVVKFDFEITLLTVSAVDG------V
PURT_SHIF8      IRSAEQ--LAQAWEYAQQGGR----AGAGRVIVEGVVKFDFEITLLTVSAVDG------V
PURT_SALPA      IRSAEQ--LAQAWEYAQQGGR----AGAGRVIVEGVVKFDFEITLLTVSAVDG------V
PURT_SALTI      IRSAEQ--LAQAWEYAQQGGR----AGAGRVIVEGVVKFDFEITLLTVSAVDG------V
PURT_SALCH      IRSAEQ--LAQAWEYAQQGGR----AGAGRVIVEGVVKFDFEITLLTVSAVDG------V
PURT_SALTY      IRSAEQ--LAQAWEYAQQGGR----AGAGRVIVEGVVKFDFEITLLTVSAVDG------V
PURT_CROS8      IRSEEM--LESAWQYAQQGGR----AGAGKVIVEGVVKFDFEITLLTISAVDG------V
PURT_YERPE      IRSEEH--LQAAWEYAQQGGR----AGSGRVIIEGLVHFDFEITLLTIRAVDG------I
PURT_YERPA      IRSEEH--LQAAWEYAQQGGR----AGSGRVIIEGLVHFDFEITLLTIRAVDG------I
PURT_YERPN      IRSEEH--LQAAWEYAQQGGR----AGSGRVIIEGLVHFDFEITLLTIRAVDG------I
PURT_YERPP      IRSEEH--LQAAWEYAQQGGR----AGSGRVIIEGLVHFDFEITLLTIRAVDG------I
PURT_YERPS      IRSEEH--LQAAWEYAQQGGR----AGSGRVIIEGLVHFDFEITLLTIRAVDG------I
PURT_YERE8      IRSEPQ--LQAAWDYAQQGGR----AGSGKVIVEGLVHFDFEITLLTISAVDG------I
PURT_PECAS      IRSAEQ--LAQAWVYAQQGGR----AGGGRVIVEGLVNFDFEITLLTIHAVDG------I
PURT_SODGM      VRDAAQ--LDAAWQYAQLGGR----AGGGKVIVEGLVAFDFEITLLTINAVDG------I
PURT_WIGBR      IYNEKE--LRHSWEKSQTYGR----TSLGEVIIEKIIPFDFEITLLVVNSVDG------M
PURT_AERHH      LRDLAK--LDESWTHAQEGGR----AGRGKVIVEGFVPFEYEITLLTVRAVDG------I
PURT_AERS4      LRDLAK--LDESWTYAQEGGR----AGRGKVIVEGFVPFEYEITLLTVRAVDG------I
PURT_PSYIN      VKSAAD--LDNAWTYSQVGGR----SGEGRIIIEGFVPFDYEITLLTVNAVDG------T
PURT_VIBCB      IKTEED--VQTAWEYAQEGGR----TGAGRVIVEGFIDFDYEITLLTVRAVDG------V
PURT_VIBPA      IKTEDD--IEKAWDYAQEGGR----TGAGRVIVEGFIDFDYEITLLTVRAVDG------V
PURT_VIBVU      IKSPAD--IEKAWQYAQEGGR----TGAGRVIVEGFIDFDYEITLLTVRAVDG------V
PURT_VIBVY      IKSPAD--IEKAWQYAQEGGR----TGAGRVIVEGFIDFDYEITLLTVRAVDG------V
PURT_VIBCH      IRTPEQ--IEAAWQYAQQGGR----SGAGRVIVEGFVDFDYEITLLTVRAVDG------V
PURT_ALIF1      IKTEAD--IRTSWDYAQDGGR----SGAGRVIVEGFVDFDYEISLLTVRAVDG------V
PURT_PHOPR      IKTPAD--IEASWQYAQEGGR----AGTGRVVVEGFIKFDYEITLLTTRAVDG------I
PURT_SHEB5      IRDIAL--SHKAWQYAQEGGR----AGGGRVIVEGFIPFDYEITLLTISAVNG------I
PURT_SHEB8      IRDIAL--SHKAWQYAQEGGR----AGGGRVIVEGFIPFDYEITLLTISAVNG------I
PURT_SHEPC      IRDIAL--SHKAWQYAQEGGR----AGGGRVIVEGFVPFDYEITLLTVSAVNG------I
PURT_SHESW      IRDIAQ--SNKAWQYAQEGGR----AGGGRVIVEGFVPFDYEITLLTVSAVNG------I
PURT_SHESM      IRDVSQ--SAKAWQYAQEGGR----AGGGRVIVEGFIPFDYEITLLTISAVNG------I
PURT_SHESR      IRDVSQ--SAKAWQYAQEGGR----AGGGRVIVEGFIPFDYEITLLTISAVNG------I
PURT_SHESA      IRDAAQ--STKAWQYAQEGGR----AGGGRVIVEGFIPFDYEITLLTISAVNG------I
PURT_SHEON      IRNVAQ--SAKAWQYAQEGGR----AGGGRVIVEGFIPFDYEITLLTISAVNG------I
PURT_SHEFN      IKSTQT--IQQAWAYAQEGGR----AGKGRVIVEAFIPFDYEITLLTISAVNG------I
PURT_SHEAM      IRSPGD--VQKAWDYAQSGGR----AGEGRIIVEGFIDFDYEITLLTISAVDG------I
PURT_PSEAE      LKGPDD--LQAAWDYAQEGGR----AGKGRVIVEGFIDFDYEITLLTVRHVDG------T
PURT_PSEAB      LKGPDD--LQAAWDYAQEGGR----AGKGRVIVEGFIDFDYEITLLTVRHVDG------T
PURT_AZOSB      LRGPDD--VKKAWDYAQEGGR----AGKGRVIVEGFIDFDYEITLLTVRHAGG------T
PURT_PSEE4      LRSADD--LQKAWDYAQEGGR----AGKGRVIIEGFIDFEYEITLLTVRHVGG------T
PURT_PSEPK      LRSDAD--LQKSWDYAQEGGR----AGKGRVIVEGFIDFEYEITLLTVRHVGG------T
PURT_PSEF5      LRSVDD--VQKAWDYAQEGGR----AGKGRVIIEGFIDFDYEITLLTVRHVGG------T
PURT_PSEPF      LRSADD--VQKAWDYAQEGGR----AGKGRVIIEGFIDFDYEITLLTVRHVGG------T
PURT_PSE14      LKSADD--VQKAWDYAQEGGR----AGKGRVIVEGFIDFDYEITLLTVRHIGG------T
PURT_PSEU2      LKSTDD--VQKAWDYAQEGGR----AGKGRVIVEGFIDFDYEITLLTVRHIGG------T
PURT_PSESM      LKSADD--VQKAWDYAQEGGR----AGKGRVIIEGFIDFDYEITLLTVRHIGG------T
PURT_PSEU5      LRSDAD--IDAAWEYAQAGGR----AGRGRVIVEGFIDFDYEITLLTVRHAGG------T
PURT_XANAC      LRSEAD--IDAAWEYAQTGGR----AGAGRCIVEGFIDFDYEITLLTVRHAGG------T
PURT_XANC5      LRSEAD--IDAAWAYAQTGGR----AGAGRCIVEGFIDFDYEITLLTVRHAGG------T
PURT_XANOR      LRSEAD--IDAAWEYAQTGGR----AGAGRCIVEGFIDFDYEITLLTVRHAGG------T
PURT_XANOM      LRSEAD--IDAAWEYAQTGGR----AGAGRCIVEGFIDFDYEITLLTVRHAGG------T
PURT_XANCP      LRSEAD--IDAAWDYAQTGGR----AGAGRCIVEGFIDFDYEITLLTVRHAGG------T
PURT_XANC8      LRSEAD--IDAAWDYAQTGGR----AGAGRCIVEGFIDFDYEITLLTVRHAGG------T
PURT_ALCBS      LKNEAD--ILPAWEYAQSGGR----AGKGRVIVEGFVDFDYEITLLTVRHKAGS--EIKT
PURT_MARHV      VKTEAD--IERAWEYAQTGGR----AGKGRVIVEGFVDFDYEITLLTVRHKEG------I
PURT_DESVH      VRTPAD--IDSAWAYAQTGGR----AGAGRVIVEGFVDFDYEITLLTVRHAGG------V
PURT_DESVV      VRTPAD--IDSAWAYAQTGGR----AGAGRVIVEGFVDFDYEITLLTVRHAGG------V
PURT_DESAG      VRSADD--IADAWTYAQSGGR----AGGGRVIVESFVDFDYEITLLTVRHCNG------T
PURT_ACTP2      IKSEDQ--IQQAWDYSQEGGR----AGGGRVIVEGFIKFDYEITQLTVRHVNG------T
PURT_HAEDU      IKSLDQ--IQQAWDYSQAGGR----AGGGRVIVEGFIKFDYEITLLTVRHING------T
PURT_MANSM      IKSFDQ--IQQAWDYAQQGGR----AGAGRVIVEGFVKFDYEITLLTVRHIGG------T
PURT_PASMU      LKSVEQ--IPSAWEYAQQGGR----AGAGRVIVEGFVKFDYEITLLTVRHVHG------T
PURT_HAES1      LKSKDD--LQKAWDYAQQGGR----AGAGRVIVEGFVKFDYEITLLTVRHAEG------T
PURT_PARD8      VREEKD--IDRAWQYAQEGGR----AGAGKVIVEGFVDFDYEITQLTVRHIGG------T
PURT_HYDCU      IKSTAD--IDSAWHYAQEGGR----AGKGKVIIEGFVDFDYEITLLTIRHKNG------T
PURT_HAHCH      IHSDGD--VERAWRYAQEGGR----AGQGKVIVEGFVDFDYEVTLLTLRHAGG------T
PURT_POLNA      IALPKD--VAPAWDHAMAGGR----VSRGRVIVEGFVDFEYEITLLTVRA-LGADGQVET
PURT_POLSJ      IAGPAD--VKTAWDYAMAGGR----VSHGRVIVEGFIDFDYEITQLTVRA-LGADGQVET
PURT_RHOFT      ISGPAD--VQKAWDYAMAGGR----VSHGRVIVEGFIDFDYEITLLTVRA-KGADGQIET
PURT_CUPNH      IDGPEG--VKAAWDYAMAGGR----VSHGRVIVEGFIDFDYEITLLTVRA-MGASGQVET
PURT_CUPPJ      IDGPEG--VKAAWDYAMAGGR----VSHGRVIVEGFIDFDYEITLLTVRA-LGADGKVET
PURT_CUPMC      IDGPAD--VKAAWDYAMAGGR----VSHGRVIVEGFIDFDYEITLLTVRA-VGANGEVET
PURT_ACIAC      LDGPAD--VQKAWDYAMAGGR----VSHGRVIVEGFIDFEYEITLLTVRA-RAADGSIQT
PURT_MYCS2      INGPDE--VAAAWEYAMAGGR----VSHTRIIVEGFVDFDYEITLLTVRA-RGADGEIAT
PURT_MYCVP      IDGPEG--VAAAWEYAMSGSR----VSNTRIIVEGFVDFDYEITLLTVRA-RGADGEIET
PURT_BORBR      IRSADD--IAAAWRYAQEGGR----VGAGRVIVEGFIEFDYEITLLTVRA-RGADGQIVT
PURT_BORPA      IRSADD--IAAAWRYAQEGGR----VGAGRVIVEGFIEFDYEITLLTVRA-RGADGQIVT
PURT_BORPE      IRSADD--IAAAWRYAQEGGR----VGAGRVIVEGFIEFDYEITLLTVRA-RGADGQIVT
PURT_BORA1      IRGPGD--LDAAWRYAQEGGR----VGGGRAIVEGFIDFDYEITLLTVRA-RGVDGQIET
PURT_BURCA      VKTDAD--VKPAWDYAMAGGR----VNHGRVIVEGFVDFDYEITQLTVRAIDPATLDTRT
PURT_BURCH      VKTDAD--VKPAWDYAMAGGR----VNHGRVIVEGFVDFDYEITQLTVRAIDPATLDTRT
PURT_BURL3      VKTEAD--VKPAWDYAMAGGR----VNHGRVIVEGFIDFDYEITQLTVRAIDPATDATRT
PURT_BURCM      VRTEAD--VKPAWDYAMAGGR----VNHGRVIVEGFIDFEYEITQLTVRAIDPATLETRT
PURT_BURVG      VRSEAD--VKAAWDYAMAGGR----VNHGRVIVEGFIDFDYEITQLTVRAIDPATLATRT
PURT_BURMA      LRSEAD--IEPAWRYAMAGGR----VNHGRVIVEGFIRFDYEITQLTVRAIDPASGQTRT
PURT_BURM9      LRSEAD--IEPAWRYAMAGGR----VNHGRVIVEGFIRFDYEITQLTVRAIDPASGQTRT
PURT_BURM7      LRSEAD--IEPAWRYAMAGGR----VNHGRVIVEGFIRFDYEITQLTVRAIDPASGQTRT
PURT_BURMS      LRSEAD--IEPAWRYAMAGGR----VNHGRVIVEGFIRFDYEITQLTVRAIDPASGQTRT
PURT_BURPS      VRSEAD--IEPAWRYAMAGGR----VNHGRVIVEGFIRFDYEITQLTVRAIDPASGQTRT
PURT_BURP0      VRSEAD--IEPAWRYAMAGGR----VNHGRVIVEGFIRFDYEITQLTVRAIDPASGQTRT
PURT_BURP1      VRSEAD--IEPAWRYAMAGGR----VNHGRVIVEGFIRFDYEITQLTVRAIDPASGQTRT
PURT_BURP6      VRSEAD--IEPAWRYAMAGGR----VNHGRVIVEGFIRFDYEITQLTVRAIDPASGQTRT
PURT_BURTA      VRSDAD--VEPAWQYAMAGGR----VNHGRVIVEGFVQFDYEITQLTVRAIDPASLKTRT
PURT_PARXL      LRGDAD--VEPAWQYAMAGGR----VNHGRVIVEGFIDFEYEITQLTVRAINPASGEVST
PURT_DECAR      LRGPDD--VQKAWDYAASGGR----VNQGRVIVEGFIDFDYEITLLTVRARDTA-GEVVT
PURT_THIDA      VDDAGE--MRAAWDYAVRGGR----VDKGRFIVEGVIDFDYEITLLTVRA-RAASGAIET
PURT_METFK      ITSPEQ--IAAAWEYAATAGR----VNQGKVIVEGQIDFDYEITLLTVRA-LDAEGKVET
PURT_HERAR      LNSADD--IEAAWNCAAAGGR----VDTGRVIVEGFIDFDYEITLLTVRA-IGADGATHT
PURT_JANMA      LSSSAD--VAAAWDCAAAGGR----VDSGRVIVEGFIDFEYEITLLTVRA-IGADGEVHT
PURT_RHOJR      VRDTGG--VETAWEYALAGGR----INYGRVIVEGFVDFDYEITQLTVRA-IGADGEVGT
PURT_METCA      LESPSD--VQAAWDHARQGGR----VGASRVIVEGRIDFDFEITLLTVRA-PVSGGDAGI
PURT_CORGL      LRSSDD--LQAAWDYAMSGAR----VANSRVIVEAFVEFDYEITLLTVRSIDPTTSKPAT
PURT_CORGB      LRSSDD--LQAAWDYAMSGAR----VANSRVIVEAFVEFDYEITLLTVRSIDPTTSKPAT
PURT_COREF      VTSAED--LESAWEYAMSGAR----VSNQRVIVEQFVEFDYEITLLTVRGIDPATGKPAT
PURT_CORJK      VGGVDE--LEAAWNAALKHSR----TNAQRVMVEQYIPFDYEVTILAVRSIDPATGREAT
PURT_ACIBT      VKSFDE--VDAAWEYAMQGGR----VNQGTVIIESQIDFDFEITLLTVRAKNPETGEIET
PURT_ACIAD      VKSFEE--VDAAWDYAQTGGR----VKQGKVIVESQIDFDFEITLLTVRAKNPETGAIET
PURT_GEOMG      VKSMEE--IDGAWTYAMEGGR----GASDTVIVEEFIPFDYEITLLTVRHAGG------T
PURT_PELPD      LRDPSQ--VDEAWRYAMEGAR----GASDTVIIEEFIQFDYEITLLTVRHCNG------T
PURT_PELCD      VKTPDD--IEKAWNYARQGAR----GAGERVIIEAFIPFDYEITLLTVRHVDG------T
PURT_FRATF      VKEHNE--IKKAWDYAQNGSR----GHAKGVIVEQFIDFDYEITLLTVRHKDG------T
