CLUSTAL format seed alignment for MF_01645

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

ALLB_BACSU      -MAYDMVIKGAKAVTPDGVIEADIVVQNGVIAEIGS--DIEASGTEIIQADGKYVFPGVI
ALLB_BACVZ      -MAYDVIVKGAKAVRKGGTERADIAVKDGKIALIGP--GIDENAEQVVQADGMYVFPGAV
ALLB_DEIRA      -MSLDLLLRGAVLVTPEGERRADLGIVGGQIAELTD--EIATPAAQTLDVSGLHVFPGVL
ALLB_DEIGD      --MYDLLVRGGQLVREGGVEQADLGVVEERIVEIAP--ELMGDAREELDARGLHVFPGAV
ALLB_SOLUE      --MSECVVRGGQVVQAGGVVSADVAIEDGRISAIGP--ELPG-AKREINARGLTVFPGVI
ALLB_RUBXD      MSAFDLIVRGGTVVR-GGCEVADVGVADGVISAVGP--DLEGGAREEIDARGLLVLPGAI
ALLB_DESHY      MSHYDLILRNGNVVCPDGVRKADIAVSDGKIVLIAE--EIPGDAKEVIDAAGKHVFPGIT
ALLB_ALKHC      MKRFDLIIRSSTVVTETTTYRADVAIRNGIVSAITEPGSISSDDGPAIDGTGLHLFPGMV
ALLB_ECOL6      -MSFDLIIKNGTVILENEARVVDIAVKDGKIAAIGQ---DLGDAKDVMDASGLVVSPGMV
ALLB_ECOUT      -MSFDLIIKNGTVILENEARVVDIAVKDGKIAAIGQ---DLGDAKDVMDASGLVVSPGMV
ALLB_ECOL5      -MSFDLIIKNGTVILENEARVVDIAVKDGKIAAIGQ---DLGDAKDVMDASGLVVSPGMV
ALLB_ECOK1      -MSFDLIIKNGTVILENEARVVDIAVKDGKIAAIGQ---DLGDAKDVMDASGLVVSPGMV
ALLB_ECOLI      -MSFDLIIKNGTVILENEARVVDIAVKGGKIAAIGQ---DLGDAKEVMDASGLVVSPGMV
ALLB_SALPA      -MSFDLIIKNGTVILENEARVIDIAVQGGKIAAIGE---NLGEAKNVLDATGLIVSPGMV
ALLB_SALTI      -MSFDLIIKNGTVILENEARVIDIAVQGGKIAAIGE---NLGEAKNVLDATGLIVSPGMV
ALLB_SALTY      -MSFDLIIKNGTVILENEARVIDIAVQGGKIAAIGE---NLGEAKNVLDATGLIVSPGMV
ALLB_SALCH      -MSFDLIIKNGTVILENEARVIDIAVQGGKIAAIGE---NLEEAKNVLDATGLIVSPGMV
ALLB_BACLD      -MNFDSIIKNGLVILENGEQEVEVGIKDGKIAAIGQ---DLGTSAKIIDAKGSIVSPGMI
ALLB_ENTFA      -MQAELVIKNGLVILETGEVITDVAVQGGKIVAIGQ---DLS-GERVIDATGLVVSPGMV
ALLB_BACSK      --MLDLCITGGRVVLPSGVEETDVGIQAGKIARIGPI--NKKEARCIMNANGQYVFPGAV
ALLB_STRCO      MSEAELVLRSTRVITPEGTRAASVAVTGEKITAVLPYDAPVPAGARLEDVGDHVVLPGLV
ALLB_STRAW      MSDVELVLRSTRVITPEGTRPAAVAVAAGKITAVLPHDAEVPAGARLEDLGDDVLLPGLV
                    :  : .   :         : :    :  :              :  .  : **  

ALLB_BACSU      DCHVHFNEPG---REDWEGFETGSQMMAAGGCTTYFDMPLNCIPSTVTAEHLLAKAELGR
ALLB_BACVZ      DCHVHFNEPG---REEWEGIETGSNMLAAGGCTSYFDMPLNCIPSTVTAENLLAKAEIAE
