CLUSTAL format seed alignment for MF_01646

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

CYSG_ACIAD       ---------------MEIFPISLKLQQQRCLIVGGGHIAYRKAILLVKAGAILDIVAPDI
CYSG_ALCBS       ---------------MEFLPISWRLQGKVALLAGGGEVALRKGRLLHRSGAILTVVAPQV
CYSG_HAHCH       --------MSTQLQTWDFLPISMNLQGRECLVVGDTEQAVRKTDLLLRAGAKVRLLGDPH
CYSG_PSEAE       ---------------MDFLPLFHSLQGRLALVVGGGEVALRKARLLADAGARLRVVAPQI
CYSG_PSEAB       ---------------MDFLPLFHSLQGRLALVVGGGEVALRKARLLADAGARLRVVAPQI
CYSG_PSEA7       ---------------MDFLPLFHSLQGRLALVVGGGEVALRKARLLADAGARLRVVAPQI
CYSG_PSEMY       ---------------MQFLPLFHKLQGRPVLVIGGGEVALRKARLLSDAGARLRVVAPEI
CYSG_PSEP1       ---------------MDYLPLFHKLQGGRVLVVGGGEIALRKARLLADAGGVLRVVAPDV
CYSG_PSEPK       ---------------MDYLPLFHKLQGGRVLVVGGGEIALRKARLLADAGGVLRVVAPDV
CYSG_PSEE4       ---------------MDYLPLFHKLQGGRALVVGGGEIALRKARLLADAGAALRVVAPEV
CYSG_PSEF5       ---------------MEYLPLFHNLRGSRVLVVGGGEIALRKSRLLADAGAQLRVVAPEI
CYSG_PSEPF       ---------------MKYLPLFHNLRGSRVLVVGGGEIALRKSRLLADAGALLRVVAPEI
CYSG_PSE14       ---------------MEFLPLFHNLRGSRVLVVGGGEIALRKSRLIADAGAVLRVVAPEI
CYSG_PSEU2       ---------------MEFLPLFHNLRGSRVLVVGGGEIALRKSRLIADAGAVLRVVAPEI
CYSG_PSESM       ---------------MEFLPLFHNLRGSRVLVVGGGEIALRKSRLIADAGAVLRVVAPEI
CYSG_PSEU5       ---------------MEYLPLFHNLKGRTVLIVGGGEIALRKARLLSEAGARLRVVAPSI
CYSG_SACD2       ---------------MDYLPLFFDLKAKPCLIVGGGTIATRKARLLHKAGAKLHVVAPKV
CYSG_GLUDA       ---------MSDATDPGWFPLALRLRGARVVVVGGGGIALNKVRLLLAHAARIDILAPRL
CYSG_GLUOX       MNTQPHHSSPDSPQDGGWFPISIRLSGARVLLVGGGEIAVNKGRLLLDHGARIDVLAEKL
CYSG1_HALHL      ---------------MHHYPIFLKLHGCRCLVVGGGEAAARRAGDLLRAGARVELIAPVL
CYSG2_HALHL      ---------------MDHYPIFLNLHGRHCVVIGGNETAARKGEDLLDSGAIITLIAPDL
CYSG_ALKEH       ---------------METLPVFMKLRDRRCLVVGGGRRAERKARLLLAAGAELTVLAEAP
CYSG_CHRVO       ---------------MEFFPIFLKLRHQRCLLVGGGEVALRKARLLLAAGASLQVVAPEL
CYSG_METFK       ---------------METLPIFMKLRDRPCLVVGGGEIASRKVSLLEKAGASVTVVSPEL
CYSG_METCA       ---------------MDYLPIFLKLRDLPCLIVGGGEVAVRKLGLLLDAGAAVTVIAASA
CYSG_NITOC       ---------------MQYLPIFLNIRGQQCLVVGGGTVAVRKVALLRQAGAEVKVIAPKL
CYSG_NITEU       ---------------MDYLPVFLNIKQRDCLVVGGGEIAVRKIRLLLRAHARIHVVSPAI
CYSG_NITEC       ---------------MDYFPVFLNIKQRNCLIVGGGSVAARKAKLLLRAGAHIHVVSPTI
CYSG_NITMU       ---------------MNFLPIFLDIHDRNCVVAGGGEVAARKVAMLLRAGAHVTVVAPRL
CYSG_THIDA       ---------------MNYLPIFLDLRDRHCLVVGGSETAARKAELLLRAGAHVAVAAPAL
CYSG_RUTMC       ---------------MNYLPIFIDIKQKPCLVVGGGDIAYRKINFLLKAHGQVTCIAKSS
CYSG_VESOH       ---------------MNYLPIFIDIKQKPCLVVGGGSIAYRKINLLLKAYGQVTCIAKSS
CYSG_PSEA6       ---------------MQYFPIFVDTKELNCLVVGAGEVAARKVELLLKTSATITVVAPWA
CYSG_PSYA2       ---------------MNTFPLFFKLEDRKVLIVGGGDVALRKADLLSRAGACITVLAPSI
CYSG_PSYCK       ---------------MNTFPLFFKLEDRKVLIVGGGDVALRKADLLSRAGACITVLAPSI
CYSG_PSYWF       ---------------MNTFPLFFKLTNQPVLIVGGGEVAQRKADLLSRAGACITILAPQI
CYSG_HYDCU       ---------------MDYLPIFMKIEQQHCLIVGGGTVAARKADLFIKSGAIVTVVAPKL
CYSG_ACTSZ       ---------------MHYFPVFADLNNRPVLVVGGGGVAARKVNLLLKANADVRIVAQKL
CYSG_MANSM       ---------------MNYFPVFADLNNRPVLVVGGGTIAARKVNLLLKANAEVRITAQKL
CYSG_NEIMA       ---------------MNYFPIFANLAGRPVLVVGGGAVAARKISLLLKAGAEVRVAAKHL
CYSG_NEIMF       ---------------MNYFPIFANLAGRPVLVVGGGAVAARKISLLLKAGAEVRVAAKHL