PURT_FRATH      VKEHNE--IKKAWDYAQNGSR----GHAKGVIVEQFIDFDYEITLLTVRHKDG------T
PURT_FRATO      VKEHNE--IKKAWDYAQNGSR----GHAKGVIVEQFIDFDYEITLLTVRHKDG------T
PURT_FRATT      VKEHNE--IKKAWDYAQNGSR----GHAKGVIVEQFIDFDYEITLLTVRHKDG------T
PURT_FRAT1      VKEHNE--IKKAWDYAQNGSR----GHAKGVIVEQFIDFDYEITLLTVRHKDG------T
PURT_FRATW      VKEHNE--IKKAWDYAQNGSR----GHAKGVIVEQFIDFDYEITLLTVRHKDG------T
PURT_FRATN      VKEHNE--IKKAWDYAQNGSR----GHAKGVIVEQFIDFDYEITLLTVRHKDG------T
PURT_NOSS1      VATKEE--VEKAWDYAIANSR----GDSQKVIVEEFINFEIEITLLTIKQWNAP-----T
PURT_TRIV2      VATKEE--VEKAWNYAIANSR----GDSQKVIVEEFINFEIEITLLTIKQWDSP-----T
PURT_SYNP6      IQQPDQ--LQAAWDYAIAGSR----GDSQKVILEEFIPFELEITLLTIRQWQGP-----T
PURT_SYNE7      IQQPDQ--LQAAWDYAIAGSR----GDSQKVILEEFIPFELEITLLTIRQWQGP-----T
PURT_SYNY3      VNNAGE--VQQAWSAAIAGAR----GDQTKVIVEEFIPFELEITLLTIRQWQGE-----T
PURT_PROM3      VSNPEG--LRQAWQAAMAGSR----GNSPRVIVEEFLHFDLEITLLTIRQEDGS-----T
PURT_PROMM      VSNPEG--LRQAWQAAMAGSR----GNSPRVIVEEFLHFDLEITLLTIRQEDGS-----T
PURT_SYNSC      VDCADD--LPKAWEAAMAGAR----GTSTQVIVEEFLHFDLEITLLTIRQRNGE-----T
PURT_SYNPX      VDGPDG--LDQAWDAAMAGAR----GTSPRVIVEEFLRFDLEITLLTIRQHNGE-----T
PURT_SYNS9      VQTPEQ--LDQAWEAAMANAR----GTSNQVIVEEFLEFDLEITLLTIRQRNGE-----T
PURT_SYNPW      VDGPEG--LNEAWEAAMANAR----GTSTHVIVEEFLRFDLEITLLTIRQRDGS-----T
PURT_SYNS3      VHSAAE--LDKAWEIAMAGAR----GSSAQVIVEEFLDFDLEITLLTIRQHDGT-----T
PURT_SYNR3      ATNPEE--LQQAWTAATQGAR----GSASLVIVEEFLRFEQEITLLTVRQKDGP-----T
PURT_PROM1      VKNKNE--LAQAWNLAIEKSR----GKSNKIILEEFIDFDLEITLLTIRQSNGK-----T
PURT_PROMT      VKNKND--LAQAWNLAIEKSR----GKSNKIILEEFIDFDLEITLLTIRQSNGK-----T
PURT_PROMA      IKDKND--LEKAWDLAIKEAR----GDSKQVIIEEYINFDLEITLLTIKQSNHQ-----T
PURT_PROMS      VETKND--LQNAWKQAQANSR----GKVKGVIIEEFINFDFEFTLLTVRKENGE-----N
PURT_PROM0      VETKND--LQNAWKQAQANSR----GKVKGVIIEEFINFDFEFTLLTVRKENGE-----N
PURT_PROM9      VGSKND--LNQAWSQAQANSR----GQVKGVIIEEFINFDFEFTLLTVRKNNGE-----N
PURT_PROM5      VKRKED--LLLAWEDALKNSR----GKIEGVILEEFLNFDYEFTLLTVRKSSGE-----N
PURT_PROMP      VNRKED--LLLAWNDALKNSR----GKIVGVILEEFLNFDYEFTLLTIRKTSGE-----N
PURT_BACFR      VKSAAE--LEHAWEYGCNGSR----GDIRELIIEEFIKFDSEITLLTVTQKNGP-----T
PURT_BACFN      VKSAAE--LEHAWEYGCNGSR----GDIRELIIEEFIKFDSEITLLTVTQKNGP-----T
PURT_BACTN      VKSADE--LEHAWEYGCSGSR----GDIRELIIEEFIKFDSEITLLTVTQKNGP-----T
PURT_BACV8      VKSADE--LEQAWHYGCEGSR----GDIKELIIEEFIQFDSEITLLTVTQKNGP-----T
PURT_CHLPD      VKTEAD--IEHAWSYSQSGRR----GDSVEVIVEAFVPFHTEITLLTVTQKNGP-----T
PURT_CHLTE      VRSEAE--IEAAWSYSQSGKR----GDIAEVIVEAFVPFHTEITLLTVTQKNGP-----T
PURT_LEPBJ      IKSPKD--ISKAWEASQTKGR----TSATEIIVEEFISFKSEITLLTVTQKNGK-----T
PURT_LEPBL      IKSPKD--ISKAWEASQTKGR----TSATEIIVEEFISFKSEITLLTVTQKNGK-----T
PURT_LEPIN      IQSREE--ISKAWEASQTKGR----AGAAEIIVEEFIPFESEITLLTVTQKNGK-----T
PURT_LEPIC      IQSREE--ISKAWEASQTKGR----AGAAEIIVEEFIPFESEITLLTVTQKNGK-----T
PURT_FLAPJ      IKTVED--IEKAWNYAVEGSR----GDVVEVIVEAFVKFNSEITLLTVAQNNNP-----T
PURT_ANADE      VRAEGD--LEAAWAYAMSGTR----GDLREVIVEEFIPFDSEITLLTVTQRRGE-----T
PURT_ERYLH      VRSADK--LEEAWDYAVANMR----GDRKRVIVEQFIDFDYEITLLTVRHKDG------I
PURT_BIFAA      VRSADA--IDAAWTEAQEGRRAHDEGDVSRVIVEALAPLDYELTVLTVSSSAG------I
PURT_BIFLO      VRSADA--IDAAWTEAQEGRRAADEGDVSRVIVEALAPLERELTVLTVSSSAG------I
PURT_SULAC      IYDESQ--VEEKFKEALTHAR----GKSKTVIVEEYVKIDRELTVLTYRYPLSSGG-VAT
PURT_SULTO      VYNESE--VEQKFKEAITHAR----GKSEQVIVEEYVKIDRELTVLTYRY-LDDKG-VVT
PURT_SACS2      VNKIEN--VEEAYRESISHAR----GKSRRVIVEEFVKIDTELTVLTYRYHSNSDS-IIT
PURT_IGNH4      ASSPEE--AREGFKRALKEAR----GKSERAIVEEFVEIDRELTALTYRH-DTGNG-IET
PURT_PYRAB      VKGPED--IPKAWEEAKTKAR----GSAEKIIVEEHIDFDVEITELAVRHFDENGE-IVT
PURT_PYRFU      VRGPED--IPKAWEEAKTKAR----GSAEKIIVEEHIDFDVEITELAVRHFDENGE-IVT
PURT_PYRHO      VKGPED--IPKAWEEAKTKAR----GSAEKIIVEEHIDFDVEVTELAVRHFDENGE-IVT
PURT_THEKO      VKGPED--VPKAWEEAKKKAR----GSAEKLIVEEHIDFDVEITELAVRHYDENGE-VVT
PURT_METAR      LKSSKD--VEKAFKEA-AKAR----GSSDKIIVEEFIDFDVEITALSVRYLNGKGK-PES
                            :  .               ::*    :. *.: *              

PURT_NITSB      VFCPPIGHIQKDG--DYIFSWQP-----MQMSETALQKAKEIAKTITDGLG---------
PURT_SULDN      VFCEPIGHEQRDG--DYVFSWQP-----MQMSEIAKQRAEDMAKKITDGLG---------
PURT_SULNB      TFCEPIGHVQKDG--DFILSWQP-----MQMSPEALKKAQEIAKAVTDGLG---------
PURT_WOLSU      TFCDPIGHIQKGG--DYIFSWQP-----AQMKKSVLKKAQKIARDVVSALG---------
PURT_METM5      RFCEPIGHIQIDG--DYHESWQP-----HPMCAPTKAKAQEMAKKITDELG---------
PURT_METM7      KFCEPIGHIQIDG--DYHESWQP-----HPMCAPTKAKAQEMAKKITDELG---------
PURT_METMP      RFCEPIGHIQVDG--DYHESWQP-----HPMCAPTKAKAQEMAKKITDELG---------
PURT_METVS      KFCEPIGHIQIDG--DYHESWQP-----HPMCSPTKAKAQEVAKKITDELG---------
PURT_META3      VYCPPIGHIQDGG--DYIESWQP-----HPMSEEMIKKAQEMANKITTVLG---------
PURT_METJA      KFCEPIGHVQIDG--DYHESWQP-----HNMSAELKEQAQDIAKKVTDALG---------
PURT_BACSU      AFCEPIGHVQKDG--DYIESWQP-----HDMTEQQIEEAKHIAKTITDELG---------
PURT_BACVZ      SFCAPIGHEQKDG--DYIESWQP-----HHMTEQQIKEAKHIAKSITDELG---------
PURT_HALWD      TFCPPVGHTQQDG--DYRTSWQP-----HSLTTEQRTTAQQMAQKVTDGLG---------
PURT_ECOLI      HFCAPVGHRQEDG--DYRESWQP-----QQMSPLALERAQEIARKVVLALG---------
PURT_SHISS      HFCAPVGHRQEDG--DYRESWQP-----QQMSPLALERAQEIARKVVLALG---------
PURT_SHIBS      HFCAPVGHRQEDG--DYRESWQP-----QQMSPLALERAQEIARKVVLALG---------
PURT_ECOUT      HFCAPVGHRQEDG--DYRESWQP-----QQMSPLALERAQEIARKVVLALG---------
PURT_ECOK1      HFCAPVGHRQEDG--DYRESWQP-----QQMSPLALERAQEIARKVVLALG---------
PURT_ECOL5      HFCAPVGHRQEDG--DYRESWQP-----QQMSPLALERAQEIARKVVLALG---------
PURT_ECO57      HFCAPVGHRQEDG--DYCESWQP-----QQMSPLALERAQEIARKVVLALG---------
PURT_SHIDS      HFCAPVGHRQEDG--DYRESWQP-----QQMSPLALERAQEIARKVVLALG---------
PURT_SHIFL      HFCAPVGHRQEDG--DYRESWQP-----QQMSPLALERAQEIARKVVLALG---------
PURT_SHIF8      HFCAPVGHRQEDG--DYRESWQP-----QQMSPLALERAQEIARKVVLALG---------
PURT_SALPA      HFCAPVGHRQQDG--DYRESWQP-----QQMSELALKRAQEIARHVVLALG---------
PURT_SALTI      HFCAPVGHRQQDG--DYRESWQP-----QQMSELALKRAQEIARHVVLALG---------
PURT_SALCH      HFCAPVGHRQQDG--DYRESWQP-----QQMSELALKRAQEIARHVVLALG---------
PURT_SALTY      HFCAPVGHRQQDG--DYRESWQP-----QQMSELALKRAQEIARHVVLALG---------
PURT_CROS8      HFCAPIGHRQEDG--DYRESWQP-----QQMSDVALTRAQEIAQKVVEALG---------
PURT_YERPE      HFCAPIGHRQEDG--DYRESWQP-----QAMSDIALQRAKEISAQVVTALG---------
PURT_YERPA      HFCAPIGHRQEDG--DYRESWQP-----QAMSDIALQRAKEISAQVVTALG---------
PURT_YERPN      HFCAPIGHRQEDG--DYRESWQP-----QAMSDIALQRAKEISAQVVTALG---------
PURT_YERPP      HFCAPIGHRQEDG--DYRESWQP-----QAMSDIALQRAKEISAQVVTALG---------
PURT_YERPS      HFCAPIGHRQEDG--DYRESWQP-----QAMSDIALQRAKEISAQVVTALG---------
PURT_YERE8      HFCAPIGHRQEDG--DYRESWQP-----QAMSDVAVARAKEIASQVVKALG---------
PURT_PECAS      HFCAPIGHRQEDG--DYRESWQP-----QRMSALAQERAQKMASDVVKALG---------
PURT_SODGM      HFCAPIGHRQEDG--DYRESWQP-----QHMSALARQRAQTIAADVVTALG---------
PURT_WIGBR      HFCLPIGHRQEKG--DYQESWQP-----HKMDNVIFEKAKKISKKIVSYLG---------
PURT_AERHH      HFCQPIGHRQEDG--DYRESWQP-----QAMSEQALARSKEVAAKVVEALG---------
PURT_AERS4      HFCDPIGHRQEDG--DYRESWQP-----QAMSTLALARSKEVAAKVVGALG---------
PURT_PSYIN      HFCDPIGHRQENG--DYRESWQP-----QAMSTVALQKAQNIAKKIVTELG---------
PURT_VIBCB      HFCAPIGHRQEDG--DYRESWQP-----QAMSENAIKAAEYTAEKVVNALG---------
PURT_VIBPA      HFCAPIGHRQEDG--DYRESWQP-----QAMSENAIKAAEYTAEKVVNALS---------
PURT_VIBVU      HFCAPIGHRQEDG--DYRESWQP-----QQMSENAIKAAEYTAEQVVNALG---------
PURT_VIBVY      HFCAPIGHRQEDG--DYRESWQP-----QQMSENAIKAAEYTAEQVVNALG---------
PURT_VIBCH      HFCAPIGHRQEDG--DYRESWQP-----QVMSENAIKAAEYVAEQVVNALG---------
PURT_ALIF1      HFCAPIGHRQEDG--DYRESWQP-----QVMTEAALKQAQNAAEKVVNALG---------
PURT_PHOPR      HFCAPIGHRQEEG--DYRESWQP-----QQMSDEALKAAQDVAEKVVNALG---------
PURT_SHEB5      HFCAPIGHRQEDG--DYRESWQP-----QAMSDEVLAKSQAIASKVVEALG---------
PURT_SHEB8      HFCAPIGHRQEDG--DYRESWQP-----QAMSDEVLAKSQAIASKVVEALG---------
PURT_SHEPC      HFCAPIGHRQEDG--DYRESWQP-----QAMSDEVLAKSQAIASKVVEALG---------
PURT_SHESW      HFCAPIGHRQEDG--DYRESWQP-----QAMSDEVLAKSQAIASKVVEALG---------
PURT_SHESM      HFCAPIGHRQEDG--DYRESWQP-----QAMSADVLAKSQAIASKVVEALG---------
PURT_SHESR      HFCAPIGHRQEDG--DYRESWQP-----QAMSADVLAKSQAIASKVVEALG---------
PURT_SHESA      HFCAPIGHRQEDG--DYRESWQP-----QAMSADVLAKSQAIASKVVEALG---------
PURT_SHEON      HFCAPIGHRQEDG--DYRESWQP-----QAMSADVLAKSQAIASKVVEALG---------
PURT_SHEFN      HFCDPIGHRQEDG--DYRESWQP-----QSMSAEVLHKAQAMSQRVVEALG---------
PURT_SHEAM      HFCAPIGHRQEDG--DYRESWQP-----QAMSSLALDRAQHIAREVVQNLG---------
PURT_PSEAE      TFCAPIGHRQVKG--DYHESWQP-----QAMSAQALAESERVARAVTEALG---------