ALLB_DEIRA      DDHVHLNEPG---RTHWEGFETGTQALAAGGATSFLDMPLNSSPPVLTRERFEDKARLGE
ALLB_DEIGD      DIHVHFNEPG---RTDWEGIRTGSRALVAGGGTVFADMPLNSTPPVLDRTTFEAKQQAAE
ALLB_SOLUE      DDHLHFNEPG---RTEWEGAATGSRALAAGGGTAFFDMPLNSTPCTVDRAAFAGKRAALE
ALLB_RUBXD      DAHVHFNEPG---RTRWEGFASGTRALAAGGTTLCVEMPLNAHPPTTDGESFDLKLAAAK
ALLB_DESHY      DGHVHFNDPG---RTEWETISTGSSALAAGGGVAYFDMPLNCSPCTLDAVNFNNKLAVAQ
ALLB_ALKHC      DVHVHFNEPG---RTEWEGFASGSKSLAAGGVTTYFDMPLNSNPPTITREELDKKRQLAN
ALLB_ECOL6      DAHTHISEPG---RSHWEGYETGTRAAAKGGITTMIEMPLNQLPATVDRASIELKFDAAK
ALLB_ECOUT      DAHTHISEPG---RSHWEGYETGTRAAAKGGITTMIEMPLNQLPATVDRASIELKFDAAK
ALLB_ECOL5      DAHTHISEPG---RSHWEGYETGTRAAAKGGITTMIEMPLNQLPATVDRASIELKFDAAK
ALLB_ECOK1      DAHTHISEPG---RSHWEGYETGTRAAAKGGITTMIEMPLNQLPATVDRASIELKFDAAK
ALLB_ECOLI      DAHTHISEPG---RSHWEGYETGTRAAAKGGITTMIEMPLNQLPATVDRASIELKFDAAK
ALLB_SALPA      DAHTHISEPG---RTHWEGYETGTRAAAKGGITTMIEMPLNQLPATVDRETIELKFDAAK
ALLB_SALTI      DAHTHISEPG---RTHWEGYETGTRAAAKGGITTMIEMPLNQLPATVDRETIELKFDAAK
ALLB_SALTY      DAHTHISEPG---RTHWEGYETGTRAAAKGGITTMIEMPLNQLPATVDRETIELKFDAAK
ALLB_SALCH      DAHTHISEPG---RTHWEGYETGTRAAAKGGITTMIEMPLNQLPATVDRETIELKFDAAK
ALLB_BACLD      DAHVHITEPGGGYRDEWEGYDTGTRAAAKGGVTTFIEMPLNQVPATVDEESIQEKFKAGK
ALLB_ENTFA      DAHVHITDPGGGYRDEWEGYVTGTAACAKGGVTTFMEMPLNQIPATVDKTSLEIKYKAGE
ALLB_BACSK      DTHVHFSEPG---RTEWEGFFTGSRSLAAGGTTTYVEMPLNALPATTNRANLQRKLEAAK
ALLB_STRCO      DTHVHVNDPG---RTEWEGFWTATRAAAAGGITTLVDMPLNSIPPTTTVDNLRTKREVAA
ALLB_STRAW      DTHVHVNDPG---RTHWEGFWTATRAAAAGGITTLVDMPLNSLPPTTTVGNLRTKRDVAA
                * * *..:**   *  **   :.:   . ** .   :****  * .     :  *     

ALLB_BACSU      QKSAVDFALWGGLVPGHI-EDIRPMAEAGAIGFKAFLSKSGT----DEFRSVDERTLLKG
ALLB_BACVZ      RKSAVDFALWGGLMPGYT-EHIRPMAEAGAIGFKAFLSKSGT----DEFQSADERTLLKG
ALLB_DEIRA      EKSLIDFGLWGGLTPLNL-DQLDDLAECGVIGLKAFMSHSGL----DEFPAADDLTLYEG
ALLB_DEIGD      RESYADFALWGGLTPRNL-DRLPELAEAGAVGFKAFMSHSGL----EEFESPDDFTLYEG
ALLB_SOLUE      RASIADFALWGGIVPGNL-SELAPLAESGVIGFKAFLSDSGL----PEFPRADDLTLYEG