CYSG_NEIMB       ---------------MNYFPIFANLAGRPVLVVGGGAVAARKISLLLKAGAEVRVAAKHL
CYSG_NEIM0       ---------------MNYFPIFANLAGRPVLVVGGGSVAARKISLLLDAGAQVRVVANQL
CYSG_PHOPR       ---------------MDYLPIFTDLKRRPCLVVGGGDVAWRKARMLLKAGADVRVIAPVL
CYSG2_AERHH      ---------------MDYLPMFAKLDGRPVLLVGGGEVALRKARLLLAAGARLTLVSPEL
CYSG2_AERS4      ---------------MDYLPMFARLEGRPVLLVGGGEVALRKARLLLAAGARLTLVSPEI
CYSG_BAUCH       ---------------MEYLPLFANLRQRTVLVVGGGNVAARKIQLLMRTGAHIKVVADDL
CYSG_SODGM       ---------------MEYLPLFADLRRRPVLVVGGGEVAARKIQLLMRAGAQIIVAARAL
CYSG1_CROS8      ---------------MEYLPLFAQLKQRPVLVVGGGEVALRKIALLRRAGACVSVVAKKL
CYSG1_KLEP7      ---------------MDYLPLFAELKQRPVLVIGGGEIAERKIKFLLRAQAQVQVVAETL
CYSG1_YERPN      ---------------MDYLPLFADLKQRPVLIVGGGEVAARKIELLHRAGAQVWVVAQTL
CYSG2_YERPP      ---------------MDYLPLFADLKQRPVLIVGGGEVAARKIELLHRAGAQVWVVAQTL
CYSG1_YERPS      ---------------MDYLPLFADLKQRPVLIVGGGEVAARKIELLHRAGAQVWVVAQTL
CYSG1_YERP3      ---------------MDYLPLFADLKQRPVLIVGGGEVAARKIELLHRAGAQVWVVAQTL
CYSG1_YERE8      ---------------MDYLPLFADLKRRPVLVVGGGEVAARKIDLLHRAGAQVRVVAQTL
CYSG1_SERP5      ---------------MDYLPIFADLKQRPVLVVGGGEVAARKVDLLLRAGAEIRIVAQSL
CYSG1_PECAS      ---------------MNYLPIFADLRQRPVLVVGGGEVATRKIDLLQRAGAEVKIVALAL
CYSG_PHOLL       ---------------MDYLPIFVELKGRLVLLVGGGEVAARKATLLLRAGALLQVVAPEL
CYSG_ZYMMO       ---------------MDYLPLFADIRQRPVLVVGGGEVAARKVALLKKAGAIIKIVAKNI
CYSG_BLOFL       ---------------MRYLPLFVYLNNKPVLVVGGGIVAFRKVQILQKTGAIIQIVAKTL
CYSG_BLOPB       ---------------MEYLPIFIDLKNRPVLVVGGGAVAARKIHMLQR--ATITIVAPAL
CYSG_BUCAI       ---------------MNYLPIFIDLKSKNVLVIGAGEVGLNKIRILLRAKAKVNVIAKEL
CYSG_SALCH       ---------------MDHLPIFCQLRDRDCLIVGGGDVAERKARLLLEAGARLTVNALTF
CYSG_SALPB       ---------------MDHLPIFCQLRDRDCLIVGGGDVAERKARLLLEAGARLTVNALTF
CYSG_SALPA       ---------------MDHLPIFCQLRDRDCLIVGGGDVAERKARLLLEAGARLTVNALNF
CYSG_SALTY       ---------------MDHLPIFCQLRDRDCLIVGGGDVAERKARLLLEAGARLTVNALTF
CYSG_SALTI       ---------------MDHLPIFCQLRDRDCLIVGGGDVAERKARLLLEAGARLTVNALTF
CYSG_SALAR       ---------------MDHLPIFCQLRDRDCLIVGGGDVAERKARLLLEAGARLTVNALTF
CYSG_CITK8       ---------------MDHLPIFCQLRDRDCLLVGGGDVAERKARLLLEAGARLTVNALAF
CYSG_ENT38       ---------------MDHLPIFCQLRHRDCLLVGGGDVAERKARLLLEAGARLTVNALAF
CYSG_ECOLC       ---------------MDHLPIFCQLRDRDCLIVGGGDVAERKARLLLDAGARLTVNALAF
CYSG_ECOLI       ---------------MDHLPIFCQLRDRDCLIVGGGDVAERKARLLLDAGARLTVNALAF
CYSG_ECO57       ---------------MDHLPIFCQLRDRDCLIVGGGDVAERKARLLLDAGARLTVNALAF
CYSG_ECOHS       ---------------MDHLPIFCQLRDRDCLIVGGGDVAERKARLLLDAGARLTVNALAF
CYSG_ECOUT       ---------------MDHLPIFCQLRDRDCLIVGGGDVAERKARLLLDAGARLTVNALAF
CYSG_ECOK1       ---------------MDHLPIFCQLRDRDCLIVGGGDVAERKARLLLDAGARLTVNALAF
CYSG_ECOL5       ---------------MDHLPIFCQLRDRDCLIVGGGDVAERKARLLLDAGARLTVNALAF
CYSG_ECOL6       ---------------MDHLPIFCQLRDRDCLIVGGGDVAERKARLLLDAGARLTVNALAF
CYSG_SHIDS       ---------------MDHLPIFCQLRDRDCLIVGGGDVAERKARLLLDAGARLTVNALAF
CYSG_SHIFL       ---------------MDHLPIFCQLRDRDCLIVGGGDVAERKARLLLDAGARLTVNALAF
CYSG_SHIF8       ---------------MDHLPIFCQLRDRDCLIVGGGDVAERKARLLLDAGARLTVNALAF
CYSG_SHISS       ---------------MDHLPIFCQLRDRDCLIVGGGDVAERKARLLLDAGARLTVNALAF
CYSG_SHIBS       ---------------MDHLPIFCQLRDRDCLIVGGGDVAERKARLLLDAGARLTVNALAF
CYSG_ECO24       ---------------MDHLPIFCQLRDRDCLIVGGGDVAERKARLLLDAGARLTVNALAF