PURT_PSEAB      TFCAPIGHRQVKG--DYHESWQP-----QAMSAQALAESERVARAVTEALG---------
PURT_AZOSB      TFCAPVGHRQEKG--DYQESWQP-----QPMSAKAIAESERIALAVTGALG---------
PURT_PSEE4      TFLEPVGHRQEKG--DYQESWQP-----QAMSPKALAESQRVAQAVTDALG---------
PURT_PSEPK      TFLEPVGHRQEKG--DYQESWQP-----QAMSPKALAESQRVAKAVTDALG---------
PURT_PSEF5      TFCAPVGHRQEKG--DYQESWQP-----QAMSPKALAESERVAKAVTEALG---------
PURT_PSEPF      TFCAPVGHRQEKG--DYQESWQP-----QAMSPVALAESERVAKAVTEALG---------
PURT_PSE14      TFCAPVGHRQEKG--DYQESWQP-----QAMSPVALAESERVARAVTEALG---------
PURT_PSEU2      TFCAPVGHRQEKG--DYQESWQP-----QAMSPVALAESERVAKAVTEALG---------
PURT_PSESM      TFCAPVGHRQEKG--DYQESWQP-----QAMSPAALAESERVAKAVTESLG---------
PURT_PSEU5      SFCEPVGHRQEKG--DYQESWQP-----QPMAPAALAEAKRIALAVTDALG---------
PURT_XANAC      SYCDPIGHWQQDG--DYRESWQP-----QPMSAAALRRSQQIAKAITDDLG---------
PURT_XANC5      SYCDPIGHWQQDG--DYRESWQP-----QPMSAAALRRSQEIAKAITDELG---------
PURT_XANOR      SYCDPIGHWQQDG--DYRESWQP-----QPMSAAALRRSQEIAKAITDDLG---------
PURT_XANOM      SYCDPIGHWQQDG--DYRESWQP-----QPMSAAALRRSQEIAKAITDDLG---------
PURT_XANCP      SFCDPIGHWQKDG--DYRESWQP-----QPMSAAALRRSQEIAQAITDELG---------
PURT_XANC8      SFCDPIGHWQKDG--DYRESWQP-----QPMSAAALRRSQEIAQAITDELG---------
PURT_ALCBS      SYCAPIGHRQENG--DYQESWQP-----QPMSAAALQASREVALAITDALG---------
PURT_MARHV      TFCEPIGHRQEDG--DYRESWQP-----QPMNDLALQRSKEIARAVVEDLG---------
PURT_DESVH      TFCDPIGHLQKDG--DYRESWQP-----QPMDAVALEKARAMADAVTGALG---------
PURT_DESVV      TFCDPIGHLQKDG--DYRESWQP-----QPMDAVALEKARAMADAVTGALG---------
PURT_DESAG      SFCEPIGHRQEDG--DYRQSWQP-----QPMSAAALEQARHMAQAVTQALG---------
PURT_ACTP2      SFLAPIGHRQEDG--DYRESWQP-----QAMSDLALKRAQETAERITTALG---------
PURT_HAEDU      SFLAPIGHRQQNG--DYRESWQP-----QAMSEVALQKAQQIAERITTALG---------
PURT_MANSM      SFLAPIGHRQQNG--DYRESWQP-----QAMSEIALQKAQQVAEKITSALG---------
PURT_PASMU      SFLAPIGHIQIDG--DYRESWQP-----QAMSAVALEKAQAIAEKITGALG---------
PURT_HAES1      SFLAPIGHRQEKG--DYRESWQP-----QAMSVQALAKAQHIAEKITTELG---------
PURT_PARD8      SFLEPVGHVQVDG--DYRESWQP-----QAMSLAAKAKAREIAGKITEALG---------
PURT_HYDCU      SFCAPIGHIQEDG--DYRQSWQP-----HPMSDIAVQSAEKIALKITEALG---------
PURT_HAHCH      SFCDPIGHLQVDG--DYRVSWQP-----HPMSAIALGAAQDIAEKVTVALG---------
PURT_POLNA      HFCEPIGHLQVSG--DYVESWQP-----HPMRPAALEKSHEIARAVTDNLS---------
PURT_POLSJ      HFCEPIGHIQVSG--DYVESWQP-----HPMREAALQKSRAIAKAVTDDLG---------
PURT_RHOFT      HFCEPVGHLQVNG--DYVESWQP-----HPMHPAALERARHIAKTVTDDLGIAVDGQAS-
PURT_CUPNH      QFCAPIGHVQVSG--DYVESWQP-----QPMHPAALETAQRIAQAVTADLG---------
PURT_CUPPJ      QFCTPIGHVQVSG--DYVESWQP-----HPMHPAALQTAQHIARAVTSDLG---------
PURT_CUPMC      HFCEPIGHVQVAG--DYVESWQP-----HPMHPKALETSQHIARAVTADLG---------
PURT_ACIAC      SFCEPIGHKQVSG--DYVESWQP-----QPMPPLALQRARDIARAVTDDLGRGLDGQPS-
PURT_MYCS2      QFCEPIGHRQVGG--DYVESWQP-----HPMPATALERAQEIAGAVTGNLG---------
PURT_MYCVP      RFCEPIGHRQVSG--DYVESWQP-----HPMPGTALERARQIAGAVTRDLG---------
PURT_BORBR      QFCEPIGHRQVDG--DYVESWQP-----HPMSPAALQRSREIALAVTGDLG---------
PURT_BORPA      QFCEPIGHRQVDG--DYVESWQP-----HPMSPAALQRSREIALAVTGDLG---------
PURT_BORPE      QFCEPIGHRQVDG--DYVESWQP-----HPMSPVALQRSREIALAVTGDLG---------
PURT_BORA1      HFCDPIGHKQVDG--DYVESWQP-----HPMSPAALARAREIALGVTGNLG---------
PURT_BURCA      YFCEPVGHVQVAG--DYVESWQP-----QPMSAVALEKSREIAHKVTEALG---------
PURT_BURCH      YFCEPVGHVQVAG--DYVESWQP-----QPMSAVALEKSREIAHKVTEALG---------
PURT_BURL3      YFCEPVGHVQVAG--DYVESWQP-----QPMSAVALEKSREIAHKVTEALG---------
PURT_BURCM      YFCEPVGHVQVAG--DYVESWQP-----QPMSALALEKSREIAHKVTEALG---------
PURT_BURVG      YFCEPVGHVQVAG--DYVESWQP-----QPMSAAALQKSRDIAHKVTEALG---------
PURT_BURMA      SFCAPIGHLQVAG--DYVESWQP-----QPMSAKALERSRDIAHRVTSALG---------
PURT_BURM9      SFCAPIGHLQVAG--DYVESWQP-----QPMSAKALERSRDIAHRVTSALG---------
PURT_BURM7      SFCAPIGHLQVAG--DYVESWQP-----QPMSAKALERSRDIAHRVTSALG---------
PURT_BURMS      SFCAPIGHLQVAG--DYVESWQP-----QPMSAKALERSRDIAHRVTSALG---------
PURT_BURPS      SFCAPIGHLQVAG--DYVESWQP-----QPMSAKALERSRDIAHRVTSALG---------
PURT_BURP0      SFCAPIGHLQVAG--DYVESWQP-----QPMSAKALERSRDIAHRVTSALG---------
PURT_BURP1      SFCAPIGHLQVAG--DYVESWQP-----QPMSAKALERSRDIAHRVTSALG---------
PURT_BURP6      SFCAPIGHLQVAG--DYVESWQP-----QPMSAKALERARDIAHRVTSALG---------
PURT_BURTA      YFCEPIGHVQVAG--DYVESWQP-----QPMSAKALERSRDIAHRVTSALG---------
PURT_PARXL      YFCDPIGHVQVAG--DYVESWQP-----QPMSPLALERSREVAHKVTAALG---------
PURT_DECAR      HFCEPIGHVQVGG--DYVESWQP-----QAMSPAALQRAQEIAAAVTGNLG---------
PURT_THIDA      RFCAPIGHLQVKG--DYVESWQP-----QAMSPTALERAREIAAAVTGELG---------
PURT_METFK      SFCEPIGHLQEKG--DYVESWQP-----QPMTALALGRAQEIARAVTESLG---------
PURT_HERAR      HFCEPIGHLQVNG--DYVESWQP-----QAMHPGALQKAHDIAKKVTDNLG---------
PURT_JANMA      HFCEPIGHVQVNG--DYVESWQP-----QRMHPGALQKAHEIAKRVTDNLG---------
PURT_RHOJR      FFCEPIGHLQDSG--DYVESWQP-----QPMSDAALARSREVAEKVTAALG---------
PURT_METCA      AFCEPVGHRQQAG--DYVESWQP-----QSLNPKARERAEAIARTVVDALG---------
PURT_CORGL      WFCEPIGHRQEDG--DYVESWQP-----MEMTPRALENARSVAARITNALG---------
PURT_CORGB      WFCEPIGHRQEDG--DYVESWQP-----MEMTPRALENARSVAARITNALG---------
PURT_COREF      WFCEPIGHRQQDG--DYVESWQP-----MEMTAPALENARSVAARITNALG---------
PURT_CORJK      WFCEPIGHRQDRG--DYVESWQP-----AHMSEDALDTARSIAARIATALG---------
PURT_ACIBT      HYCDPIGHRQDAG--DYVESWQP-----QPMTPAALEEAKRIANKVTTALG---------
PURT_ACIAD      QYCDPIGHRQDAG--DYVESWQP-----QAMTDAALTEAKRIAHKVTVALG---------
PURT_GEOMG      TFCPPIGHVQIKG--DYHESWQP-----MAMTPAALAESQRQAKAVTDALG---------
PURT_PELPD      SFCPPIGHVQIKG--DYHESWQP-----MAMSPAALAEARRQAEAVTTALG---------
PURT_PELCD      SYCPPIGHRQEGG--DYQESWQP-----MPMTDKALAEAQRQAKVITEALG---------
PURT_FRATF      SFCDPIGHIQKDG--DYRFSWQP-----HTMPDTALAKSQEIAKEITDALG---------
PURT_FRATH      SFCDPIGHIQKDG--DYRFSWQP-----HTMPDTALAKSQEIAKEITDALG---------
PURT_FRATO      SFCDPIGHIQKDG--DYRFSWQP-----HTMPDTALAKSQEIAKEITDALG---------
PURT_FRATT      SFCDPIGHIQKDG--DYRFSWQP-----HTMPDTALAKSQEIAKEITDALG---------
PURT_FRAT1      SFCDPIGHIQKDG--DYRFSWQP-----HTMPDTALAKSQEIAKEITDALG---------
PURT_FRATW      SFCDPIGHIQKDG--DYRFSWQP-----HTMPDTALAKSQEIAKEITDALG---------
PURT_FRATN      SFCDPIGHIQKDG--DYRFSWQP-----HTMSDTALAKSQGIAKEITDALG---------
PURT_NOSS1      IFCSPIGHRQERG--DYQESWQP-----AGISEDKILEAQAIAKTVTDALGGAG------
PURT_TRIV2      IFCSPIGHRQERG--DYQESWQP-----AGISEDKILEAQAIAKKVTDALGGAG------
PURT_SYNP6      LFCPPIGHRQERG--DYQESWQP-----APLRPDLLAQAQAIAAQVTEALGGAG------
PURT_SYNE7      LFCPPIGHRQERG--DYQESWQP-----APLRPDLLAQAQAIAAQVTEALGGAG------
PURT_SYNY3      LFCDPIGHRQERG--DYQESWQP-----APLTQRQLAQAQAIAKTVTDALGGAG------
PURT_PROM3      LFCEPIGHEQIGG--DYQCSWQP-----AELSTEQLKQAQSMALSITENLGGVG------
PURT_PROMM      LFCEPIGHEQIGG--DYQCSWQP-----AELSTEQLKQAQSMALTITKNLGGVG------
PURT_SYNSC      LFCAPIGHEQEGG--DYQCSWQP-----AQLTDQQLHQAQAMAKTVTDNLGGAG------
PURT_SYNPX      LFCAPIGHEQEHG--DYQCSWQP-----AELSSEQLHQAQAMARTVTQNLGGVG------
PURT_SYNS9      LFCPPIGHEQERG--DYQCSWQP-----AQMSDAQLQQAQTMARTVTDNLGGAG------
PURT_SYNPW      LFCPPIGHEQARG--DYQCSWQP-----AALSDKQLSEAQAMARTVTDNLGGAG------
PURT_SYNS3      LFCPPIGHQQANG--DYQCSWQP-----ASISPSQLQQAQTMARTVTDNLGGAG------
PURT_SYNR3      LFCPPIGHIQERG--DYQCSWQP-----AELQQSQLLEAQRMARQVTDALGGAG------
PURT_PROM1      LFCAPIGHEQKNG--DYQCSWQP-----AELTESVLEKAQQIAKRVTDNLGGVG------
PURT_PROMT      LFCAPIGHEQKNG--DYQCSWQP-----AELTESVLEKAQQIAKRVTDNLGGVG------
PURT_PROMA      IFCPPIGHEQKGG--DYQCSWQP-----QKLSFDQLKEAKSIAKKVTNELGGIG------
PURT_PROMS      IFCLPIGHLQSNG--DYQCSWQP-----LEIKESLIIEAKRMTSRILNNLNGAG------
PURT_PROM0      IFCLPIGHLQSNG--DYQCSWQP-----LEIKDSLIIEAKRMTSRILNNLNGAG------
PURT_PROM9      IFCLPIGHLQSNG--DYQCSWHP-----LEINQSLISEAKKMTTKILNNLNGSG------
PURT_PROM5      VFCEPIGHEQYKG--DYQCSWQP-----LDMNESLINEARNMTNKILNNLNGSG------
PURT_PROMP      IFCEPIGHEQYKG--DYQCSWQP-----LDMNQSLINEARKMTTKILNNLNGSG------
PURT_BACFR      LFCPPIGHVQKGG--DYRESFQP-----AHIDPAHLKEAEDMAEKVTRALTGAG------
PURT_BACFN      LFCPPIGHVQKGG--DYRESFQP-----AHIDPAHLKEAEDMAEKVTRALTGAG------
PURT_BACTN      LFCPPIGHVQKGG--DYRESFQP-----AHIDPAHLKEAEEMAEKVTRALTGAG------
PURT_BACV8      LFCPPIGHVQKGG--DYRESFQP-----AHIDPEHLKEAQRMADKVTAALTGAG------
PURT_CHLPD      LFCPPIGHRQERG--DYQESWQP-----CRIGDAQLHEAQEIAEKVTRSLTGAG------
PURT_CHLTE      LFCPPIGHRQERG--DYQESWQP-----CRISPEQLEEAQNIAGKVTEALTGAG------
PURT_LEPBJ      LFCPPIGHRQERG--DYQESWQP-----AEISEVQLKEAQRMAEAVTKELTGFG------
PURT_LEPBL      LFCPPIGHRQERG--DYQESWQP-----AEISEVQLKEAQRMAEAVTKELTGFG------
PURT_LEPIN      LFCPPIGHRQERG--DYQESWQP-----AAISEVQLKEAQRMADAVTKELTGFG------