ALLB_RUBXD      ASAHVDFALWGGIVPGRV-GRMEELAGRGVAGFKAFMSATGT----PDFEAADDLTLYEG
ALLB_DESHY      KDSLVDYGFWGGLTSANL-DKLDELAECGVIGFKAFACHSGI----DEFPRMDDYTALVG
ALLB_ALKHC      EKSLVDYRFWGGLVPGNI-DHLQDLHDGGVIGFKAFMSECGT----DDFQFSHDETLLKG
ALLB_ECOL6      GKLTIDAAQLGGLVSYNI-DRLHELDEVGVVGFKCFVATCGDRGIDNDFRDVNDWQFFKG
ALLB_ECOUT      GKLTIDAAQLGGLVSYNI-DRLHELDEVGVVGFKCFVATCGDRGIDNDFRDVNDWQFFKG
ALLB_ECOL5      GKLTIDAAQLGGLVSYNI-DRLHELDEVGVVGFKCFVATCGDRGIDNDFRDVNDWQFFKG
ALLB_ECOK1      GKLTIDAAQLGGLVSYNI-DRLHELDEVGVVGFKCFVATCGDRGIDNDFRDVNDWQFFKG
ALLB_ECOLI      GKLTIDAAQLGGLVSYNI-DRLHELDEVGVVGFKCFVATCGDRGIDNDFRDVNDWQFFKG
ALLB_SALPA      GKLTIDAAQLGGLVSYNL-DRLHELDEVGVVGFKCFVATCGDRGIDNDFRDVNDWQFYKG
ALLB_SALTI      GKLTIDAAQLGGLVSYNL-DRLHELDEVGVVGFKCFVATCGDRGIDNDFRDVNDWQFYKG
ALLB_SALTY      GKLTIDAAQLGGLVSYNL-DRLHELDEVGVVGFKCFVATCGDRGIDNDFRDVNDWQFYKG
ALLB_SALCH      GKLTIDAAQLGGLVSYNL-DRLHELDEVGVVGFKCFVATCGDRGIDNDFRDVNDWQFYKG
ALLB_BACLD      GKLSVDVASYGGLVPFDLDGGIQELDSNGVVAYKCFLATCGDRSIEGDFMNVDDYSLYEG
ALLB_ENTFA      NKLKVDVGSFGGVVPTNLADGIQELDEGGVSGYKCFLGTCGDRSIEGDFQNVDDYSLYEG
ALLB_BACSK      GQNYVDYSFYGGLVPTNL-HELADLSASGVVAFKCFLSPCGS-DIPGDFRNVDLNGLRAG
ALLB_STRCO      DKAHIDVGFWGGALPDNV-KDLRPLHEAGVFGFKAFLSPSGV----DEFPHLDQEQLARS
ALLB_STRAW      DKAHIDVGFWGGALPDNV-KDLRPLHDAGVFGFKAFLSPSGV----DEFPELDQERLARS
                     *    **  .      :  :   *. . *.*    *      :*   .      .

ALLB_BACSU      MAEIAAAGKILALHAESDAITSYLQMVLANKGKVDADAYAASRPEEAEVEAVYRTIQYAK
ALLB_BACVZ      MKEIAACGKVLALHAESDALTRFLEAEYALQGKIDVRAYASSRPEEAECEAVQRAIEYAR
ALLB_DEIRA      MRTAKRHGLVVATHAESNEFTRRLTETARAQGKSGVRDYLESRPVVTELEAVQRALLFAQ
ALLB_DEIGD      MLQARDLGLIVALHAESDAITRGLSTRIRREGGTGVRDYLRSRPAIAEVEAVNRALLLAE
ALLB_SOLUE      MREAARLGLPVAVHAESEEITSRLTRRARDAGRTSARDYLDSRPVIAEVEAIHRAALLAR
ALLB_RUBXD      MQEAARLGLPVLVHAENRQITDALARRATSALRTTMRDYLASRPAVAELEAIGRAILLAS
ALLB_DESHY      MEKLAKLGLPLMVHCENAEITKELTELSLANNRTGVRDYFAARPPITEIENVSRMITFAE
ALLB_ALKHC      MKKIAALGSILAVHAESNEMVNALTTIAIEEQRLTVKDYSEARPIVSELEAVERILRFAQ