CYSG2_KLEP7      ---------------MDHLPIFCQLRQRDCLLVGGGDVAERKARLLLDAGANVTVNALDF
CYSG2_CROS8      ---------------MDHLPIFCQLRHRACLLVGGGDVAERKARLLLEAGAALTVNALAF
CYSG_YERPE       ---------------MDYFPIFCQLQHKACLLVGGGEIAERKARLLLDAGALVTVNACEF
CYSG_YERPA       ---------------MDYFPIFCQLQHKACLLVGGGEIAERKARLLLDAGALVTVNACEF
CYSG2_YERPN      ---------------MDYFPIFCQLQHKACLLVGGGEIAERKARLLLDAGALVTVNACEF
CYSG1_YERPP      ---------------MDYFPIFCQLQHKACLLVGGGEIAERKARLLLDAGALVTVNACEF
CYSG2_YERPS      ---------------MDYFPIFCQLQHKACLLVGGGEIAERKARLLLDAGALVTVNACEF
CYSG2_YERP3      ---------------MDYFPIFCQLQHKACLLVGGGEIAERKARLLLDAGALVTVNACEF
CYSG2_YERE8      ---------------MDYFPIFCQLQNKACLLVGGGEVAERKARLLLDAGAAVTVNACEF
CYSG2_SERP5      ---------------MDYLPIFCQLQHKACLLVGGGEIAERKARLLLDAGAALTVNACSF
CYSG2_PECAS      ---------------MDYLPIFCQLHDKPCLLVGGGEIAERKARLLLDAGAVITVNALDF
CYSG1_AERHH      ---------------MDFLPLFCQLQHKPVLIVGGGEVAVRKARLLLDAKARVTINAPHL
CYSG3_AERHH      ---------------MDYLPIFCRLDNKPVLLVGGGEVAERKARLLLDAGAQLTVVAPEL
CYSG1_AERS4      ---------------MDYLPIFCRLDNKPVLLVGGGEVAERKARLLLDAGARLTVVSPAL
CYSG_PSYIN       ---------------MDYLPIFTKLENRPCLVVGGGSIACRKIHLLLKAGADVTVCALEF
CYSG_PSET1       ---------------MQYLPIFTKLDNKPVLVVGGGDVALRKCSALLKARASITLVAPKF
CYSG_BORBR       ---------------MTLFPIFADLTGRRVLVVGGGAVAVRKTQALLQAGAEVVVGAPRL
CYSG_BORPA       ---------------MTLFPIFADLTGRRVLVVGGGAVAVRKTQALLQAGAEVVVGAPRL
CYSG_BORPE       ---------------MTLFPIFADLTGRRVLVVGGGAVAVRKTQALLQAGAEVVVGAPRL
CYSG_BORA1       ---------------MKLFPIFSDIKGRCVLVVGGGAVATRKAQALLEAGAAVSVGAPTL
CYSG_XYLFA       ------------MTANVLFPLFANLHDRAVLVVGGGKVAERKTEALLKVGALPIIGAPSL
CYSG_XYLFT       ------------MTANVLFPLFANLHDRAVLVVGGGKVAERKTEALLKVGALPIIGAPSL
                                    *:         :: *    . .:   :    .     .   

CYSG_ACIAD       DPQLMSLIEQSA----GTAYVKLFEDHDLDRVY--RLVIAATDNADVNKRVFEQAELRNL
CYSG_ALCBS       CDELLDIVVRSG----GSCVVRAFESADLDGV---ALVICATDDRSTNAEIAKQAQQRGL
CYSG_HAHCH       AKALKESADALN----AITVIPDPFHPDLLQLC--AVVVAASDSAMLNQQVAQAAQARGI
CYSG_PSEAE       HIELRHLVEQGG----GELLERDYQDGDQPGC---ALIIAATDDEPLNAEVSRAANARGI
CYSG_PSEAB       HIELRHLVEQGG----GELLERDYQDGDQPGC---ALIIAATDDEPLNAEVSRAANARGI
CYSG_PSEA7       HIELRHLVEQGG----GELLERDYQDGDQPGC---ALIIAATDDEPLNAEVSRAANARGI
CYSG_PSEMY       RSELQELA--GA----DGICLRGYASSDLQGV---ALVIAATDDEPLNARISAEAQAQGI
CYSG_PSEP1       DGQLAALAREGG----GEVLVRGYQAADLVGC---RLVIAATDDPGLNAQVSADAQALSV
CYSG_PSEPK       DGQLAALAREGG----GEVLVRGYQAADLVGC---RLVIAATDDPGLNAQVSADAQALSL
CYSG_PSEE4       DGQLAALAREGG----GEVLVRGYQSSDLDGC---RLVIAATDDPGLNAQVSAHAQARSL
CYSG_PSEF5       EAQLQELIVASG----GESLLRGYVEADLDGC---TLIIAATDDESLNAQVSADAHRRCV
CYSG_PSEPF       EAQLRELVAASG----GECLLRGYAEADLDGC---GLIIAATDDEALNAHVSADAHRRCV
CYSG_PSE14       EAQLSELVVQSG----GEMILRGYSESDLDGC---VLIIAATDDEPLNAQVSHDARLRCV
CYSG_PSEU2       EAQLSELVVQSG----GEMILRGYSECDLDGC---VLIIAATDDEPLNAQVSRDARLRCV
CYSG_PSESM       ETQLRELVAHSG----GELILRGYSESDLDGC---VLIIAATDDEPLNAQVSRDARLRCV
CYSG_PSEU5       EAQLVELVQAGA----GECLDRGYARQDLQGC---VLAIAATDDEPLNATVSQHANALGV
CYSG_SACD2       SEELEKLVAASN----GKVFKQEYDQTFLDDV---ILVISATDIDAVNSVVAADCHAIKL
CYSG_GLUDA       EDTLAAWQAEGRITHIAGEATPDRVRALLPGS---RLVYAATDDRAVNRAVAAQADALNI
CYSG_GLUOX       HPAVQGWVENGRVRHVGERADEAVLRRLLPGC---RLVYAATDSRDTNRQVAALADELNI