PURT_LEPIC      LFCPPIGHRQERG--DYQESWQP-----AAISEVQLKEAQRMADAVTKELTGFG------
PURT_FLAPJ      LFCAPIGHRQERG--DYQESWQP-----ARISDKDLHEAQDMARKVTEALGGAG------
PURT_ANADE      LFCPPIGHRQERG--DYQESWQP-----HPVPPPLLEEARRMAGAVTRALGGAG------
PURT_ERYLH      TFCPPIGHRQERG--DYRESWQP-----ATMSKPAIAAAQEMAEKVVTALQGNGKG----
PURT_BIFAA      VTCAPIGQRQESG--DYRESWQP-----ATFTPDVLEQAQHIARTAVEGLVAKAQASGEK
PURT_BIFLO      VTCAPIGQRQESG--DYRESWQP-----ATEPDGEAERARDIARTAVEGLVAKAQAAGET
PURT_SULAC      KTIYPVEHQRPQGVYHYIESWHP-----ATVSQDVISKASEYATKVVNELG---------
PURT_SULTO      KTITPIEHQRPSDVYYYVESWHP-----STVDKDIIERAQEYATRVVNELG---------
PURT_SACS2      KTIEPIEHKRPS--YYYVESWHP-----SNVSQGVKETARGIAQKVAEELG---------
PURT_IGNH4      VPLPPVEHKRPKGIYYYYESWHP-----ATVNDEVVKKAKDIAVKVVNELG---------
PURT_PYRAB      TFPKPVGHYQIDG--DYHASWQP-----AEISEKAEREVYRIAKRITDVLG---------
PURT_PYRFU      TFPKPVGHYQIDG--DYHASWQP-----AEISEKAEREVYRIAKRITDVLG---------
PURT_PYRHO      TFPKPVGHYQIDG--DYHASWQP-----AEISEKAEREVYRIAKRITDVLG---------
PURT_THEKO      TFPKPVGHYQIDG--DYHSSWQP-----AEISERAEREVYRIAKRITDVLG---------
PURT_METAR      KFVRPLGHYQIEG--DYHASWHPWTDATDKKIDKLEKEIYDYAGRIMDKLG---------
                    *: : :      :  *::*                   :      *          

PURT_NITSB      GRGIFGVELFVK--GDEVYFSEVSPRPHDTGMVTMI-TQ-SQSEFALHVRAVLGLGLGF-
PURT_SULDN      GRGLFGVELFIK--GDEVYFSEVSPRPHDTGMVTLI-TQ-SQSEFALHLRAVLGLPLEF-
PURT_SULNB      GRGIFGVEFFVK--DEEVYFSELSPRPHDTGMVTLI-TQ-SQSEFALHVRAVLGLPLDF-
PURT_WOLSU      GRGIFGVELFIK--KNEVYFSEVSPRPHDTGMVTLI-TQ-NFSEFALHLRAVLGAPLHV-
PURT_METM5      GYGIFGVELFVL--DDEVIFSEVSPRPHDTGMVTMV-TQ-KMSEFEIHARAILGLPVNV-
PURT_METM7      GYGIFGVELFVL--DDEVIFSEVSPRPHDTGMVTMV-TQ-KMSEFEIHARAILGLPVNV-
PURT_METMP      GYGIFGVELFVL--DDEVIFSEVSPRPHDTGMVTMV-TQ-KMSEFEIHARAILGLPVNV-
PURT_METVS      GYGIFGVELFIM--DDEVIFSEVSPRPHDTGMVTMV-TQ-KMSEFEIHVRSILGLPVNV-
PURT_META3      GNGIFGVELFIR--GDEVIFSEVSPRPHDTGMVTMI-TQ-NMSEFEIHLRSILGLPVDI-
PURT_METJA      GYGIFGVELFVK--GDEVIFSEVSPRPHDTGMVTMI-TQ-EMSEFEIHVRAILGLPVST-
PURT_BACSU      GYGLFGVELFLA--KDRVYFSEVSPRPHDTGLVTLV-TQ-NLSEFALHVRAILGFPITE-
PURT_BACVZ      GYGLFGVELFLT--EDKVYFSEVSPRPHDTGLVTLV-TQ-NLSEFALHVRAVLGFPIPE-
PURT_HALWD      GYGIFGVEFFVQ--DGTVIFSELSPRPHDTGLVTLS-SQ-RLSQFDLHLRAILGLPIPD-
PURT_ECOLI      GYGLFGVELFVC--GDEVIFSEVSPRPHDTGMVTLI-SQ-DLSEFALHVRAFLGLPVGG-
PURT_SHISS      GYGLFGVELFVC--GDEVIFSEVSPRPHDTGMVTLI-SQ-DLSEFALHVRAFLGLPVGG-
PURT_SHIBS      GYGLFGVELFVC--SDEVIFSEVSPRPHDTGMVTLI-SQ-DLSEFALHVRAFLGLPVGG-
PURT_ECOUT      GYGLFGVELFVC--GDEVIFSEVSPRPHDTGMVTLI-SQ-DLSEFALHVRAFLGLPVGG-
PURT_ECOK1      GYGLFGVELFVC--GDEVIFSEVSPRPHDTGMVTLI-SQ-DLSEFALHVRAFLGLPVGG-
PURT_ECOL5      GYGLFGVELFVC--GDEVIFSEVSPRPHDTGMVTLI-SQ-DLSEFALHVRAFLGLPVGG-
PURT_ECO57      GYGLFGVELFVC--GDEVIFSEVSPRPHDTGMVTLI-SQ-DLSEFALHVRAFLGLPVGG-
PURT_SHIDS      GYGLFGVELFVC--GDEVIFSEVSPRPHDTGMVTLI-SQ-DLSEFALHVRAFLGLPVGG-
PURT_SHIFL      GYGLFGVELFVC--GDEVIFSEVSPRPHDTGMVTLI-SQ-DLSEFALHVRAFLGLPVGG-
PURT_SHIF8      GYGLFGVELFVC--GDEVIFSEVSPRPHDTGMVTLI-SQ-DLSEFALHVRAFLGLPVGG-
PURT_SALPA      GHGLFGVELFVC--GDEVIFSEVSPRPHDTGMVTLI-SQ-DLSEFALHVRAFLGMPIGA-
PURT_SALTI      GHGLFGVELFVC--GDEVIFSEVSPRPHDTGMVTLI-SQ-DLSEFALHVRAFLGMPIGA-
PURT_SALCH      GHGLFGVELFVC--GDEVIFSEVSPRPHDTGMVTLI-SQ-DLSEFALHVRAFLGMPIGA-
PURT_SALTY      GHGLFGVELFVC--GDEVIFSEVSPRPHDTGMVTLI-SQ-DLSEFALHVRAFLGMPVGA-
PURT_CROS8      GYGLFGVELFVC--GDEVIFSEVSPRPHDTGMVTLI-SQ-DLSEFALHVRAFLGLPVGG-
PURT_YERPE      GFGLFGVELFVC--GDDVIFSEVSPRPHDTGMVTLI-SQ-NMSEFALHVRAFLGLPIGT-
PURT_YERPA      GFGLFGVELFVC--GDDVIFSEVSPRPHDTGMVTLI-SQ-NMSEFALHVRAFLGLPIGT-
PURT_YERPN      GFGLFGVELFVC--GDDVIFSEVSPRPHDTGMVTLI-SQ-NMSEFALHVRAFLGLPIGT-
PURT_YERPP      GFGLFGVELFVC--GDDVIFSEVSPRPHDTGMVTLI-SQ-NMSEFALHVRAFLGLPIGT-
PURT_YERPS      GFGLFGVELFVC--GDDVIFSEVSPRPHDTGMVTLI-SQ-NMSEFALHVRAFLGLPIGT-
PURT_YERE8      GYGLFGVELFVC--GDEVIFSEVSPRPHDTGMVTLI-SQ-NMSEFALHVRAFLGLPIGT-
PURT_PECAS      GYGLFGVELFVC--GDEVIFSEVSPRPHDTGMVTMI-SQ-DLSEFALHVRAFLGLPIGA-
PURT_SODGM      GKGLFGVELFIC--GDDVIFSEVSPRPHDTGMVTLI-SQ-DLSEFALHVRAFLGLPIGT-
PURT_WIGBR      GYGIFGVEFFIY--KDKVIFSEISPRPHDTGMVTLI-SQ-NLSEFALHVRSFLKLPIGK-
PURT_AERHH      GYGLFGVELFIK--GDEVWFSEVSPRPHDTGMVTLI-SQ-DLSEFALHVRAILGLPVGT-
PURT_AERS4      GYGLFGVELFIR--GDEVWFSEVSPRPHDTGMVTLI-SQ-DLSEFALHVRAILGLPIGT-
PURT_PSYIN      GYGLFGMEFFVK--GDQVYFSEVSPRPHDTGLVTLV-SQ-DASEFALHVRAILGFPIGR-
PURT_VIBCB      GYGIFGVELFVK--GDKVIFNEVSPRPHDTGMVTMI-SQ-EMSEFTLHVHAFTGMPINN-
PURT_VIBPA      GYGIFGVELFVK--GDKVIFNEVSPRPHDTGMVTMI-SQ-EMSEFALHVRAFTGMPINK-
PURT_VIBVU      GYGIFGVELFVK--GDKVIFNEVSPRPHDTGLVTLI-SQ-EMSEFALHVRAFTGMPVNK-
PURT_VIBVY      GYGIFGVELFVK--GDKVIFNEVSPRPHDTGLVTLI-SQ-EMSEFALHVRAFTGMPVNK-
PURT_VIBCH      GYGLFGVELFVK--GDKVIFNEVSPRPHDTGMVTLI-SQ-ELSEFALHVRAFTGLPIGQ-
PURT_ALIF1      GYGLFGVELFIK--GDNIYFNEVSPRPHDTGLVTLI-SQ-EMSEFALHVRAFTGMPINQ-
PURT_PHOPR      GYGLFGVELFVR--GNEVLFNEVSPRPHDTGMVTLI-SQ-DLSEFALHVRAFLGLPIQQ-
PURT_SHEB5      GYGLFGVELFVK--GHEVYFSEVSPRPHDTGLVTLI-SQ-DLSEFALHVRAILGLPIPN-
PURT_SHEB8      GYGLFGVELFVK--GHEVYFSEVSPRPHDTGLVTLI-SQ-DLSEFALHVRAIQGLPIPN-
PURT_SHEPC      GYGLFGVELFVK--GHEVYFSEVSPRPHDTGLVTLI-SQ-DLSEFALHVRAILGLPIPN-
PURT_SHESW      GYGLFGVELFVK--GNEVYFSEVSPRPHDTGLVTLI-SQ-DLSEFALHVRAILGLPIPN-
PURT_SHESM      GYGLFGVELFVK--GSDVYFSEVSPRPHDTGLVTLI-SQ-DLSEFALHVRAILGLPIPN-
PURT_SHESR      GYGLFGVELFVK--GNDVYFSEVSPRPHDTGLVTLI-SQ-DLSEFALHVRAILGLPIPN-
PURT_SHESA      GYGLFGVELFVK--GSDVYFSEVSPRPHDTGLVTLI-SQ-DLSEFALHVRAILGLPIPN-
PURT_SHEON      GYGLFGVELFVK--GSDVYFSEVSPRPHDTGLVTLI-SQ-DLSEFALHVRAILGLPIPN-
PURT_SHEFN      GYGLFGVELFIR--GDEVYFSEVSPRPHDTGLVTLI-SQ-DLSEFALHVRAILGLPISN-
PURT_SHEAM      GFGLFGVELFIK--GDEVYFSEVSPRPHDTGMVTLI-SQ-DLSEFALHVRAILGLPVGT-
PURT_PSEAE      GRGLFGVELFVK--GDQVWFSEVSPRPHDTGLVTLI-SQ-DLSEFALHARAILGLPIPV-
PURT_PSEAB      GRGLFGVELFVK--GDQVWFSEVSPRPHDTGLVTLI-SQ-DLSEFALHARAILGLPIPV-
PURT_AZOSB      GRGLFGVELFIK--GDMVWFSEVSPRPHDTGLVTLI-SQ-DLSEFALHARAILGLPIPA-
PURT_PSEE4      GRGLFGVELFVK--GDQVWFSEVSPRPHDTGLVTLI-SQ-ELSQFALHARAILGLPIPV-
PURT_PSEPK      GRGLFGVELFVK--GDQVWFSEVSPRPHDTGLVTLI-SQ-DLSQFALHARAILGLPIPV-
PURT_PSEF5      GRGLFGVELFIK--GDQVWFSEVSPRPHDTGLVTLI-SQ-DLSQFALHARAILGLPIPL-
PURT_PSEPF      GRGLFGVELFIK--GDQVWFSEVSPRPHDTGLVTLI-SQ-DLSQFALHARAILGLPVPL-
PURT_PSE14      GRGMFGVELFIK--GDQVWFSEVSPRPHDTGLVTLI-SQ-DLSQFALHARAILGLPIPL-
PURT_PSEU2      GRGMFGVELFIK--GDQVWFSEVSPRPHDTGLVTLI-SQ-DLSQFALHARAILGLPIPL-
PURT_PSESM      GRGMFGVELFIK--GDQVWFSEVSPRPHDTGLVTLI-SQ-DLSQFALHARAILGLPIPL-
PURT_PSEU5      GRGIFGVELFVK--GEQVWFCEISPRPHDTGLVTLV-SQ-DLSEFALHARAILGLPIPV-
PURT_XANAC      GRGLFGVELFVK--GDEVWFSEVSPRPHDTGLVTLV-SQ-ELSEFALHARAILGLPVGAQ
PURT_XANC5      GWGLFGVELFVK--GDEVWFSEVSPRPHDTGLVTLV-SQ-DLSEFALHARAILGLPVGAQ
PURT_XANOR      GWGLFGVELFVK--GDEVWFSEVSPRPHDTGLVTLV-SQ-ELSEFALHARAILGLPVGAE
PURT_XANOM      GWGLFGVELFVK--GDEVWFSEVSPRPHDTGLVTLV-SQ-ELSEFALHARAILGLPVGAE
PURT_XANCP      GWGLFGVELFVK--GDEVWFSEVSPRPHDTGLVTLV-SQ-ELSEFALHARAILGLPVGAE
PURT_XANC8      GWGLFGVELFVK--GDEVWFSEVSPRPHDTGLVTLV-SQ-ELSEFALHARAILGLPVGAE
PURT_ALCBS      GLGIFGVELFIK--GDQVYFSEVSPRPHDTGLVTLI-SQ-TLSEFALHARAILGLPIPT-
PURT_MARHV      GYGIYGVELFVK--GENVWFSEVSPRPHDTGLVTLV-SQ-DLSEFAIHARAILGIPVPV-
PURT_DESVH      GWGIFGVELFVR--GDEVWFSEVSPRPHDTGLVTLI-SQ-NMSEFALHVRAILGLPVPL-
PURT_DESVV      GWGIFGVELFVR--GDEVWFSEVSPRPHDTGLVTLI-SQ-NMSEFALHVRAILGLPVPL-
PURT_DESAG      GYGLFGVELFIK--GDTVWFSEVSPRPHDTGLVTIA-SQ-NLSEFALHVRAVLGLPVPV-
PURT_ACTP2      GRGIFGVELFVC--GDEIIFNEVSPRPHDTGMVTMA-SQ-ELSQFALHARAILGLPIPE-
PURT_HAEDU      GRGIFGVELFVC--GDDIIFNEVSPRPHDTGMVTMA-SQ-ELSQFALHARAILGLPIPH-
PURT_MANSM      GRGIFGVEMFVC--GDEVIFNEVSPRPHDTGMVTLI-SQ-ELSEFALHARAILGLPIPE-
PURT_PASMU      GRGIFGVEMFVC--GDEVIFNEVSPRPHDTGMVTLI-SQ-ELSEFALHARAILGLPIPD-
PURT_HAES1      GRGIFGVEMFVC--GDEVIFNEVSPRPHDTGMVTLI-SQ-ELSEFALHARAILGLPIPE-
PURT_PARD8      GRGIFGVELFIK--GDDVIFSEVSPRPHDTGMVTMI-TQ-DLSQFALHARAVLGLPIPN-
PURT_HYDCU      GWGLFGVELFIK--DDQVIFSEVSPRPHDTGLVTLI-SQ-DLSEFALHLRAILGLPIPN-
PURT_HAHCH      GCGIFGVELFVK--GDEVYFSEVSPRPHDTGLVTLV-SQ-NLSEFALHARALLGLPVPL-
PURT_POLNA      GQGVFGVELFVK--GDEVWFSEVSPRPHDTGMVTLC-TQ-WQNEFELHARAILGLPVDT-
PURT_POLSJ      GQGLFGVELFVK--GDEVWFSEVSPRPHDTGMVTMC-TQ-WQNEFELHARAILGLPVNT-
PURT_RHOFT      GLGIFGVELFVK--GEQVWFSEVSPRPHDTGLVTLT-TQ-WQSEFELHARAILGLPVNT-
PURT_CUPNH      GMGLFGVELFVK--GEQVWFSEVSPRPHDTGMVTMA-TQ-WQNEFELHARAILGLPVDT-
PURT_CUPPJ      GQGLFGVELFVK--GEQVWFSEVSPRPHDTGMVTMA-TQ-WQNEFELHARAILGLPVST-
PURT_CUPMC      GQGLFGVELFVK--GEQVWFSEVSPRPHDTGMVTMI-TQ-WQNEFELHARAILGLPVST-
PURT_ACIAC      GQGLFGVELFVK--GDEVWFSEVSPRPHDTGLVTLA-TQ-HQSEFELHARAILGLPVDT-