ALLB_ECOL6      AQKLGELGQPVLVHCENALICDALGEEAKREGRVTAHDYVASRPVFTEVEAIRRVLYLAK
ALLB_ECOUT      AQKLGELGQPVLVHCENALICDALGEEAKREGRVTAHDYVASRPVFTEVEAIRRVLYLAK
ALLB_ECOL5      AQKLGELGQPVLVHCENALICDALGEEAKREGRVTAHDYVASRPVFTEVEAIRRVLYLAK
ALLB_ECOK1      AQKLGELGQPVLVHCENALICDALGEEAKREGRVTAHDYVASRPVFTEVEAIRRVLYLAK
ALLB_ECOLI      AQKLGELGQPVLVHCENALICDELGEEAKREGRVTAHDYVASRPVFTEVEAIRRVLYLAK
ALLB_SALPA      AQKLGEMDQTVLVHCENALICDELGEEAKREGRVTAHDYVASRPVFTEVEAIRRVLYLAK
ALLB_SALTI      AQKLGEMDQTVLVHCENALICDELGEEAKREGRVTAHDYVASRPVFTEVEAIRRVLYLAK
ALLB_SALTY      AQKLGEMDQTVLVHCENALICDELGEEAKREGRVTAHDYVASRPVFTEVEAIRRVLYLAK
ALLB_SALCH      AQKLGEMDQTVLVHCENALICDELGEEAKREGRVTAHDYVASRPVFTEVEAIRRVLYLAK
ALLB_BACLD      MKQIAKTGKILSIHAENAAITDKLGEIASKNGETSLRAYVDSRPVFTEVEPIRKIILFAK
ALLB_ENTFA      MKQVAKTGKVLAIHAENAPITDKLGAVAYQNGETTLAAYVATRPVFTEVEAIQKAILFAK
ALLB_BACSK      MRLLAEKGQLLCVHAEDPSMISQL--EAKLLSPVGADAYVASRPVEAEVKAVCDTLAAAR
ALLB_STRCO      LAEIAAFDGLLIVHAEDP----HHLAAAPQQGGPKYTHFLASRPRDAEDTAIATLLAQAK
ALLB_STRAW      MAEIAGFGGLLIVHAEDP----HHLAAAPQRGGPRYTDFLASRPRDAEDTAIANLLAQAK
                       .  :  *.*.                     :  :**  :*   :      * 

ALLB_BACSU      VTGCPVHFVHISTAKAVRLIREAKQEGLDVSVETCPHYVLFSHDDLRQRGSVAKCAPPLR
ALLB_BACVZ      ATGCALHFVHISTKRAVLSIQQAKKDGLDVTVETCPHYLLFSFEDFLKKGAAAKCAPPLR
ALLB_DEIRA      DTGAALHLVHVSSGAAVALAYEGKQKGIDVTIETCPHYLHFTGEDVERVGAALKCAPPLR
ALLB_DEIGD      ETGAKLHLVHLSTGRAVTLAAEARARGVDVSIETCPHYLCFTGEDMERLGAVLKCAPPLR
ALLB_SOLUE      EAGCKLHIVHISSGRGVAAALEARTMGTDIAIETCAHYLFFTEDDLLRLGAIAKCAPPLR
ALLB_RUBXD      EAGCSLHIVHVSTGRGVALVAAARERGVDVTCETCPHYLLFTDEDAVRIGAAAKCAPPLR
ALLB_DESHY      ETGCKLIIAHISTAKAVDLVAQARARGVDVYCETIGHYLYLTGDDVERLGTVAKCSPPIR
ALLB_ALKHC      LTCCPIHICHVSSRKVLKRIKQAKGEGVNVSVETCPHYLLFSLDEFAEIGYLAKCAPPLR
ALLB_ECOL6      VAGCRLHVCHVSSPEGVEEVTRARQEGQDVTCESCPHYFVLDTDQFEEIGTLAKCSPPIR
ALLB_ECOUT      VAGCRLHVCHVSSPEGVEEVTRARQEGQDVTCESCPHYFVLDTDQFEEIGTLAKCSPPIR
ALLB_ECOL5      VAGCRLHVCHVSSPEGVEEVTRARQEGQDVTCESCPHYFVLDTDQFEEIGTLAKCSPPIR