CYSG1_HALHL      AAPCEQLLDTS--PGELHHRAEPFAAGMEEGA---ALVVGASGDEATDRTVYEACRARGI
CYSG2_HALHL      GGDCEDLLQRY--PDRAHHRAEDYKPGMEQGA---ALVLSASGHDATDRLVYRQCTRLGI
CYSG_ALKEH       LPTLAALTEAH----GCRMVRRPLTARDLDGV---SLVISAA-DEATDRRAHMLARARNI
CYSG_CHRVO       APELADLAERG----ELEHLPGRYAPALLDGM---RLAVAATDDAEVNRAVAADAEARGI
CYSG_METFK       HPTLAKSLAEG----RIRHLASVFEPAQLDGA---VLVIAATDDAEVNRAVSREAQARNI
CYSG_METCA       EAVIVELADRGL----IRLRTKVFEATDSEGF---RLIIAATDDRAVNAAVATAARRHGI
CYSG_NITOC       HEQLQEWADKGK----ITAQQASFSETEIKSC---YLVIAATDDSSLNEQVYHLATAQGV
CYSG_NITEU       SEELSNLLLQSP---VITHTAESFRPDHLQDR---ALAIAATNDHEVNRAVSAAARKAGI
CYSG_NITEC       NAEFTGLLQQFS---SISHNAETFRPDHLQGR---VLVIAATHDRATNQAVSVAARKAGI
CYSG_NITMU       CSELLEQLNEQSREGKLAYRAETFQDEHLADA---VLVIAATDDFAVNQRISEAAKRLRI
CYSG_THIDA       HAGFEQLPDRQR----LTRVADTFSPALLDGK---DAVIVVEDDAAAAQIVADAARARHL
CYSG_RUTMC       CKNVVKLASDNK----IIYFEKSFEASDIKEQ---VLIVSATDNTSLNKQVSELSNQNNI
CYSG_VESOH       CKNVAKLVNNKK----IIYIERSFESSDVNGQ---VLIISATNNATLNKKVSELASQNNI
CYSG_PSEA6       CDTVQRLADEGQ----VTLHTRGYESSDLTAK---QLVFVATDDSQLNIDIHHQAKAQNI
CYSG_PSYA2       NHEIQALLSSSK----HELIYEHYNKTYMTNS---RVIIAATDDERLNHQIHADATALNI
CYSG_PSYCK       SHEIQALLSDSK----HALIYENYNKTYMTDS---RVIIAATDDETLNHQIHSDATALNI
CYSG_PSYWF       SQEIHQLLSDER----HTLITAHYDKKYIDGK---RIVIAGTDDEALNHQVHADCKALNI
CYSG_HYDCU       GNEMTFHLAQGK----IIWHMNTFSTALVSELPRPSLVISATDDQNVNLAVYKTYHAQDI
CYSG_ACTSZ       NAELTALFELGH----ILWIAGEFNS-EQIR--NVFLVIAATDDEYLNERVFRVAESQQK
CYSG_MANSM       NAELTALVEQDR----IIWIAKEFHG-EQIR--NVFLVVAATDDEQLNEQVFQVAESRQK
CYSG_NEIMA       NAELSALAAENK----ILWLAEEFRA-EHIR--TVFLIIAASSDQALNRRVFHLAESCQK
CYSG_NEIMF       NAELSALAAENK----ILWLAEEFRA-EHIR--TVFLIIAASSDQALNRRVFHLAESCQK
CYSG_NEIMB       NAELSALAAENK----ILWLAEEFRA-EHIR--TVFLIIAASSDQALNRRVFHLAESCQK
CYSG_NEIM0       NAELSALAAENK----ILWLAEEFRA-EHIR--TVFLIIAASSDQALNRRVFQLAESCQK
CYSG_PHOPR       NQAFQQAIEQQQ----VSHVADEFES-SHLD--GIFLAIAATDRKAVNALVYQSANQRQV
CYSG2_AERHH      EPDFHQFA--DR----FTHLAERFTP-AHLT--GQILVVAATDDLEVNALVYQSANQLGL
CYSG2_AERS4      EPEFAEFA--GR----FTHLVERFTP-AHLA--GQLLVVAATDNLEVNALVYQSANQLGL
CYSG_BAUCH       CPELARIVNKKD----INWIGKLFEP-AMLD--EVFLVIAATNNTKLNALVYKCAEKRHI
CYSG_SODGM       CPALEEIRQAGG----LSWLGESFEP-AMLD--DVFLVIAATDDAALNARVSQCAEQRHL
CYSG1_CROS8      HPELAALEQEGA----LRWLAQSFEP-AQLD--AVFLVIAATSDAALNRRVFDEANARQR
CYSG1_KLEP7      SPALADLAARQA----LSWRATEFSD-SLVD--DVFLVIAATEDDALNQRVFAAANARYR
CYSG1_YERPN      SSELEQQYQDGR----IHWLAQDFLP-EQLD--NVFLVIAATNDTVLNAAVFAAADQRCI
CYSG2_YERPP      SSELEQQYQDGR----IHWLAQDFLP-EQLD--NVFLVIAATNDTVLNAAVFAAADQRCI
CYSG1_YERPS      SSELEQQYQDGR----IHWLAQDFLP-EQLD--NVFLVIAATNDTVLNAAVFAAADQRCI
CYSG1_YERP3      SSELEQQYQDGR----IHWLAQDFLP-EQLD--NVFLVIAATNDTVLNAAVFAAADQRCI
CYSG1_YERE8      SSELEQLHQDGR----IHWLALDFLP-EQLD--EVFLVIAATNDTALNAAVFAAADQRHL
CYSG1_SERP5      SPILEQLSQQGQ----IHWLGQAFAA-EQLD--EVFLVIAATDDSALNAEVFSEADKRRV
CYSG1_PECAS      AEPLAAQHQAGQ----VEWLAQSFTP-ELLS--GVFLVIAATDDAELNAAVFEAANQRHL
CYSG_PHOLL       CSELQQRYQAGE----LEWYQGEFQP-EYLD--GIFLVIAATDDRILNHQVFSEADKRSI
CYSG_ZYMMO       HPELQILQENHE----IEWLAKSFSP-EQLD--HVFLVIAATNDSLLNQQIYQAAEQRHR
CYSG_BLOFL       CLNLKTTLFKKK----IIWIGKVFQI-SMLD--NVFLVIIATDDTDFNDMVFKYAEKRHI
CYSG_BLOPB       CTELKKVLIKQN----ISWISKNFQP-IMLN--KVILVIVATNDSKLNTFIYQNAEKHNI
CYSG_BUCAI       CSEVKLLLRDQK----INWLSKNFDL-IYLN--KIFLVVSATNDIKLNQYIFKKCNERCV