PURT_MYCS2      GQGIFGVELFVK--GDQVWFSEVSPRPHDTGMVTMV-TQ-WQNEFELHARAILGLPVDT-
PURT_MYCVP      GQGIFGVELFVK--GDQVWFSEVSPRPHDTGMVTMV-TQ-WQNEFELHARAILGLPVDT-
PURT_BORBR      GLGIFGVELFVA--GDQVWFSEVSPRPHDTGMVTLI-SQ-VQNEFELHARALLGLPVDT-
PURT_BORPA      GLGIFGVELFVA--GDQVWFSEVSPRPHDTGMVTLI-SQ-VQNEFELHARALLGLPVDT-
PURT_BORPE      GLGIFGVELFVA--GDQVWFSEVSPRPHDTGMVTLI-SQ-VQNEFELHARALLGLPVDT-
PURT_BORA1      GLGIFGVELFVA--GDQVWFSEVSPRPHDTGMVTMI-TQ-VQNEFELHARALLGLPVDT-
PURT_BURCA      GRGLFGVELFVR--GDDVWFSEVSPRPHDTGLVTLA-SQ-RQSEFELHARAILGLPVDP-
PURT_BURCH      GRGLFGVELFVR--GDDVWFSEVSPRPHDTGLVTLA-SQ-RQSEFELHARAILGLPVDP-
PURT_BURL3      GRGMFGVELFVN--GDDVWFSEVSPRPHDTGLVTLA-SQ-RQSEFELHARAILGLPVDP-
PURT_BURCM      GRGLFGVELFVR--GDDVWFSEVSPRPHDTGLVTLA-SQ-RQSEFELHARAILGLPVDP-
PURT_BURVG      GRGLFGVELFVR--GDDVWFSEVSPRPHDTGLVTLA-SQ-RQSEFELHARAILGLPVDP-
PURT_BURMA      GRGIFGVELFVR--GDDVWFSEVSPRPHDTGLVTLA-SQ-RQSEFELHARAILGLPVEP-
PURT_BURM9      GRGIFGVELFVR--GDDVWFSEVSPRPHDTGLVTLA-SQ-RQSEFELHARAILGLPVEP-
PURT_BURM7      GRGIFGVELFVR--GDDVWFSEVSPRPHDTGLVTLA-SQ-RQSEFELHARAILGLPVEP-
PURT_BURMS      GRGIFGVELFVR--GDDVWFSEVSPRPHDTGLVTLA-SQ-RQSEFELHARAILGLPVEP-
PURT_BURPS      GRGIFGVELFVR--GDDVWFSEVSPRPHDTGLVTLA-SQ-RQSEFELHARAILGLPVEP-
PURT_BURP0      GRGIFGVELFVR--GDDVWFSEVSPRPHDTGLVTLA-SQ-RQSEFELHARAILGLPVEP-
PURT_BURP1      GRGIFGVELFVR--GDDVWFSEVSPRPHDTGLVTLA-SQ-RQSEFELHARAILGLPVEP-
PURT_BURP6      GRGIFGVELFVR--GDDVWFSEVSPRPHDTGLVTLA-SQ-RQSEFELHARAILGLPVEP-
PURT_BURTA      GRGIFGVELFVR--GDDVWFSEVSPRPHDTGLVTLA-SQ-RQSEFELHARAILGLPVEP-
PURT_PARXL      GRGLFGVELFVR--GDDVWFSEVSPRPHDTGLVTLC-SQ-RFSEFELHARAILGLPVDT-
PURT_DECAR      GRGLFGVELFVK--GDMVWFSEVSPRPHDTGLVTLC-SQ-RFSEFELHARAILGLPVDT-
PURT_THIDA      GRGLFGVELFVK--GDTVWFSEVSPRPHDTGMVTLA-TQ-RQNEFELHARAILGLPVDT-
PURT_METFK      GLGLFGVELFVK--GDQVWFSEVSPRPHDTGMVTMG-SQ-RFSEFDLHARAILGLPVNV-
PURT_HERAR      GLGLFGVELFVK--HDMVWFSEVSPRPHDTGMVTMA-SQ-EQSEFELHAKAILGLPVNV-
PURT_JANMA      GLGLFGVELFVK--DDMVWFSEVSPRPHDTGMVTMA-SQ-EQSEFELHAKAILGLPVNV-
PURT_RHOJR      GRGIFGVELFVK--GDDVYFSEVSPRPHDTGLVTLR-TQ-RLSEFELHARAILGLPVDT-
PURT_METCA      GRGLFGVELFVR--GDEVWFSEVSPRPHDTGMVTMV-SQ-AQNEFELHVRAILGLPVDS-
PURT_CORGL      GRGVFGVELFVS--GDDVYFSEVSPRPHDTGLVTLA-TQ-RFSEFELHAKAILGLPVDV-
PURT_CORGB      GRGVFGVELFVS--GDDVYFSEVSPRPHDTGLVTLA-TQ-RFSEFELHAKAILGLPVDV-
PURT_COREF      GRGVFGVELFVS--GDDVYFSEVSPRPHDTGLVTLA-TQ-RFSEFELHAKAVLGLPVDV-
PURT_CORJK      GRGVYGVELFVK--GDDVYFSEVSPRLHDTGMVTLG-TQ-RFSEFDLHARAILGLPIDT-
PURT_ACIBT      GCGIFGVELFIK--GDKVWFSEVSPRPHDTGLVTLA-SQ-FQSEFELHARAILGLPVNT-
PURT_ACIAD      GCGIFGVELFIK--GDHVWFSEVSPRPHDTGLVTLA-SQ-FQSEFELHARAILGLPVNT-
PURT_GEOMG      GSGIFGVELFIK--GDRVWFSEVSPRPHDTGMVTMI-SQ-NLSEFELHVRAILGLPVPE-
PURT_PELPD      GYGLFGVELFIS--NDRVLFSEVSPRPHDTGMVTMI-SQ-NLSQFELHVRAILGLPVGE-
PURT_PELCD      GAGLFGVEFFIQ--GDTVYFSEVSPRPHDTGMVTMA-TQ-NMSEFELHVRAVLGLPIPA-
PURT_FRATF      GYGVFGVELFIK--GDEVFFNEVSPRPHDTGMVTLI-SQ-NINEFELHLRAIVGLPIPD-
PURT_FRATH      GYGVFGVELFIK--GDEVFFNEVSPRPHDTGMVTLI-SQ-NINEFELHLRAIVGLPIPD-
PURT_FRATO      GYGVFGVELFIK--GDEVFFNEVSPRPHDTGMVTLI-SQ-NINEFELHLRAIVGLPIPD-
PURT_FRATT      GYGVFGVELFIK--GDEVFFNEVSPRPHDTGMVTLI-SQ-NINEFELHLRAIVGLPIPD-
PURT_FRAT1      GYGVFGVELFIK--GDEVFFNEVSPRPHDTGMVTLI-SQ-NINEFELHLRAIVGLPIPD-
PURT_FRATW      GYGVFGVELFIK--GDEVFFNEVSPRPHDTGMVTLI-SQ-NINEFELHLRAIVGLPIPD-
PURT_FRATN      GYGVFGVELFIK--GDEVFFNEVSPRPHDTGMVTLI-SQ-NINEFELHLRAIVGLPIPD-
PURT_NOSS1      ---IFGVEFFIT--KDEVIFSELSPRPHDTGMVTLI-SQ-NLNEFELHLRAILGLPIPK-
PURT_TRIV2      ---IFGVEFFIT--KDEVIFSELSPRPHDTGMVTLI-SQ-NLNEFELHLRAILGLPIPK-
PURT_SYNP6      ---LFGVEFFVT--PDEVIFSELSPRPHDTGMVTLI-SQ-NLNEFELHLRAVLGLPIPA-
PURT_SYNE7      ---LFGVEFFVT--PDEVIFSELSPRPHDTGMVTLI-SQ-NLNEFELHLRAVLGLPIPA-
PURT_SYNY3      ---IFGVEFFIT--PEEVIFSELSPRPHDTGMVTLI-SQ-NLNEFELHLRAILGLPIPQ-
PURT_PROM3      ---LFGVEFFLC--GNEVIFSELSPRPHDTGLVTLI-SQ-NLSEFELHLRAVLKLPIPT-
PURT_PROMM      ---LFGVEFFLC--GNEVIFSELSPRPHDTGLVTLI-SQ-NLSEFELHLRAVLNLPIPT-
PURT_SYNSC      ---LFGVEFFLC--DDEVIFSELSPRPHDTGLVTLI-SQ-NLSEFELHLRAVLGLPIPA-
PURT_SYNPX      ---LFGVEFFLC--GDEVIFSELSPRPHDTGLVTLI-SQ-NLSEFELHLRAVLGLPIPS-
PURT_SYNS9      ---LFGVEFFLC--GNEVIFSELSPRPHDTGLVTLI-SQ-NLSEFELHLRAVLNLPIPQ-
PURT_SYNPW      ---LFGVEFFLC--GDEVIFSELSPRPHDTGLVTLI-SQ-NLNEFELHLRAVLGLPIPA-
PURT_SYNS3      ---LFGVEFFLC--GDEVVFSELSPRPHDTGLVTLI-SQ-NLSEFDLHLRAVLGLPIPS-
PURT_SYNR3      ---IFGVEFFIA--SGEVIFSELSPRPHDTGLVTLR-GQ-NLSEFELHLRAVLGLPIPS-
PURT_PROM1      ---LFGVEFFIK--GEEVIFSELSPRPHDTGLVTLI-SQ-NLNEFELHLRAVLGIPIPE-
PURT_PROMT      ---LFGVEFFIK--GEEVIFSELSPRPHDTGLVTLI-SQ-NLNEFELHLRAVLGIPIPE-
PURT_PROMA      ---LFGVEFFIR--GEEVIFSELSPRPHDTGLVTLI-SQ-NLNEFELHLRAILGLPIPS-
PURT_PROMS      ---LYGVEFFIK--GSEVIFSELSPRPHDTGMVTLV-SQ-NINEFELHLRAFLNLPIPR-
PURT_PROM0      ---LYGVEFFIK--GSEVIFSELSPRPHDTGMVTLV-SQ-NINEFELHLRAFLDLPIPH-
PURT_PROM9      ---LYGVEFFVK--ENEVIFSELSPRPHDTGMVTLV-SQ-NINEFELHLRAFLNLPIPH-
PURT_PROM5      ---IYGVEFFVR--GKEVIFSELSPRPHDTGMVTLV-SQ-NLNEFELHLRAFLNLPIPK-
PURT_PROMP      ---IYGVEFFVR--GKEVIFSELSPRPHDTGMVTLV-SQ-NINEFELHLRAFLNLPIPN-
PURT_BACFR      ---LWGVEFFLSH-ENGVYFSELSPRPHDTGMVTLAGTQ-NLNEFELHLRAVLGLPIPG-
PURT_BACFN      ---LWGVEFFLSH-ENGVYFSELSPRPHDTGMVTLAGTQ-NLNEFELHLRAVLGLPIPG-
PURT_BACTN      ---LWGVEFFLSH-ENGVYFSELSPRPHDTGMVTLAGTQ-NLNEFELHLRAVLGLPIPG-
PURT_BACV8      ---IWGVEFFLSH-ENGVYFSELSPRPHDTGMVTLAGTQ-NLNEFELHLRAVLGLPIPE-
PURT_CHLPD      ---IWGVEFFLA--DDGLYFSELSPRPHDTGMVTLAGTQ-NFTEFELHARAVLGLPIPK-
PURT_CHLTE      ---IWGVEFFLA--DDGVYFSELSPRPHDTGMVTLAGTQ-NLSEFELHARAVLGLPVPD-
PURT_LEPBJ      ---IWGVEFFLT--EDQVYFSELSPRPHDTGMVTLSGTQ-NFNEFELHIRAILGIPIPE-
PURT_LEPBL      ---IWGVEFFLT--EDQVYFSELSPRPHDTGMVTLSGTQ-NFNEFELHIRAILGIPIPE-
PURT_LEPIN      ---IWGVEFFLT--EDKVYFSELSPRPHDTGMVTLAGTQ-NFNEFELHLRAILGIPILE-
PURT_LEPIC      ---IWGVEFFLT--EDKVYFSELSPRPHDTGMVTLAGTQ-NFNEFELHLRAILGIPILE-
PURT_FLAPJ      ---LFGVEFFLT--NDGVYFSELSPRPHDTGMVTLAGTQ-NFNEFELHLRAILSLPIFD-
PURT_ANADE      ---IFGVEFFLA--KDRIWFSELSPRPHDTGMVTLAGTQ-PLNEFELHLRAVLGLPIPP-
PURT_ERYLH      -FGLFGVEFFVK--GEEVIFSELSPRPHDTGMVTSV-SQ-NLSEFDLHARAIMGLHVPS-
PURT_BIFAA      GWGVFGVELFVLT-DGNVLFNEVSPRPHDTGMVTMA-SQ-RLSEFALHARAILGLPITQ-
PURT_BIFLO      GWGVFGVELFVLT-DGSILFNEVSPRPHDTGMVTMA-SQ-RLSEFALHARAILGLPITP-
PURT_SULAC      GFGIFGVEIMIAGN--RVLFNEVAPRPHDTGLVTLVSS--DISEFQVHVRSALGLPTPDV
PURT_SULTO      GFGIFGVEIIVSGN--RVLFSEVSPRPHDTGLVTMASL--DINEFQIHVRSALGLPTPEV
PURT_SACS2      GLGIYGVEIIVSGN--RILFSEVAPRPHDTGLVTLASS--DINEFQIHVRSAIGLPTPEV
PURT_IGNH4      GLGIFGVEILVTKDG-RVLFSEVSPRPHDTGLVTLASM--ELSEFAIHARAVLGLPVPEP
PURT_PYRAB      GLGLFGVEMFVKGD--KVWANEVSPRPHDTGMVTLASHPPGFSEFGLHLRAVLGLPIPGE
PURT_PYRFU      GLGLFGVEMFVKGD--KVWANEVSPRPHDTGMVTLASHPPGFSEFGLHLRAVLGLPIPGE
PURT_PYRHO      GLGIFGVEMFVKGD--KVWANEVSPRPHDTGMVTLASHPPGFSEFALHLRAVLGLPIPGE
PURT_THEKO      GLGIFGVEMFVKGD--KVWANEVSPRPHDTGMVTLASHPTGFSEFGLHLRAVLGLPIPGE
PURT_METAR      GYGLFAHEMFVDTKNGKVYANETACRPHDTGLVTIASMPFGYSEFALHAKAVLGIPIACE
                   ::. *:::      :   * : * ****:**        .:* :* ::         

PURT_NITSB      --------TFYTPGASAAYKAKHE-----SFTPVIEADESVFDQ--ESFLRVFGKPESHE
PURT_SULDN      --------TFYGEGASAAFKSEVH-----NFSPVIHVDESLFSK--NSFVRIFGKPEAHK
PURT_SULNB      --------TFYGAGACGAYKAKNE-----SHNPVLEIPDDAFTK--DSFVRVFGKPESHV
PURT_WOLSU      --------ERISAGASAAFKSSQE-----SQTPSVTLPKEAYAK--DCDFRVFGKPVSHE
PURT_METM5      --------DILFPGASHVIKSEIL------KWAPEYEIHEASKV-KDTKIRLFGKPIAKV
PURT_METM7      --------DILFPGASHVIKSEIL------KWAPEYEIHEASKV-KDTKIRLFGKPIAKV
PURT_METMP      --------DIVSPGASHVIKSEIL------KWAPEYEIHEASKV-KDTKIRLFGKPIAKV
PURT_METVS      --------DLSYPGASYVIKSEIY------KWAPEYDIIEASKL-KDTKIRLFGKPVAKI
PURT_META3      --------QLITAGASSVIKSKIH------KYAPQYDISDAVKV-PNTKLRIFGKPLAKV
PURT_METJA      --------KLIHPGASHVIKAEIN------KYAPKYHIEDALKV-PNTKLRLFGKPNAKV
PURT_BACSU      -------ITQLSPGASRPLKAPEE-----LADYTVEGLENALAV-PKTQVRVFGKPITKA
PURT_BACVZ      -------ITQLSPGASRPLKAPKE-----LADYAVEGLEKALAV-KSTQVRVFGKPVTKV
PURT_HALWD      -------IDVERPGASAALVVDEP-----LTRPAFTGVDEALSM-SDVDIRLFGKPEAYP
PURT_ECOLI      -------IRQYGPAASAVIL-PQL----TSQNVTFDNVQNAVGA--DLQIRLFGKPEIDG
PURT_SHISS      -------IRQYGPAASAVIL-PQL----TSQNVTFDNVQNAVGA--DLQIRLFGKPEIDG
PURT_SHIBS      -------IRQYGPAASAVIL-PQL----TSQNVTFDNVQNAVGA--DLQIRLFGKPEIDG
PURT_ECOUT      -------IRQYGPAASAVIL-PQL----TSQNVTFDNVQNAVGA--DLQIRLFGKPEIDG
PURT_ECOK1      -------IRQYGPAASAVIL-PQL----TSQNVTFDNVQNAVGA--DLQIRLFGKPEIDG
PURT_ECOL5      -------IRQYGPAASAVIL-PQL----TSQNVTFDNVQNAVGA--DLQIRLFGKPEIDG
PURT_ECO57      -------IRQYGPAASAVIL-PQL----TSQNVTFDNVQNAVGA--DLQIRLFGKPEIDG