ALLB_ECOK1      VAGCRLHVCHVSSPEGVEEVTRARQEGQDVTCESCPHYFVLDTDQFEEIGTLAKCSPPIR
ALLB_ECOLI      VAGCRLHVCHVSSPEGVEEVTRARQEGQDVTCESCPHYFVLDTDQFEEIGTLAKCSPPIR
ALLB_SALPA      AAGCRLHVCHISSPEGVEEVTRARQEGQDVTCESCPHYFVLDTDQFEEIGTLAKCSPPIR
ALLB_SALTI      AAGCRLHVCHISSPEGVEEVTRARQEGQDVTCESCPHYFVLDTDQFEEIGTLAKCSPPIR
ALLB_SALTY      AAGCRLHVCHISSPEGVEEVTRARQEGQDVTCESCPHYFVLDTDQFEEIGTLAKCSPPIR
ALLB_SALCH      AAGCRLHVCHISSPEGVEEVTRARQEGQDVTCESCPHYFVLDTDQFEEIGTLAKCSPPIR
ALLB_BACLD      ETGCRVHIVHIACEEGVDEIVKAQQEGVDITCETCTHYLYFYKEELDHIGPVVKCSPPIR
ALLB_ENTFA      ETGCRIHICHVACQEGVEEVLKAQAEGVDVTCETCTHYLYFTTDELDAIGPVVKCSPPIR
ALLB_BACSK      ETGCRIHFVHISSAAAIEAIERAKEEGVDVTVESCPHYFLLSAEELAELGPLAKCQPPLR
ALLB_STRCO      RFNARVHVLHLSSSDALPLIAEARADGVRVTVETCPHYLTLTAEEVPDGASEFKCCPPIR
ALLB_STRAW      RLNARVHVLHLSSSDALPLIAGAKAEGVRVTVETCPHYLTLTAEEVPDGASEFKCCPPIR
                   . : . *::    :     .:  *  :  *:  **. :  ::    .   ** **:*

ALLB_BACSU      SRQSKETLIETLIAGDIDMVSSDHSPCRPSLKREDNMFLSWGGISGGQFTLLGMLELA-L
ALLB_BACVZ      SEADKEELIGVLAEGLIDMVSSDHSPCHPSLKREDNMFLSWGGISGGQFTLLGMIQLA-I
ALLB_DEIRA      DPAVQEELWRELLAGHIDTVGSDHSPAPPDMKTSEDFFSLWGGISGAQSTLNVMLEDGYA
ALLB_DEIGD      DASEVDALWQAIRAGHIDTIGSDHSPSTLDLKERADFFEVWGGIAGVQSTLTVLLTEG-R
ALLB_SOLUE      DRQEFDRLWAHVLGGIVDVVASDHSPAPPAMKTGDDFFAIWGGIAGVQSTLAVLLEAGHF
ALLB_RUBXD      PREEVESLWEQVLAGNVAFVTSDHSPCPPDMKAGEDMFRAWGGISGCQSLLPALLDEGYH
ALLB_DESHY      DGENQLQMWGRLFNDNIAFVSSDHSPCDPKLKNGE-FMRVWGGISACQTTLQGLLTHAYH
ALLB_ALKHC      ERQEVEDLWDGLMAGEIDLISSDHSPSLPQMKTGKTIFEVWGGIAGCQNTLAVMLTEGYH
ALLB_ECOL6      DLENQKGMWEKLFNGEIDCLVSDHSPCPPEMKA-GNIMKAWGGIAGLQSCMDVMFDEAVQ
ALLB_ECOUT      DLENQKGMWEKLFNGEIDCLVSDHSPCPPEMKA-GNIMKAWGGIAGLQSCMDVMFDEAVQ
ALLB_ECOL5      DLENQKGMWEKLFNGEIDCLVSDHSPCPPEMKA-GNIMKAWGGIAGLQSCMDVMFDEAVQ
ALLB_ECOK1      DLENQKGMWEKLFNGEIDCLVSDHSPCPPEMKA-GNIMKAWGGIAGLQSCMDVMFDEAVQ
ALLB_ECOLI      DLENQKGMWEKLFNGEIDCLVSDHSPCPPEMKA-GNIMKAWGGIAGLQSCMDVMFDEAVQ
ALLB_SALPA      DQENQKGMWEKLFNGEIDCLVSDHSPCPPEMKA-GNIMQAWGGIAGLQNCMDVMFDEAVQ