CYSG_SALCH       IPQFTVWANEGM----LTLVEGPFDE-TLLD--SCWLAIAATDDDTVNQRVSDAAESRRI
CYSG_SALPB       IPQFTVWANEGM----LTLVEGPFDE-TLLD--SCWLAIAATDDDTVNQRVSDAAESRRI
CYSG_SALPA       IPQFTVWANEGM----LTLVEGPFDE-TLLD--SCWLAIAATDDDTVNQRVSDAAESRRI
CYSG_SALTY       IPQFTVWANEGM----LTLVEGPFDE-TLLD--SCWLAIAATDDDTVNQRVSDAAESRRI
CYSG_SALTI       IPQFTVWVNEGM----LTLVEGPFDE-TLLD--SCWLAIAATDDDTVNQRVSEAAESRRI
CYSG_SALAR       IPQFTVWADEGM----LTLVEGPFDE-ALLD--PCWLAIAATDDDAVNQHVSEAAESRRI
CYSG_CITK8       IPQFTVWANEGM----LTLVEGAFEE-SLLD--GCWLAIAATDDDAVNQQVSEAAESRRI
CYSG_ENT38       DPQFNVWAQEGM----LTLVQGEFDE-SLLD--TCWLTIAATDDDDVNQRVSDACEIRRI
CYSG_ECOLC       IPQFTAWADAGM----LTLVEGPFDE-SLLD--TCWLAIAATDDDALNQRVSEAAEARRI
CYSG_ECOLI       IPQFTAWADAGM----LTLVEGPFDE-SLLD--TCWLAIAATDDDALNQRVSEAAEARRI
CYSG_ECO57       IPQFTAWADAGM----LTLVEGPFDE-SLLD--TCWLAIAATDDDALNQRVSEAAEARRI
CYSG_ECOHS       IPQFTAWADAGM----LTLVEGPFDE-SLLD--TCWLAIAATDDDALNQRVSEAAEARRI
CYSG_ECOUT       IPQFTAWADAGM----LTLVEGPFDE-SLLD--TCWLAIAATDDDALNQRVSEAAESRRI
CYSG_ECOK1       IPQFTAWADAGM----LTLVEGPFDE-SLLD--TCWLAIAATDDDALNQRVSEAAESRRI
CYSG_ECOL5       IPQFTAWADAGM----LTLVEGPFDE-SLLD--TCWLAIAATDDDALNQRVSEAAESRRI
CYSG_ECOL6       IPQFTAWADAGM----LTLVEGPFDE-SLLD--TCWLAIAATDDDALNQRVSEAAEARRI
CYSG_SHIDS       IPQFTAWADAGM----LTLVEGPFDE-SLLD--TCWLAIAATDDDALNQRVSEAAEARRI
CYSG_SHIFL       IPQFTAWADAGM----LTLVEGPFDE-SLLD--TCWLAIAATDDDTLNQRVSEAAEARRI
CYSG_SHIF8       IPQFTAWADAGM----LTLVEGPFDE-SLLD--TCWLAIAATDDDTLNQRVSEAAEARRI
CYSG_SHISS       IPQFTAWADAGM----LTLVEGPFDE-SLLD--TCWLAIAATDDDTLNQRVSEAAEARRI
CYSG_SHIBS       IPQFTAWADAGM----LTLVEGPFDE-SLLD--TCWLAIAATDDDTLNQRVSEAAEARRI
CYSG_ECO24       IPQFTAWADAGM----LTLVEGPFDE-SLLD--TCWLAIAATDDDALNQRVSEAAEARRI
CYSG2_KLEP7      TPQFQVWADSQM----LTLVQGEFIP-SLLD--NCWLAIAATDDETVNQQVSEAAEARRI
CYSG2_CROS8      APQFKAWAKQGM----LRLVQGEFNA-SLLD--DCWLAIAATDDDAVNNQVSEAAEARRI
CYSG_YERPE       TPQFHHWADQGQ----LSLISGEFVP-ELLA--DKWLVIAATDQLSVNALVYQSANQQRI
CYSG_YERPA       TPQFHHWADQGQ----LSLISGEFVP-ELLA--DKWLVIAATDQLSVNALVYQSANQQRI
CYSG2_YERPN      TPQFHHWADQGQ----LSLISGEFVP-ELLA--DKWLVIAATDQLSVNALVYQSANQQRI
CYSG1_YERPP      APQFHHWADQGQ----LSLISGEFVP-ELLA--DKWLVIAATDQLSVNALVYQSANQQRI
CYSG2_YERPS      TPQFHHWADQGQ----LSLISGEFVP-ELLA--DKWLVIAATDQLSVNALVYQSANQQRI
CYSG2_YERP3      TPQFHHWADQGQ----LSLISGEFVP-ELLA--DKWLVIAATDQLSVNALVYQSANQQRI
CYSG2_YERE8      TEQFHDWAEQGL----LSLVSGEFAP-ELLA--EKWLVIAATDQVAVNALVYQSANQQRV
CYSG2_SERP5      TPQFHEWAALGR----LTLAAGEFSA-ELLA--EKWLVIAATDRVEVNALVYQCANQQRV
CYSG2_PECAS      NDQFRAWEKDAQ----LTLVHSTFDP-ALLN--EVWLVIAATDNQDVNNHVYASASERRI
CYSG1_AERHH      EPQLMSWAEQGL----LTVCAADFHP-ELLD--GKWLVIAATNQPEVNQQVFNEANRRQI
CYSG3_AERHH      DPELAELAANGS----IEWLAGEFAP-QQLT--GKWLVVAATDRREVNALVYQSANQARI
CYSG1_AERS4      DPELAALATSGT----IDWLAAEFEP-AHLT--GKWLVVAATDRREVNALVYQSANQAGI
CYSG_PSYIN       NPSLLKQAANKE----LKILEQAFTE-ELLE--NKWLVIAATNKKQVNEHIATAAHAKQL
CYSG_PSET1       CQQLIELASENK----VTLIHEYFSE-QHLK--NMMLVIAATDLEHVNSQVFELANAHNI
CYSG_BORBR       DPALAALAEQGG----IARLDGGFEP-AWLA--GAWLVVAATDDRAVNAAVSEAARARRV
CYSG_BORPA       DPALAALAEQGG----IARLDGGFEP-AWLA--GAWLVVAATDDRAVNAAVSEAARARRV
CYSG_BORPE       DPALAALAEQGG----IARLDGGFEP-AWLA--GAWLVVAATDDRAVNAAVSEAARARRV
CYSG_BORA1       TPELARLAQGQT----ITHLQGEFDA-DWLK--DAWLIIAATDDRTVNTRVYEAACARRQ