PURT_SHIDS      -------IRQYGPAASAVIL-PQL----TSQNVTFDNVQNAVGA--DLQIRLFGKPEIDG
PURT_SHIFL      -------IRQYGPAASAVIL-PQL----TSQNVTFDNVQNAVGA--DLQIRLFGKPEIDG
PURT_SHIF8      -------IRQYGPAASAVIL-PQL----TSQNVTFDNVQNAVGA--DLQIRLFGKPEIDG
PURT_SALPA      -------IRQYGPAASAVIL-PQL----TSQNVTFDDVHAAVGA--GVQVRLFGKPEIDG
PURT_SALTI      -------IRQYGPAASAVIL-PQL----TSQNVTFDDVHAAVGA--GVQVRLFGKPEIDG
PURT_SALCH      -------IRQYGPAASAVIL-PQL----TSQNVTFDDVHAAVGA--GVQVRLFGKPEIDG
PURT_SALTY      -------IRQYGPAASAVIL-PQL----TSQNVTFDNVHAAVGA--GVQVRLFGKPEIDG
PURT_CROS8      -------IRQYGPAASAVIL-PTL----KSDDVKFGELSGALGA--GLQLRLFGKPEIDG
PURT_YERPE      -------IRQYGAAASAVIL-PEL----TSQNITYRGLETALIG--DTQIRLFGKPEIAG
PURT_YERPA      -------IRQYGAAASAVIL-PEL----TSQNITYRGLETALIG--DTQIRLFGKPEIAG
PURT_YERPN      -------IRQYGAAASAVIL-PEL----TSQNITYRGLETALIG--DTQIRLFGKPEIAG
PURT_YERPP      -------IRQYGAAASAVIL-PEL----TSQNITYRGLETALIG--DTQIRLFGKPEIAG
PURT_YERPS      -------IRQYGAAASAVIL-PEL----TSQNITYRGLETALIG--DTQIRLFGKPEIAG
PURT_YERE8      -------IRQYGAAASAVIL-PEL----TSHNIAYHGLETALVG--DTQIRLFGKPDIAG
PURT_PECAS      -------VRQYGASASAVIL-PEL----DSDNVRYQELESALLP--HTQIRLFGKPDISG
PURT_SODGM      -------IRQYGPAASAVIL-PEL----QSDNVSFSGLENALAA--GQQIRLFGKPDLSG
PURT_WIGBR      -------IRQYGPSSSVVICGNEL----YGNKISFSNIE-CINT--NQQIRIFSKPNIKG
PURT_AERHH      -------ITQYGPSASAVVL-REG----HSQDIRYQGIGEALALVPGAQLRLFGKPEIAG
PURT_AERS4      -------ITQYGPSASAVVL-RDG----HSQDIRYQGIGAALALVSGAQLRLFGKPEIAG
PURT_PSYIN      -------IIQYGPCASSVIL-GNG----LSDDIKFTNLDQALGSVAGAQIRLFAKPDING
PURT_VIBCB      -------IVQYGPSASAVIL-GQG----TSTDIRFDNLSKAMAQ-PQTQVRLFGKPEIDG
PURT_VIBPA      -------IVQYGPSASAVIL-GQG----TSTDIRFDNLAKALAQ-PQTQVRLFGKPEIDG
PURT_VIBVU      -------IVQYGPSASAVIL-GNG----QSENLRFDGMSDALEQ-PQTQLRLFGKPDING
PURT_VIBVY      -------IVQYGPSASAVIL-GNG----QSENLRFDGMSDALEQ-PQTQLRLFGKPDING
PURT_VIBCH      -------IVQYGPSASAAIL-GQG----QSQNIQFNGLDDALSI-PHTQVRLFGKPDIAG
PURT_ALIF1      -------VTQYGPSASSVIL-GQG----TSTNIRFDGLTEALSQ-PQTQIKLFGKPEIDG
PURT_PHOPR      -------IIQYGPAASAVIL-GNG----ISSNIRFDNLTAALSR-PQTQVRLFGKPEING
PURT_SHEB5      -------IHQHGPSASAVIL-AEG----TSSNIRYQGIAAALEA-VNTQLRLFAKPDIDG
PURT_SHEB8      -------IHQHGPSASAVIL-AEG----TSSNIRYQGIAAALEA-VNTQLRLFAKPDIDG
PURT_SHEPC      -------IHQHGPSASAVIL-AEG----TSSNIRYQGIGAALEA-VNTQLRLFAKPDIDG
PURT_SHESW      -------IHQHGPSASAVIL-AEG----TSSNIRYQGIGAALEA-VNTQLRLFAKPDIDG
PURT_SHESM      -------IHQHGPSASAVVL-VEG----KSKNIRYQGLADALAA-ENTQLRLFAKPEIDG
PURT_SHESR      -------IHQHGPSASAVVL-VEG----KSKNIRYQGLADALAA-ENTQLRLFAKPEIDG
PURT_SHESA      -------IHQHGPSASAVVL-VEG----KSKNIRYQGLADALAA-ENTQLRLFAKPEIDG
PURT_SHEON      -------IHQHGPSASAVVL-VEG----KSKNIRYQGLAAALAA-ENTQLRLFAKPEIDG
PURT_SHEFN      -------IVQHGPSASAVIL-AEG----TSTNIRYQGMAAALAP-ADTQLRLFGKPDIDG
PURT_SHEAM      -------IVQRGPSASAVIL-VEG----ESSNIGYSGLAEALAQ-PNTQLRLFAKPEIHG
PURT_PSEAE      -------IRQLGPSASAVIL-VEG----KSRQVAFANLGAALSE-ADTALRLFGKPEVDG
PURT_PSEAB      -------IRQLGPSASAVIL-VEG----KSRQVAFANLGAALSE-ADTALRLFGKPEVDG
PURT_AZOSB      -------IRQVGPSASAVIL-VEG----ESTQPSFSNLGAALAE-PDTALRLFGKPEVKG
PURT_PSEE4      -------VRQFGPSASAVIL-PEG----QSQQTSFANLGAALSE-PDTAIRLFGKPEING
PURT_PSEPK      -------VRQFGPSASAVIL-PEG----QSQQTSFANLGAALSE-PDTAIRLFGKPEING
PURT_PSEF5      -------IRQFGPSASAVIL-VEG----TSTQTAFANLGAALSE-PDTALRLFGKPEVNG
PURT_PSEPF      -------IRQFGPSASAVIL-VEG----QSTQTAFANLGAALSE-PDTALRLFGKPEVNG
PURT_PSE14      -------IRQFGPSASAVIL-VEG----QSTQTAFANLGAALAE-PDTALRLFGKPEVNG
PURT_PSEU2      -------IRQFGPSASAVIL-VEG----QSTQTAFANLGAALAE-PDTALRLFGKPEVNG
PURT_PSESM      -------IRQFGPSASAVIL-VEG----QSTQTAFANLGAALAE-PDTALRLFGKPEVNG
PURT_PSEU5      -------IRQLGPAASAVVL-VEG----ESTQVSFGNLAEVLAE-PDTALRLFGKPGVSG
PURT_XANAC      DGGV---IRQAGPSASCALL-AHG----NGV-PAFDNVAEALRD-PDTALRLFGKPRVDG
PURT_XANC5      DGGV---IRQAGPSASCALL-AHG----NGV-PVFDNVAEALRD-PDTALRLFGKPRVDG
PURT_XANOR      DGGV---IGQSGPSASCALL-AHG----NGV-PVFDNVADALRD-PNTALRLFGKPRVDG
PURT_XANOM      DGGV---IGQSGPSASCALL-AHG----NGV-PVFDNVADALRD-PNTALRLFGKPRVDG
PURT_XANCP      NGGV---IRQSGPSASCALL-AHG----NGV-PVFDNVAEALRD-PDTALRLFGKPRVDG
PURT_XANC8      NGGV---IRQSGPSASCALL-AHG----NGV-PVFDNVAEALRD-PDTALRLFGKPRVDG
PURT_ALCBS      -------IEQRGASASSVLL-IQG----QSEAMRYHGLNTALAN-ADTEVRLFGKPDING
PURT_MARHV      -------VRQNGPSASAVIL-PEG----SSTEVSYTGLEEALAQ-PGTQLRLFGKPELQG
PURT_DESVH      -------LRQNGPAASCVIL-AEG----DSEAPRFHGVDAALAE-QDTALCLFGKPEVHG
PURT_DESVV      -------LRQNGPAASCVIL-AEG----DSEAPRFHGVDAALAE-QDTALCLFGKPEVHG
PURT_DESAG      -------IRQYGPAASSVIL-AEG----SSARTRFGNLQEALGE-PDTSLLLFGKPEVQG
PURT_ACTP2      -------IYQISPAASKAIV-VEG----KSNNMTFGNLDKVLEE-IGTNIRLFGKGEVNG
PURT_HAEDU      -------IEQFGPAASKAIV-VEG----KSNNVMFVGLDKVLEE-RGTHIRLFGKAEVNG
PURT_MANSM      -------INLISPAASKAIV-VEG----KSTQVQFGNLEQVLAE-PNTNIRLFGKTEVDG
PURT_PASMU      -------ITLISPSASKAIV-VEG----KSTQVVFGQLAEVLAE-PHTNLRLFGKGEVDG
PURT_HAES1      -------INLISPAASKAIV-VEG----KSNQVQFGNLFEVLQE-PNTNIRLFGKGEVNG
PURT_PARD8      -------IVFHGAGASRAVV-VEG----DSDRLSLGNLDKVLEQ-PDTQMRFFGKPEVHG
PURT_HYDCU      -------ITQHGPSASSVIL-PTG----HSTETQFSGLEDALKE-PDTQIRLFGKPEIAG
PURT_HAHCH      -------IKQTGASASVALL-VEG----DSSRVCFSSLEAALCH-PEVQLRLFGKPEVHG
PURT_POLNA      --------ALKSPGASAVIYGGVD----AAG-IVFDGVADALRV-PNTDIRLFGKPESFV
PURT_POLSJ      --------ALKSSGASAVIYGGVD----AKG-IVFDGVADALRV-PNTDIRLFGKPESFV
PURT_RHOFT      --------ALRNPGASAVIYGGVD----AKG-IVFDGVDEALRV-PGTDLRLFGKPESFV
PURT_CUPNH      --------TLRSPGASAVIYGGVD----AQG-VVFDGVDQALSV-PQTEVRLFGKPESFV
PURT_CUPPJ      --------ALKSPGASAVIYGGVD----AQG-VVFDGVDAALRV-PQTEVRLFGKPESFA
PURT_CUPMC      --------ALRAPGASAVIYGGVE----AEG-IVFDGVDEALRV-PQTELRLFGKPESFT
PURT_ACIAC      --------SLRNPGASAVIYGGVD----AQG-IAFDGVDEALAV-PGTDLRLFGKPESFA
PURT_MYCS2      --------TLRAPGASAVIYGGVD----ATG-VVFDGVDAALQV-PHTDIRLFGKPESFV
PURT_MYCVP      --------TLKSPGASAVIYGGVD----AEG-VVFDGVDLALRV-PHTDIRLFGKPESFV
PURT_BORBR      --------RLRQPGASSVIYGGVE----ARG-VAFEGVAQALAE-PGTDIRLFGKPESFA
PURT_BORPA      --------RLRQPGASSVIYGGVE----ARG-VAFEGVAQALAE-PGTDIRLFGKPESFA
PURT_BORPE      --------RLRQPGASSVIYGGVD----ARG-VAFEGVAQALAE-PGTDIRLFGKPESYA
PURT_BORA1      --------ALRQPGASSVIYGGLD----GRG-VTFHGVAQALAE-PGTDVRLFGKPEAFV
PURT_BURCA      --------ALGTPAASAVIYGGLD----ERG-IAFEGVRDALAV-PGADLRLFGKPESFA
PURT_BURCH      --------ALGTPAASAVIYGGLD----ERG-IAFEGVRDALAV-PGADLRLFGKPESFA
PURT_BURL3      --------ALGTPAASAVIYGGLD----ERG-IAFEGVREALAV-PGADLRLFGKPESFA
PURT_BURCM      --------TLGSPAASAVIYGGLD----ERG-IAFEGVRDALAV-PGADLRLFGKPESFA
PURT_BURVG      --------TLGSPAASAVIYGGLD----ERG-IAFEGVRDALAV-PGADLRLFGKPESFV
PURT_BURMA      --------ALATPAASAVIYGGLD----EAG-IAFEGVRDALAV-PGADLRLFGKPESFA
PURT_BURM9      --------ALATPAASAVIYGGLD----EAG-IAFEGVRDALAV-PGADLRLFGKPESFA
PURT_BURM7      --------ALATPAASAVIYGGLD----EAG-IAFEGVRDALAV-PGADLRLFGKPESFA
PURT_BURMS      --------ALATPAASAVIYGGLD----EAG-IAFEGVRDALAV-PGADLRLFGKPESFA
PURT_BURPS      --------ALATPAASAVIYGGLD----EAG-IAFEGVRDALAV-PGADLRLFGKPESFA
PURT_BURP0      --------ALATPAASAVIYGGLD----EAG-IAFEGVRDALAV-PGADLRLFGKPESFA
PURT_BURP1      --------ALATPAASAVIYGGLD----EAG-IAFEGVRDALAV-PGADLRLFGKPESFA
PURT_BURP6      --------ALATPAASAVIYGGLD----EAG-IAFEGVRDALAV-PGADLRLFGKPESFA
PURT_BURTA      --------ALATPAASAVIYGGLD----EAG-IAFEGVRDALAV-PGADLRLFGKPESFA
PURT_PARXL      --------SLRAPGASAVIYGGLD----EAG-IAFEGVAAALAV-PNADLRLFGKPESFV
PURT_DECAR      --------ALREAGASAVIYGGME----EKG-IAFAGLEEALAV-PRSDLRLFGKPESFK
PURT_THIDA      --------GLREPGASAVIYGAVD----ARG-IAFDGVDDALAA-PGVDLRLFGKPEAFA
PURT_METFK      --------ALSRPGASAVIYGGLD----SSQ-LVFEGVEQALAV-PESDIRLFGKPESFA
PURT_HERAR      --------AMKTPAASAVIYGQHD----GEV-VAFEGVADALRV-PGTDVRLFGKPESFA
PURT_JANMA      --------ALSTPAASAVIYGRHD----GKV-VSFEGVAEALHI-PGTDIRLFGKPESFA
PURT_RHOJR      --------TLTTPGASAVIYGGVD----ATG-IGFDGVADAMAV-PETDLRLFGKPESFV
PURT_METCA      --------SLRRPGASAVIYGGVA----AEG-IAFEGLERALAV-PESEVRLFGKPEAHP
PURT_CORGL      --------TLISPGASAVIYGGIE----SEG-VSYTGLAEALAV-AETDLRIFAKPEAFT
PURT_CORGB      --------TLISPGASAVIYGGIE----SEG-VSYTGLAEALAV-AETDLRIFAKPEAFT
PURT_COREF      --------TLTSPGASAVIYGGVD----SPG-VSYAGLAEALAV-AETDVRLFGKPEAFT
PURT_CORJK      --------TLISPGASAVIRCEDK----HDGDIEYAGVNKAMAV-EETNIYLFGKPRALA
PURT_ACIBT      --------ARHSVAASAVIYAGVD----ANN-LSYSNLNVALAH-PDTDLRLFGKPEGFK
PURT_ACIAD      --------TRHSVAASAVIYAGVD----ADN-LSFSQLNQALAH-PETDLRLFGKPEGFK
PURT_GEOMG      -------VANLAPAASHVVL-ASE----AAEEVTFSGLDAALSV-PETKLRLFGKPDTRP
PURT_PELPD      -------IVNLAPSASHVIL-ADA----SFDAVRFEGLEQALEV-ATSKLRLFGKPDTRP
PURT_PELCD      -------IELLSPGASHVVL-AGG----QDDEVSFSGVEDALRV-PGSKVRLFGKPDSRP