ALLB_SALTI      DQENQKGMWEKLFNGEIDCLVSDHSPCPPEMKA-GNIMQAWGGIAGLQNCMDVMFDEAVQ
ALLB_SALTY      DQENQKGMWEKLFNGEIDCLVSDHSPCPPEMKA-GNIMQAWGGIAGLQNCMDVMFDEAVQ
ALLB_SALCH      DQENQKGMWEKLFNGEIDCLVSDHSPCPPEMKA-GNIMQAWGGIAGLQNCMDVMFDEAVQ
ALLB_BACLD      EQSRLEGMWNRVLNGDISFVTSDHSPCTPDLKATDNAFEAWGGIAGLQNNVDVLFDEGVQ
ALLB_ENTFA      DADQQAALWNHVQTGGIAFVTSDHSPCTPDLKDTTNAFEAWGGISGVQNNVDVLFDEAVQ
ALLB_BACSK      PKQEQAKLWACLLDGQIDWLASDHSPCTPDLKD-GDFLTAWGGISGCQNNIDIMFDAAVK
ALLB_STRCO      EAANQDLLWQALADGTIDCVVTDHSPSTADLKT-DDFATAWGGIAGLQLSLPAMWTAA-R
ALLB_STRAW      EAANQDLLWQALADGTIDCVVTDHSPSTADLKT-DDFATAWGGISGLQLSLPAIWTEA-R
                       :   :  . :  : :****.   :*        ****:. *  :  :   .  

ALLB_BACSU      EHQIPFETIAEWTAAAPAKRFGLQ-KKGRLEAGCDADFVLVSM-EPYTVTRESMFAKHKK
ALLB_BACVZ      DHGIPFEHVARWTAEAPAKRFGLT-NKGRLEEGFDADFAIVRP-EPFTVTKETMFSKHKQ
ALLB_DEIRA      QRGLPLEIIAALLALNPAQRFGLP-QKGRLAVGADADFALVALGEKF--TLDTLYDRWQQ
ALLB_DEIGD      ERGLSLPDIARLSARTPAGHFGLA-GKGRLEPGADADLVLVDLDREWVHTPEDLHTRWKF
ALLB_SOLUE      QRGLRLERIAELTAGYPARRFALH-NKGSIAVGNDADLTLVDMDGQENLEPESLWQKHPV
ALLB_RUBXD      GRGLPPERLAELLSANVARRFGFA-GKGGIEEGNDADLALVDPSGEHVLREEDLHYRHPI
ALLB_DESHY      DRKFPLVKIAQLTAQHVNEIFKIK-GKGQINLGYDADFALVDLNHEFTLQAEDLFYKHKV
ALLB_ALKHC      KRKMPLTQIVQLLSTEPAKRFGLYPQKGTIQVGAEASFTLIDLNESYTLNASDLYYRHPI
ALLB_ECOL6      KRGMSLPMFGKLMATNAADIFGLQ-QKGRIAPGKDADFVFIQPNSSYVLTNDDLEYRHKV
ALLB_ECOUT      KRGMSLPMFGKLMATNAADIFGLQ-QKGRIAPGKDADFVFIQPNSSYVLTNDDLEYRHKV
ALLB_ECOL5      KRGMSLPMFGKLMATNAADIFGLQ-QKGRIAPGKDADFVFIQPNSSYVLTNDDLEYRHKV
ALLB_ECOK1      KRGMSLPMFGKLMATNAADIFGLQ-QKGRIAPGKDADFVFIQPNSSYVLTNDDLEYRHKV
ALLB_ECOLI      KRGMSLPMFGKLMATNAADIFGLQ-QKGRIAPGKDADFVFIQPNSSYVLTNDDLEYRHKV
ALLB_SALPA      KRGMSLPMFGKLMATNAADIFGLK-HKGRIAPGKDADLVFIQPDSSYVLKNEDLEYRHKV
ALLB_SALTI      KRGMSLPMFGKLMATNAADIFGLK-HKGRIAPGKDADLVFIQPDSSYVLKNEDLEYRHKV
ALLB_SALTY      KRGMSLPMFGKLMATNAADIFGLK-HKGRIAPGKDADLVFIQPDSSYVLKNEDLEYRHKV
ALLB_SALCH      KRGMSLPMFGKLMATNAADIFGLK-HKGRIAPGKDADLVFIQPDSSYVLKNEDLEYRHKV