CYSG_XYLFA       TASLQHWAETGR----ITWRQGTFEN-SWLQE-DIWLVIAATDQPEVNHAAARAAHAQRL
CYSG_XYLFT       TASLQRWAETGR----ITWRQGTFEN-SWLQE-DIWLVIAATDQPEVNHAAARAAHAQRL
                                                                             

CYSG_ACIAD       LVNSVDDIPNCRFMVPAIIDRSPLLISVASNGASPVLSRQLRTQIETLVPHGMGKLAEFS
CYSG_ALCBS       PVNVVDDPSLGDFIFPAIVDRSPVLISISSSGASPVLARKLRAQLESTLPARWGRLADLM
CYSG_HAHCH       PVNVVEQPELSSFIFPSIIDRHPVLVSVTSSGGAPVLTRLLRNRLESLIPHGFGRLADLA
CYSG_PSEAE       PVNVVDAPALCSVIFPAIVDRSPLVVAVSSGGDAPVLARLIRAKLETWIPSTYGQLAGLA
CYSG_PSEAB       PVNVVDAPALCSVIFPAIVDRSPLVVAVSSGGDAPVLARLIRAKLETWIPSTYGQLAGLA
CYSG_PSEA7       PVNVVDAPALCSVIFPAIVDRSPLVVAVSSGGDAPVLARLIRAKLETWIPSSYGQLAGLA
CYSG_PSEMY       PVNVVDAPALCSVIFPAIVDRSPLIVAVSSGGDAPVLARLIRAKIETWIPATYGQLANLG
CYSG_PSEP1       PVNVVDAPALCTVIFPAIVDRSPLVIAVSSGGDAPVLARLIRAKLEAWIPSAYGELAGLA
CYSG_PSEPK       PVNVVDAPALCTVIFPAIVDRSPLVIAVSSGGDAPVLARLIRAKLEAWIPSAYGELAGLA
CYSG_PSEE4       PVNVVDAPALCTVIFPAIVDRSPLVVAVSSGGDAPVLARLIRAKLEAWIPSAYGELAGLA
CYSG_PSEF5       PVNVVDAPALCSVIFPAIVDRSPLVIAVSSGGDAPVLARLIRAKLETWIPSTYGQLAGLA
CYSG_PSEPF       PVNVVDAPALCSVIFPAIVDRSPLIIAVSSGGDAPVLARLIRAKIETWIPSTYGHLAGLA
CYSG_PSE14       PVNVVDAPALCTVIFPAIVDRSPLVIAVSSGGDAPVLARLIRAKLETWIPSTYGQLAGLA
CYSG_PSEU2       PVNVVDAPALCTVIFPAIVDRSPLVIAVSSGGDAPVLARLIRAKLETWIPSSYGQLAGLA
CYSG_PSESM       PVNVVDAPALCTVIFPAIVDRSPLVIAVSSGGDAPVLARLIRAKLETWIPSSYGQLAGLA
CYSG_PSEU5       PVNVVDSPQLCSVIFPAIVDRSPLVVAVSSGGDAPVLARLIRARIETWIPAAYGQLAGLA
CYSG_SACD2       PVNVVDSPALCSVIMPAIIDRSPLIIGVTSGGEAPVLARRVRSMLESSIPAAYGQLAQLA
CYSG_GLUDA       PVCAVDDPEPSSFITPAQIHRGPVRIAISTGGAAPVLARRLRERIEAVMPAGLDALARFL
CYSG_GLUOX       PVCAVDDPGPSSFITPAQVRRGMVRVAVSTGGAAPVLARRLREQIETLLPEGTGRLATYM
CYSG1_HALHL      PVNVAGRPSLSTYITPVQVDRSPLQLAVSSGGAAPVLARQIASRLETLLPAAYGRLARLA
CYSG2_HALHL      PVNTVDRPEYCSYITPAVVDRSPLQVAITSGGAAPVLARQVRSQIETLLPTAYGRLAALA
CYSG_ALKEH       PINVVDRPDLCSFTLPATVDRGPVQIAVSTGGTSPVLARMLRNRLEADIPSAYGRLARLA
CYSG_CHRVO       LVNVVDDAEASRYISPAIIDRSPLMVAVASGGSVPVLARSIRARLESLIPAGYGRLARFG
CYSG_METFK       PVNVVDAPELCTFIVPSIVDRSPLLVAVSSGGTAPVLARMLRTRIETLIPATYGRLAAFA
CYSG_METCA       PVNVVDCPDLCDFIFPAIIDRSPVLVAVSTGGASPVLARQLRTRIETCIPSRFGTLARLA
CYSG_NITOC       LVNVADCPRFCDFILPSIVDRSPVIVAVSSGGASPVLARLLRARLETLIPQAYGRLGQFA
CYSG_NITEU       PVNVVDNPDLCTFIMPSILDRSPIIVAVSSGGTSPILARLLRSRLEALIPSAYGRLAEYA
CYSG_NITEC       PVNVVDNPDLCTFIMPSILDRSPIIVAVSSGGGSPVLARLLRARLEALIPAAYGRLATYA
CYSG_NITMU       PVNVVDNPGLCSFIMPSIVDRTPVVVAVSSGGASPVLTRLLRARLETMIPMAYGRLAAYA
CYSG_THIDA       PVNVADKPALCSFILPSIIDRSPIMVAVSSGGESPVLARLLRARLETLIPAAYGRLSALA
CYSG_RUTMC       PVNVVDSPDLCTFIMPSIVDRSPIVIAISSAGKAPVLARLIRAKLESTLPHAYGKLAELA
CYSG_VESOH       PVNVIDSPDLCTFIMPSIVDRSPILIAISSAGKAPVLARIIRAKLESTLPHAYGKLAELA
CYSG_PSEA6       LVNVVDNTPLCQFITPSIVDRSPIIIAMSSGGVAPVLLRYLRQKLESVIPQKVSLLGQFS
CYSG_PSYA2       PVNVVDTPHLCDFIFPAIVDRNPIVIGISSNGKAPVLARLLRARLETLIPQGYGKLAKLA
CYSG_PSYCK       PVNVVDTPHLCDFIFPAIVDRNPIVIGISSNGKAPVLARLLRARLETLIPQGYGKLAKLA
CYSG_PSYWF       PVNVVDTPPLCDFIFPAIVDRNPIVIGISSNGKAPVLARLTRARLETLIPQGYGKLAKLA
CYSG_HYDCU       PVNVADQTEYCDFILPAIVDRSPMTIAISTGGRSPVLARVMKARLETMIPHGFSVLTDLV
CYSG_ACTSZ       LVNVVDDQARCSFIFPSIIDRNPIQVAVSSGGTAPVLARLLREKLEALLPQHLGAMADIS
CYSG_MANSM       LVNVVDDQARCSFIFPSIIDRSPIQVAVSSGGAAPVLARLLREKLEALLPQHLGVMADIS