PURT_FRATF      -------IQTLQPSASAAIL-LEG----DTANASICGIDKALAD-ANVDIRIFSKKEIHG
PURT_FRATH      -------IQTLQPSASAAIL-LEG----DTANASICGIDKALAD-ANVDIRIFSKKEIHG
PURT_FRATO      -------IQTLQPSASAAIL-LEG----DTANASICGIDKALAD-ANVDIRIFSKKEIHG
PURT_FRATT      -------IQTLQPSASAAIL-LEG----DTANASICGIDKALAD-ANVDIRIFGKKEIHG
PURT_FRAT1      -------IQTLQPSASAAIL-LEG----DTANASICGIDKALAD-ANVDIRIFGKKEIHG
PURT_FRATW      -------IQTLQPSASAAIL-LEG----DTANASICGIDKALAD-ANVDIRIFGKKEIHG
PURT_FRATN      -------IQTLQPSASAAIL-LEG----DTANASICGIDKALAD-ANVDIRIFGKKEIHG
PURT_NOSS1      -------IEQLGFCASAVILASE-----KLDAPLFTGVAEALAE-PDVDIRLFGKPTAHP
PURT_TRIV2      -------IEQLGPSASAVILASE-----KLDAPVFTGIAEALAA-PDVDIRLFGKPTAHP
PURT_SYNP6      -------IELLGPSASRVILAED-----SGDRPSYAGVAAALQE-PWVDLRLFGKPDMRP
PURT_SYNE7      -------IELLGPSASRVILAED-----SGDRPSYAGVAAALQE-PWVDLRLFGKPDMRP
PURT_SYNY3      -------IKQTGPAASAVILALE-----AGEKLSYAGLAEALTE-SGTDVRLFGKPNARP
PURT_PROM3      -------IQTADAAASRVILAKD-----NLSSISYKGVEKALSE-IDTQILLFGKPNARP
PURT_PROMM      -------IQTADAAASRVILAKD-----NLSSISYKGVEKALSE-IDTQILLFGKPNARP
PURT_SYNSC      -------ITAADAAASRVILAQT-----NMDSVAFEGVEQALTE-ADTQVLLFGKPTARP
PURT_SYNPX      -------ITTADAAASRVILAQN-----QMDAVSYTGVDTALQE-PDTQLLLFGKPTARP
PURT_SYNS9      -------LTTAPAAASRVILADR-----ELKTVAYEGLEQALRE-AGTQVLLFGKPNARP
PURT_SYNPW      -------IRCADAAASRVILADK-----HGSRVTYSGMEEALQE-SETSVFLFGKRDARP
PURT_SYNS3      -------ITAADAAASRVILAES-----QGHHVQFSGVEQALTE-PDTNLLLFGKREARP
PURT_SYNR3      -------ITSTGAAASRVVLAGAD---QQGGPVHYRGVAEALAV-PESELLLFGKPEARP
PURT_PROM1      -------IVCHEASASRVILASM-----ETTDVAFTGLEQALSQ-SNTNVFMFGKPSSTE
PURT_PROMT      -------IVCHEASASRVILASM-----ETTDVAFTGLEQALSQ-SNTNVFMFGKPSSTE
PURT_PROMA      -------IECVSPSASRVILSQE-----SFAKVAYKGIEKALEI-QNSKIMIFGKPNTKK
PURT_PROMS      -------IDLIEPSATRVILSNQ-----EYLNPIYEGLYEALEF-EKTKVLIFGKPVSRK
PURT_PROM0      -------IYLIEPSATRVILSNQ-----EYLNPIYEGLNEALEF-EKTKVLIFGKPVSRK
PURT_PROM9      -------INLIEPSATRVILSDQ-----EHMNPIYEGLNEALEV-ENTKVLIFGKPISRK
PURT_PROM5      -------ISLLKPSATRVILSEK-----ESINPSYTGLNEALEV-ENTKVLIFGKPTSKK
PURT_PROMP      -------ISLLKPSATRVIISDK-----ESNTPSYSGLNEALEL-ENTKVLIFGKPTAKK
PURT_BACFR      -------IKQERIGASAVILSPI----ASQERPQYRGMEEVTGE-EDTYLRIFGKPYTRV
PURT_BACFN      -------IKQERIGASAVILSPI----ASQERPQYRGMEEVTGE-EDTYLRIFGKPYTRV
PURT_BACTN      -------IKQERIGASAVILSPI----ASQERPQYRGMEEVTKE-EDTYLRIFGKPFTRV
PURT_BACV8      -------ITQERIGASAVILSPI----ASKEAPRYRGEEEVCKE-TNTYLRIFGKPYTKL
PURT_CHLPD      -------IELLRVGASAVVSADR----EGKN-PDYSGLEEALGE-PCTDIRIFGKPATRP
PURT_CHLTE      -------ITLLRAGASAVILADR----VGNN-PSFDGLDAALAE-PGSDIRIFGKPVMRP
PURT_LEPBJ      -------VTQERKGASAVILAST----DGKI-PEVRGLDIASEM-PESDFRIFGKPITRP
PURT_LEPBL      -------VTQERKGASAVILAST----DGKI-PEVRGLDIASEM-PESDFRIFGKPITRP
PURT_LEPIN      -------ITLERKGASAVILAST----ENKT-PEISGLDIASGM-SESDFRIFGKPITRP
PURT_LEPIC      -------ITLERKGASAVILAST----ENKT-PEISGLDIASGM-SESDFRIFGKPITRP
PURT_FLAPJ      -------ITLEKAGARAVILASE----NSNN-PTYSGIENIACL-PKSDFRIFGKPTSRP
PURT_ANADE      -------ITLVRPGASAVILA------RGTGAPVVRGLESALAE-PGADVRIFGKPALRP
PURT_ERYLH      -------EILARPSASAVILAEQ-----ESETVSYSGLAAAM-E-GGADIRIFGKPNTRP
PURT_BIFAA      -------EHVALSIPEGTVAASHAIVVQGDGEAEFRNVAAALAE-PGTDLRVFAKPEVHG
PURT_BIFLO      -------EHVSLTIPAGSVAASHAIVVAGDGEVEFTDVAAALAE-PGTDLRIFAKPEVHG
PURT_SULAC      K--------VVTPAAAHVILASGEK-----WAPKYINVDKALEI-PGVQVRLFGKPVTYN
PURT_SULTO      K--------IVSPAAAHVILANNEG-----WAPKFLNVEKALQI-PGVQIRLFGKPSTYY
PURT_SACS2      K--------LVSPAASHVILAQTENV----WGPKFLNIEKAMEI-PGVQVRLFGKPVTYE
PURT_IGNH4      K--------LLTPAASRVVLA-EEAL----EPPCLKGVGEALKV-KGVQLRWFAKPRSYK
PURT_PYRAB      WVDGYRLFPMLIPAATHVIKAKVKG-----YSPRFRGLAKALSV-PNATVRLFGKPEAYV
PURT_PYRFU      WVDGYRLFPMLIPAATHVIKAKVSG-----YSPRFRGLAKALSV-PNATIRLFGKPEAYP
PURT_PYRHO      WVDGYRLFPMLIPAATHVIKAKVSG-----YSPRFRGLVKALSV-PNATVRLFGKPEAYV
PURT_THEKO      WVDGYRLFPMLTPAATHVIKANVSG-----YSPRFRGLAKALSV-PNATVRLFGKPEAYP
PURT_METAR      G----KVIQPRSTAASHVILSHTEG-----WYPQFK--VDGAYA-PDTNVLIFGKPEAYE
                              .                                  .  *.*     

PURT_NITSB      GRRMAVVLTLA---ETAEQALQKANELIAKVSDQ-------------------
PURT_SULDN      GRRLAVALVF----DKAEQALQRARELITKVKDS-------------------
PURT_SULNB      GRRMAVSLVL----DEVKEAKRRATEIVETIDDH-------------------
PURT_WOLSU      GRRMAVLLIKD---EEAESALKRAKKLIKKVSE--------------------
PURT_METM5      GRRMGVALA---VSDNVTKARENAEKAAHLVNIK-------------------
PURT_METM7      GRRMGVALA---VSDDITKARENAEKAAHLVNIK-------------------
PURT_METMP      GRRMGVALA---VSDDVIKAREHAEKVAHLVKIK-------------------
PURT_METVS      GRRMGVALS---TAEDVSVARDTAKKAANIVKIK-------------------
PURT_META3      GRRMGVALA---SANTVEEARKNAKKCANGVIIR-------------------
PURT_METJA      GRRMGVALA---YADSVEKARELAEKCAHAVRIE-------------------
PURT_BACSU      GRRMAVALS---AADSVETARENAKKALDQLILK-------------------
PURT_BACVZ      GRRMAVALS---AAETVEEARERAAEALSHLSIT-------------------
PURT_HALWD      GRRMGAAVA---TAIDIETAQERASEAVDCIHVSDDKT---------------
PURT_ECOLI      SRRLGVALA---TAESVVDAIERAKHAAGQVKVQG------------------
PURT_SHISS      SRRLGVALA---TAESVVDAIERAKHAAGQVKVQG------------------
PURT_SHIBS      SRRLGVALA---TAESVVDAIERAKHAAGQVKVQG------------------
PURT_ECOUT      SRRLGVALA---TAESVVDAIERAKHAAGQVKVQG------------------
PURT_ECOK1      SRRLGVALA---TAESVVDAIERAKHAAGQVKVQG------------------
PURT_ECOL5      SRRLGVALA---TAESVVDAIERAKHAAGQVKVQG------------------
PURT_ECO57      SRRLGVALA---TAESVVDAIERAKHAAGQVKVQG------------------
PURT_SHIDS      SRRLGVALA---TAESVVDAIERAKHAAGQVKVQG------------------
PURT_SHIFL      SRRLGVVLA---TSESVVDAIERAKHAAGQVKVQG------------------
PURT_SHIF8      SRRLGVVLA---TSESVVDAIERAKHAAGQVKVQG------------------
PURT_SALPA      TRRLGVALA---TGENVEEAVIRAKKAASRVTVKG------------------
PURT_SALTI      TRRLGVALA---TGENVEEAVIRAKKAASRVTVKG------------------
PURT_SALCH      TRRLGVALA---TGENVEEAVIRAKKAASRVTVKG------------------
PURT_SALTY      TRRLGVALA---TGENVEEAVIRAKKAVSRVTVKG------------------
PURT_CROS8      SRRLGVALA---TGETVDDAIARAKASAAAVIVKG------------------
PURT_YERPE      KRRLGVALA---VADNIETAIEVAKKAAGNIEVSGE-----------------
PURT_YERPA      KRRLGVALA---VADNIETAIEVAKKAAGNIEVSGE-----------------
PURT_YERPN      KRRLGVALA---VADNIETAIEVAKKAAGNIEVSGE-----------------
PURT_YERPP      KRRLGVALA---VADNIETAIEVAKKAAGNIEVSGE-----------------
PURT_YERPS      QRRLGVALA---VADNIETAIEVAKKAAGNIEVSGE-----------------
PURT_YERE8      KRRLGVALA---VADDTDTAIEIAKRAASAVVVTGK-----------------
PURT_PECAS      KRRMGVALA---SAETTDDAIEIAKRVAASVKVSG------------------
PURT_SODGM      KRRLGVALA---VAATVEEAVTVAKDAAAAVRVTG------------------
PURT_WIGBR      YRRLGVILD---QDETIERSLRKAKKTASKILIKT------------------
PURT_AERHH      RRRLGVALA---RAEDCPTAVEQAKAVAARVDVLF------------------
PURT_AERS4      RRRLGVALA---RGQQCEEAVEKAKAVAARVEVIC------------------
PURT_PSYIN      QRRLGVAIA---RGETVEEAVDNAKTVSNKVNIIY------------------
PURT_VIBCB      RRRLGVVLT---RRKTIEDSIEDAVNSASKVQIIY------------------
PURT_VIBPA      RRRLGVVLT---RRKTIEESVQDAVENAKKVKIVY------------------
PURT_VIBVU      RRRLGVVLT---RRSSTEKAVDAAIESAKKIKIIY------------------
PURT_VIBVY      RRRLGVVLT---RRSSTEKAVDAAIESAKKIKIIY------------------
PURT_VIBCH      RRRLGVALS---RGKTTQEATDRAIECAKAVKIHY------------------
PURT_ALIF1      RRRLGVAIT---RRDNLETAIEDAVTASNKVQVIY------------------
PURT_PHOPR      RRRLGVALT---RREDTKQAVSDAINAAADVKVIY------------------
PURT_SHEB5      RRRLGVALA---RDIDIDSAVSKALDSASKVKVIF------------------
PURT_SHEB8      RRRLGVALA---RDIDIDSAVSKALDSASKVKVIF------------------
PURT_SHEPC      RRRLGVALA---RDIDIDSAISKALDSASKVKVIF------------------
PURT_SHESW      RRRLGVALA---RDIDIDSAISKALDSASKVKVIF------------------
PURT_SHESM      RRRLGVALA---RDKDIESAVNKALDSASKVKVIF------------------
PURT_SHESR      RRRLGVALA---RDKDIESAVNKALDSASKVKVIF------------------
PURT_SHESA      RRRLGVALA---RDKDIESAVNKALDSASKVKVIF------------------
PURT_SHEON      RRRLGVALA---RDKDIDSAVNKALDSAAKVQVIF------------------
PURT_SHEFN      RRRLGVALA---RDNSVEQAVEKAKTVASHIKVLF------------------
PURT_SHEAM      RRRLGVALA---RGTSIDEALQTALASAGCIKVHFN-----------------
PURT_PSEAE      QRRMGVALA---RDESIDAARAKATRAAQAVRVEL------------------
PURT_PSEAB      QRRMGVALA---RDESIDAARAKATRAAQAVRVEL------------------
PURT_AZOSB      QRRMGVALA---RDESIEAARAKALRAAQAVKVEL------------------
PURT_PSEE4      TRRMGVCLA---RDESVEAARAKATRASQAVKVEF------------------
PURT_PSEPK      TRRMGVCLA---RDESVELARAKATRASQAVKVEF------------------