ALLB_BACLD      KRNMPLSKFAAIIATNPAKRFNLA-SKGSIAVGKDADFVFIKKDAPYELKAEDLAYRHKI
ALLB_ENTFA      KRGLSLKQFADMIAANPADRYHLA-QKGRISIGKDADFVLIKPNAPYILKAEDLEYRNKI
ALLB_BACSK      RRGMPPEQLARLIATNPAKRMNLR-EKGEIAIGKDADFAFVDDRQSYTLTKEQLYYKNKH
ALLB_STRCO      GRGLGLEDVVRWMSERTAALVGLDARKGAIAPGHDADFAVLAPDETFTVDPAALQHRNRV
ALLB_STRAW      RRGHSLEDVVRWMSARTARLVGL-AQKGAIEAGRDADFAVLAPDETFTVDPAALQHRNRV
                 :      .    :        :   ** :  * :*.:..:            :  :   

ALLB_BACSU      SIYEGHTFPCSISATYSKGRCVYNDG-EKVTEIDGALVVPS-----------
ALLB_BACVZ      SLYEGHTFPYRIAATYSKGRCVYQDGGRKQSGAFGTFLKPSEIKEPIL----
ALLB_DEIRA      NPYRGQSFQGRVHATYLRGQPVYQNG-EFTGTPRGRLLRPRSL---------
ALLB_DEIGD      SPYLGRTFRGRVVQTRLRGQTVYAEG-RFPHPPQGRFLRPAPAS--------
ALLB_SOLUE      NPYTGNSFRGSIRRTMLRGTTIFNHD-EITVKSGGQLLRPKANTYATSGIHP
ALLB_RUBXD      SPYVGRSFRGRVVRTILRGRTVFEGG-RVVSGPAGRFVRPQREKGER-----
ALLB_DESHY      SPYVGDRFRGSVSQTILRGTTIYKDG-KIVSQPIGKHLRPHQ----------
ALLB_ALKHC      SPYVGQRFRGKVKHTICQGKHVYQDH--------------------------
ALLB_ECOL6      SPYVGRTIGARITKTILRGDVIYDIEQGFPVAPKGQFILKHQQ---------
ALLB_ECOUT      SPYVGRTIGARITKTILRGDVIYDIEQGFPVAPKGQFILKHQQ---------
ALLB_ECOL5      SPYVGRTIGARITKTILRGDVIYDIEQGFPVAPKGQFILKHQQ---------
ALLB_ECOK1      SPYVGRTIGARITKTILRGDVIYDIEQGFPVAPKGQFILKHQQ---------
ALLB_ECOLI      SPYVGRTIGARITKTILRGDVIYDIEQGFPVAPKGQFILKHQQ---------
ALLB_SALPA      SPYVGRTIGARITKTILRGDVIYDIEHGFPVPPKGQFILKHQQ---------
ALLB_SALTI      SPYVGRTIGARITKTILRGDVIYDIEHGFPVPPKGQFILKHQQ---------
ALLB_SALTY      SPYVGRTIGARITKTILRGDVIYDIEHGFPVPPKGQFILKHQQ---------
ALLB_SALCH      SPYVGRTIGARITKTILRGDVIYDIEHGFPVPPKGQFILKHQQ---------
ALLB_BACLD      SPYIGRKIGAQVVKTILRGVEIYDKEKGISNEKVGRFIP-------------
ALLB_ENTFA      SPYIGREIGAQVIQTILRGETIYAQETGVTEAFNGVFIKN------------
ALLB_BACSK      SPYVGRTIGCKVRRVLLRGQTIYTEEKGIIGKPSGELLHIH-----------
ALLB_STRCO      TAYAGKTLYGVVKSTWLRGERIVADG--AFTDPKGQLLDRA-----------
ALLB_STRAW      TAYAGKTLSGVVKSTWLRGERIMADG--EFTEPKGRLLSREP----------
                . * *  :   :  .  :*  :