CYSG_NEIMA       PVNVVDDRDHCSFIFPSVIDRNPVQIAVSSSGSAPVLARLLRERLEALLPPSLGDMAEIS
CYSG_NEIMF       PVNVVDDRDHCSFIFPSVIDRNPVQIAVSSSGSAPVLARLLRERLEALLPPSLGDMAEIS
CYSG_NEIMB       PVNVVDDRDHCSFIFPSVIDRNPVQIAVSSSGSAPVLARLLRERLEALLPPSLGDMAEIS
CYSG_NEIM0       PVNVVDDRDYCSFIFPSIINRNPIQIAVSSSGSAPVLARLLREKLEALLPHSLGDMAEIS
CYSG_PHOPR       LVNVVDDTQRCSFIIPSIIDRSPIIVAVSSSGKAPVLARLIREKLEALLPQHLGRMATIA
CYSG2_AERHH      FVNVVDDPKRSSFIFPSIIDRSPIMVAVSSGGKAPVLVRLLRERLESLLPRHLGALAELS
CYSG2_AERS4      FVNVVDDPKRSSFIFPSIIDRSPLMVAVSSGGKAPVLVRLLRERLESLLPRHLGGLTELS
CYSG_BAUCH       FANIVDKQSYCSFIFPSIVDRSPIVVAISSSGKAPVLARILREKIETILPMFIGPMATLV
CYSG_SODGM       LANVVDDQPYCSFIFPSIIDRAPIVVAISSSGTAPVLARILREKLESILPTFLGPMAAIA
CYSG1_CROS8      LVNVVDDQPLCSFIFPSIVDRSPLIVAISSSGNAPVLARLLREKIESLLPASLGRMAEVA
CYSG1_KLEP7      LVNVVDNQALCSFVFPSIVDRSPLLVAISSSGKAPVLSRILREKIEALLPTNLGRLAESA
CYSG1_YERPN      LANVVDDQPLCSFIFPSIVDRSPLVVAISSSGQAPVLARILREKLEALLPTRLSDMAAIA
CYSG2_YERPP      LANVVDDQPLCSFIFPSIVDRSPLVVAISSSGQAPVLARILREKLEALLPTRLSDMAAIA
CYSG1_YERPS      LANVVDDQPLCSFIFPSIVDRSPLVVAISSSGQAPVLARILREKLEALLPTRLSDMAAIA
CYSG1_YERP3      LANVVDDQPLCSFIFPSIVDRSPLVVAISSSGQAPVLARILREKLEALLPTRLSDMAAIA
CYSG1_YERE8      LANVVDDQPRCSFIFPSIVDRSPLVVAISSAGQAPVLARILREKLEALLPSSLGDMAAVA
CYSG1_SERP5      LANVVDDQPRCSFIFPSIIDRSPLVVAVSSSGQAPVLARMLREKLEALLPASLGQMAEVA
CYSG1_PECAS      LVNVVDDQPKCTFIFPSIVDRSPLVVAISSGGQAPVLARLLREKLESLLPASLGTMAEIA
CYSG_PHOLL       LVNVVDDQVHCSFIFPSIIDRSPVLVAISSAGKAPVLARLIREKLEALLPSSLGTMAKIA
CYSG_ZYMMO       LVNVVDDQQKCSFIFPSIVDRAPITLALSSAGTSPVLVRMLREKLEALLPQSLGKMAEIA
CYSG_BLOFL       LVNTVDDPAKCSFIFPAIIDRSPILIGISSGGQAPVLIRMLKEKLESLIPMSIGYVASLA
CYSG_BLOPB       LINTVDDKNKCSFIFPAIIDRNPVLIGISSCGKAPILVRILREKLELLLPKSLGFVAKLA
CYSG_BUCAI       LVNIVDDKLKCSFIFPSIIDRSPLIVAISSGGTAPVLLRLLREKIEAILPNKLGDVAKIA
CYSG_SALCH       FCNVVDAPKAASFIMPSIIDRSPLMVAVSSGGTSPVLARLLREKLESLLPQHLGQVARYA
CYSG_SALPB       FCNVVDAPKAASFIMPSIIDRSPLMVAVSSGGTSPVLARLLREKLESLLPQHLGQVARYA
CYSG_SALPA       FCNVVDAPKAASFIMPSIIDRSPLMVAVSSGGTSPVLARLLREKLESLLPQHLGQVARYA
CYSG_SALTY       FCNVVDAPKAASFIMPSIIDRSPLMVAVSSGGTSPVLARLLREKLESLLPQHLGQVARYA
CYSG_SALTI       FCNVVDAPKAASFIMPSIIDRSPLMVAVSSGGTSPVLARLLREKLESLLPQHLGQVARYA
CYSG_SALAR       FCNVVDAPKAASFIMPSIIDRSPLMVAVSSGGTSPVLARLLREKLESILPQHLGQVAQYA
CYSG_CITK8       FCNVVDAPKAASFIMPSIIDRSPLMVAVSSGGTSPVLARLLREKLESLLPQHLGQVAHYA
CYSG_ENT38       FCNVVDAPKEASFIMPSIIDRSPLMVAVSSGGTSPVLARLLREKLEAILPQHLGQVARYA
CYSG_ECOLC       FCNVVDAPKAASFIMPSIIDRSPLMVAVSSGGTSPVLARLLREKLESLLPLHLGQVAKYA
CYSG_ECOLI       FCNVVDAPKAASFIMPSIIDRSPLMVAVSSGGTSPVLARLLREKLESLLPLHLGQVAKYA
CYSG_ECO57       FCNVVDAPKAASFIMPSIIDRSPLMVAVSSGGTSPVLARLLREKLESLLPLHLGQVAKYA
CYSG_ECOHS       FCNVVDAPKAASFIMPSIIDRSPLMVAVSSGGTSPVLARLLREKLESLLPLHLGQVAKYA
CYSG_ECOUT       FCNVVDAPKAASFIMPSIIDRSPLMVAVSSGGTSPVLARLLREKLESLLPLHLGQVAKYA
CYSG_ECOK1       FCNVVDAPKAASFIMPSIIDRSPLMVAVSSGGTSPVLARLLREKLESLLPLHLGQVAKYA
CYSG_ECOL5       FCNVVDAPKAASFIMPSIIDRSPLMVAVSSGGTSPVLARLLREKLESLLPLHLGQVAKYA
CYSG_ECOL6       FCNVVDAPKAASFIMPSIIDRSPLMVAVSSGGTSPVLARLLREKLESLLPLHLGQVAKYA
CYSG_SHIDS       FCNVVDAPKAASFIMPSIIDRSPLMVAVSSGGTSPVLARLLREKLESLLPLHLGQVAKYA
CYSG_SHIFL       FCNVVDAPKAASFIMPSIIDRSPLMVAVSSGGTSPVLARLLREKLESLLPLHLGQVAKYA
CYSG_SHIF8       FCNVVDAPKAASFIMPSIIDRSPLMVAVSSGGTSPVLARLLREKLESLLPLHLGQVAKYA
CYSG_SHISS       FCNVVDAPKAASFIMPSIIDRSPLMVAVSSGGTSPVLARLLREKLESLLPLHLGQVAKYA