PURT_PSEF5      QRRMGVALA---RDESIEAARAKATRAAQAVVVEL------------------
PURT_PSEPF      QRRMGVALA---RDESIEAARAKATRASQAVVVEL------------------
PURT_PSE14      QRRMGVALA---RDESIEAARAKATRASQAVDVKL------------------
PURT_PSEU2      QRRMGVALA---RDESIEAARAKATRASQAVNVEL------------------
PURT_PSESM      QRRMGVALA---RDESIEAARAKATRASSAVVVEL------------------
PURT_PSEU5      QRRMGVALA---RDTSIDAARQKALRAAAAVKIEL------------------
PURT_XANAC      HRRVGVTLA---RADSVDAAREKARVAAAALTIQLQA----------------
PURT_XANC5      HRRVGVTLA---RADSIDAAREKARVAAAALTIQLQA----------------
PURT_XANOR      HRRVGVTLA---RADSIDAAREKARVAAAALGIQLTA----------------
PURT_XANOM      HRRVGVTLA---RADSIDAAREKARVAAAALGIQLTA----------------
PURT_XANCP      HRRVGVTLA---RAGSIDAAREKARVAAAALTIQLRD----------------
PURT_XANC8      HRRVGVTLA---RAGSIDAAREKARVAAAALTIQLRD----------------
PURT_ALCBS      SRRLGVALA---KADTIDAARDKANTAIAAFKVDL------------------
PURT_MARHV      RRRMGVALA---LGSSIEDAREKARTAASSIKVQF------------------
PURT_DESVH      RRRMGVALA---LGDDIDAARAKARRAAGSVTVEL------------------
PURT_DESVV      RRRMGVALA---LGDDIDAARAKARRAAGSVTVEL------------------
PURT_DESAG      RRRMGVALA---LGETVEQAVEKACRVSDAVKVML------------------
PURT_ACTP2      HRRLGVILA---RDENTEKALAKAERAYAKLAVQL------------------
PURT_HAEDU      HRRLGVILA---RDESTDKALAKVERAYANLTVKL------------------
PURT_MANSM      HRRMGVILS---RDISVEKALEKAFRAYDKLEINL------------------
PURT_PASMU      HRRMGVILA---RDISVEKALEKARRAYDKLEIAL------------------
PURT_HAES1      HRRLGVILA---RDISVDKALEKVSRAYDKLDIQL------------------
PURT_PARD8      HRRMAVLLA---RGLDVTEAREKTGVMMEQLNVKL------------------
PURT_HYDCU      RRRMGVALA---RDTSIEKAIEKAKASAMAVKVDF------------------
PURT_HAHCH      KRRMGVVLA---QSENLDEARKLAQKAVDSIVVELGPDIKQE-----------
PURT_POLNA      KRRMGVALA---FDADVDVARTHARLAASKVRPRAAG----------------
PURT_POLSJ      KRRMGVALA---FDADVEVARANAKLAASRVKPRVAKG---------------
PURT_RHOFT      KRRMGVALA---AHADVEQARVNAKLAASKVKPRAA-----------------
PURT_CUPNH      KRRMGVALA---YADDVDTARTRAKEAASRVRPRAVG----------------
PURT_CUPPJ      KRRMGVALA---YADDVDTARQRAKEAAACVKPRVAG----------------
PURT_CUPMC      KRRMGVALA---YAEDVDTARERAKEAAGKVKPRKA-----------------
PURT_ACIAC      RRRMGVAVA---RADDVDTARANARLAAGRVRPRAA-----------------
PURT_MYCS2      KRRMGVALA---FDDDVQTARRNAAEAASRMKPRAV-----------------
PURT_MYCVP      NRRMGVALA---FADDVDTARRNAAEAAGRVTPRAV-----------------
PURT_BORBR      KRRMGVGLA---VADDVDQARAKAARVSQAVRVRAGA----------------
PURT_BORPA      KRRMGVGLA---VADDVDQARAKAARVSQAVRVRAGA----------------
PURT_BORPE      KRRMGVGLA---VADDVDQARAKAARVSQAVRVRA------------------
PURT_BORA1      KRRMGVGLA---VADTLDAAREKARRVSAAVSVKAA-----------------
PURT_BURCA      KRRMGVALA---TGATVDEARERAKRAAAAVRPVSAR----------------
PURT_BURCH      KRRMGVALA---TGATVDEARERAKRAAAAVRPVSAR----------------
PURT_BURL3      KRRMGVALA---TGATVDEARERAKRAAAAVRPVSAR----------------
PURT_BURCM      KRRMGVALA---TGASVDEARERAKRAAAAVRPVSAR----------------
PURT_BURVG      KRRMGVALA---TGANVDEARERAKRAAAAVRPVSSR----------------
PURT_BURMA      KRRMGVALA---TGANVDEARERAKRAAAAVRPVSAR----------------
PURT_BURM9      KRRMGVALA---TGANVDEARERAKRAAAAVRPVSAR----------------
PURT_BURM7      KRRMGVALA---TGANVDEARERAKRAAAAVRPVSAR----------------
PURT_BURMS      KRRMGVALA---TGANVDEARERAKRAAAAVRPVSAR----------------
PURT_BURPS      KRRMGVALA---TGANVDEARERAKRAAAAVRPVSAR----------------
PURT_BURP0      KRRMGVALA---TGANVDEARERAKRAAAAVRPVSAR----------------
PURT_BURP1      KRRMGVALA---TGANVDEARERAKRAAAAVRPVSAR----------------
PURT_BURP6      KRRMGVALA---TGANVDEARERAKRAAAAVRPVSAR----------------
PURT_BURTA      KRRMGVALA---TGANVDEARERAKRAAAAVRPVSAR----------------
PURT_PARXL      KRRMGVALA---TGETTDEARSRAKQAAAAVRPVSAK----------------
PURT_DECAR      KRRMGVAVA---NGESTDQARERAKLAASKVRPTRT-----------------
PURT_THIDA      RRRMGVALA---TADSPDAARLLAKAAAAKVKPVPV-----------------
PURT_METFK      RRRMGVALA---TADDVEKARARARTAAKLVKTRDGK----------------
PURT_HERAR      RRRMGVALA---AAADVETARNNARTAAAKIKPVAHSR---------------
PURT_JANMA      RRRMGVALA---KAADVDTARKNAKAAAAKVNPVVSS----------------
PURT_RHOJR      RRRMGVAVS---TGPDVETARSRAREAASRVEPVA------------------
PURT_METCA      RRRMGVALA---AADTVEEARRRAVLAASRVRPVKIPA---------------
PURT_CORGL      KRRMGVAVS---TAEDVAAARDRATLAAAAIKVHPGNSAEA------------
PURT_CORGB      KRRMGVAVS---TAEDVAAARDRATLAAAAIKVHPGNSAEA------------
PURT_COREF      KRRMGVAVS---TAEDTATARDRATLAAAAVTVHG------------------
PURT_CORJK      RRRMGVAVA---TAENIDQARQRAEEAAGYIEVRPTVFAEGGQ----------
PURT_ACIBT      RRRMGVATA---RAENTDLARTLAKETADQVSVQTNS----------------
PURT_ACIAD      RRRMGVATA---RAETTDQARELATQAAEHVQVIVASNQ--------------
PURT_GEOMG      GRRMGVALS---FGADTDEARNRAEQAAHAVKIVTL-----------------
PURT_PELPD      GRRMGVALV---QGKDTDEARGRAEACAHAVRMVPLS----------------
PURT_PELCD      GRRMGVALV---VAPDVDTARKRAEEAAGKIRVEPVK----------------
PURT_FRATF      KRRMGVVLA---KAQNTHIALETSKQALAHIHLTK------------------
PURT_FRATH      KRRMGVVLA---KAQNTHIALETSKQALAHIHLTK------------------
PURT_FRATO      KRRMGVVLA---KAQNTHIALETSKQALAHIHLTK------------------
PURT_FRATT      KRRMGVVLA---KAQNTHIALETSKQALAHIHLTK------------------
PURT_FRAT1      KRRMGVVLA---KAQNTHIALETSKQALAHIHLTK------------------
PURT_FRATW      KRRMGVVLA---KAQNTHIALETSKQALAHIHLTK------------------
PURT_FRATN      KRRMGVVLT---KAQNTHIALETSKQALAYIHLTK------------------
PURT_NOSS1      YRRMGVALA---KAENVETAREKATDAASKIHISSQ-----------------
PURT_TRIV2      YRRMGVALA---KAENVQAAREKATDAASKIQISSQ-----------------
PURT_SYNP6      QRRMGVALA---RDESVEAARAKADRAASQVTIQPS-----------------
PURT_SYNE7      QRRMGVALA---RDESVEAARAKADRAASQVTIQPS-----------------
PURT_SYNY3      HRRLGVALA---QAESVDAARRLAQTVAEKVIVQTE-----------------
PURT_PROM3      RRRMGVALA---KGKSLEAVRSKADRAAASIQVIKGKGVT-------------
PURT_PROMM      GRRMGVALA---KGKSMEAVRSKADRAAASIQVIKG-----------------
PURT_SYNSC      GRRMGVALA---RGVDRKEAQAKADRAAACVSVIPGSTAG-------------
PURT_SYNPX      GRRMGVALA---RGEHLAEARAKADRAAACVRVLQR-----------------
PURT_SYNS9      NRRMGVALA---RGEDLSEVRAKADRAAACIQVLDGSARR-------------
PURT_SYNPW      GRRMGVALA---RGEHQAEARAKADRSAAAVHLHIED----------------
PURT_SYNS3      GRRMGVALA---RGTQINEALAKADRCAAAVKVQVMD----------------
PURT_SYNR3      MRRMGVALA---SGSSLAEARGRADTAAQAVALEIGG----------------
PURT_PROM1      GRRMGVAVA---KAETIDEARIKADNAAQSIQFINE-----------------
PURT_PROMT      GRRMGVAVA---KAETIDEARIKADNAAQSVQFINE-----------------
PURT_PROMA      GRRMGVSLA---QGKTLEEARFKADKSAKCIQIFEAKEAQS------------
PURT_PROMS      GRRMGVVLS---SNTDINLARKNADEAALKIKVSTT-----------------
PURT_PROM0      GRRMGVVLS---SNSDIYLARKNADEAARKIKVSTT-----------------
PURT_PROM9      GRRMGVVLS---SNSDINLARKNADEAARKIKVSSK-----------------
PURT_PROM5      GRRMGVVLS---SDDDLNIARKNADKSASKIKIVS------------------
PURT_PROMP      GRRMGVVLS---TDDDLNIARENADKSALKIKIVS------------------
PURT_BACFR      NRRMGVVLCYAPNGSDLDALRDKAKRIADKVEVY-------------------
PURT_BACFN      NRRMGVVLCYAPNGSDLDALRDKAKRIADKVEVY-------------------
PURT_BACTN      NRRMGVVLCYAPLNSDLDALRDKAKRIAEKVEVY-------------------
PURT_BACV8      NRRMGVVVCYAPNGSDLDALRDKCKAAAAKVEVY-------------------
PURT_CHLPD      YRRMGVTLAYDEPGSDVDTVKAKAIANARKVRVTSE-----------------
PURT_CHLTE      YRRMGVALMSGEKGSDVDELKRQAIANAEKVMIKCDETV--------------
PURT_LEPBJ      YRRMGIALSYSTKGEGISSLRKRAILLASKIKVD-------------------
PURT_LEPBL      YRRMGIALSYSTKGEGISSLRKRAILLASKIKVD-------------------
PURT_LEPIN      YRRMGVTLSYSTKGEEISSLRKRAVLLASKIKVD-------------------
PURT_LEPIC      YRRMGVTLSYSTKGEEISSLRKRAVLLASKIKVD-------------------
PURT_FLAPJ      YRRMGVVLTNDTLETPIEEIVTRAKKMATLVKVNL------------------
PURT_ANADE      HRRMGVALVSGAPGDDPRALVERARAVAARVSVDP------------------
PURT_ERYLH      YRRMGVALA---TGGDTDYARTAAVAAANKLHIHYGD----------------
PURT_BIFAA      HRRMAVALA---VGGDEADARAKAGNVAESLDIAIV-----------------
PURT_BIFLO      HRRMAVALA---VGESEADARAKAGLVADALTITVE-----------------
PURT_SULAC      ERRMGIVLA---TGNSVEEAKEKVRKASALILVS-------------------
PURT_SULTO      KRRMGVVLA---TGNTVEEAKEKARKAASLVLVT-------------------
PURT_SACS2      KRRMGVVLA---TGNSVEEALEKVRKASSIILVK-------------------
PURT_IGNH4      ERRMGVLLA---TGSTVEEALERVRRAAGFLKVVKC-----------------
PURT_PYRAB      GRRLGVVLA---WDKDVQEAKKRAEMVAHMIELRTRSSDWHDQNYEKRKHLL-
PURT_PYRFU      GRRLGVVLA---WDKDVQEAKKRAEMVAHMIELRTRSSDWHSQDYEKRKHLL-
PURT_PYRHO      GRRLGIALA---WDKDVEVAKRKAEMVAHMIELRTRSSDWHDQNYEKRKHLLR
PURT_THEKO      GRRLGVAIA---WDKDVGEAKRKAEMVAHSIELRTRSANWHSQDYEKRKHLL-
PURT_METAR      ERRLGVVLA---TAGTVEDAKKKAQKAAHTVKVSA-NDKWAGQEITEKHYR--
                 **:.                         .