CYSG_SHIBS       FCNVVDAPKAASFIMPSIIDRSPLMVAVSSGGTSPVLARLLREKLESLLPLHLGQVAKYA
CYSG_ECO24       FCNVVDAPKAASFIMPSIIDRSPLMVAVSSGGTSPVLARLLREKLESLLPLHLGQVAKYA
CYSG2_KLEP7      FCNVVDAPRQASFIMPSIIDRSPLMVAVSSGGTSPVLARLLREKLESILPLHLGQLARYA
CYSG2_CROS8      FCNVVDAPKQASFIMPSIIDRSPLMVAISSGGTSPVLARLLREKLEALLPQHLGKVAGYA
CYSG_YERPE       FCNVVDDPKRTSFIMPSIIDRSPIMIAVSSGGKAPVLARLLREKLEALLPQHLGQLA---
CYSG_YERPA       FCNVVDDPKRTSFIMPSIIDRSPIMIAVSSGGKAPVLARLLREKLEALLPQHLGQLA---
CYSG2_YERPN      FCNVVDDPKRTSFIMPSIIDRSPIMIAVSSGGKAPVLARLLREKLEALLPQHLGQLA---
CYSG1_YERPP      FCNVVDDPKRTSFIMPSIIDRSPIMIAVSSGGKAPVLARLLREKLEALLPQHLGQLAQLA
CYSG2_YERPS      FCNVVDDPKRTSFIMPSIIDRSPIMIAVSSGGKAPVLARLLREKLEALLPQHLGQLAQLA
CYSG2_YERP3      FCNVVDDPKRTSFIMPSIIDRSPIMIAVSSGGKAPVLARLLREKLEALLPQHLGQLAQLA
CYSG2_YERE8      FCNVVDDPKRTSFIMPSIIDRSPIMIAISSGGKAPVLARLLREKLEAMLPQHLGQLAQLA
CYSG2_SERP5      FCNVVDDPKRASFIMPSIIDRSPIMVAVSSGGKAPVLARLLREKLEAVLPQHLGKLAQLG
CYSG2_PECAS      FCNVVDSPERASFIMPSIIDRSPLMVAVSSGGTAPVLARLLREKLESILPQNLGKLAAFA
CYSG1_AERHH      FCNVVDSPAHCSAIMPAIIDRSPLMVAISSAGSAPLLSRQLREKIEALLPQHLGQLATLA
CYSG3_AERHH      FANVVDDPKRSSFIMPSIIDRSPLMVAISSGGKAPVLARLLREKLEALLPQHLGAVAAFA
CYSG1_AERS4      FANVVDDPKRSSFIMPSIIDRSPLMVAISSGGKAPVLARLLREKLEALLPQHLGAVAAFA
CYSG_PSYIN       LVNVVGQADISSFILPSIVDRSPLVVAISSGGKAPVLARLIRERLETLLPMHLGRLAAIS
CYSG_PSET1       FVNVVDDQPKCTFIFPSIVDRNPITIAISSAGTAPVLARRLREKLETLIPQHIGPLATLV
CYSG_BORBR       FCNVVDDAELSSFQVPSVVDRSPLIVAISSSGVAPVLARRLRERIESLFDHSLGQLAALA
CYSG_BORPA       FCNVVDDAELSSFQVPSVVDRSPLIVAISSSGVAPVLARRLRERIESLFDHSLGQLAALA
CYSG_BORPE       FCNVVDDAELSSFQVPSVVDRSPLIVAISSSGVAPVLARRLRERIESLFDHSLGQLAALA
CYSG_BORA1       FCNVVDDPALSSFQVPSIVDRSPLIVAISSSGLAPVLARRLRERLESLFDHSLGALAELA
CYSG_XYLFA       FVNVVDDIALSNVQVPAVVERGPLRIAISSGGGAPMVARYLRQQLESLIDDSWGRLTTLF
CYSG_XYLFT       FVNVVDDIALSNVQVPAVVERGPLRIAISSGGGAPMVARYLRQQLESLIDDSWGRLTTLF
                                *  : *  : :.::: *  *:: *     :*  .    . :    

CYSG_ACIAD       GQWRSRVKAQITNPDERRIFWEELYASPLKEQVFND--NLDIANQMMTQSLAEWTAP---
CYSG_ALCBS       ARFRQPLKDKLSNIGARRLFWEQTLDSPVVEKVLAG--KDSEAEAMLAAAIESADATTL-
CYSG_HAHCH       MEFRDKVRSRFGHINQRRRFWESVLEGVVSDLVFCG--RTDKARAMLDDMLSGEQADAIK
CYSG_PSEAE       SRFRHRVKELLPDLQQRRVFWENLFQGEIAERVLAG--RPAEAERLLEEHLAGGLAHIA-
CYSG_PSEAB       SRFRHRVKELLPDLQQRRVFWENLFQGEIAERVLAG--RPAEAERLLEERLAGGLAHIA-
CYSG_PSEA7       SRFRNRVKELLPDLQQRRVFWENLFQGEIAERVLAG--RPAEAERLLEERLAGGLAHMA-
CYSG_PSEMY       KRFRDRVKQLFPDVQQRRVFWEDVFQGQIAESVFAG--KPEEGERLLEERLAGA-APRA-
CYSG_PSEP1       ARFRHKVKSLYPDVNQRRGFWETVFQGPIAERQLAG--QGAEAERLLQAMVDGA-PVQQ-
CYSG_PSEPK       ARFRHKVKSLYPDVNQRRGFWETVFQGPIAERQLAG--QGAEAERLLQAMVDGA-PVQQ-
CYSG_PSEE4       ARFRDKVKALYPDVNQRRGFWENVFQGPIAERQLAG--QGAEAERLLQAMVDGA-PVQQ-
CYSG_PSEF5       ARFRAQVKGLFPDVQQRRAFWEDVFQGPIADRQLAG--QGAEAERLLQAKIAGK-APHA-
CYSG_PSEPF       ARFRDQVKGLFPDVQQRRGFWEDVFQGPIADRQLAG--QGAEAERLLQAKIDGE-AMVT-
CYSG_PSE14       ARFRNQVKGLFPNVQQRRAFWEDVFQGAIADRQLAG--QGAEAERLLIAKIAGE-PPPE-
CYSG_PSEU2       ARFRNQVKGLFPNVQQRRAFWEEVFQGAIADRQLAG--QGAEAERMLIAKIAGE-PPPE-
CYSG_PSESM       ARFRNQVKGLLPNVQQRRAFWEEVFQGAIADRQLAG--QGAEAERLLIAKIAGE-PPAQ-
CYSG_PSEU5       KQFRAQVKARFANVQQRRVFWEEVFQGPIAEQALAG--RTAEAERLLAEKLAGV-APKA-
CYSG_SACD2       SKFRQRAKDVFENGDLRRRFWENILNGPIAEKVLGG--NLAAAEQLIEAQLDSA-SVEK-
CYSG_GLUDA       QAERAHVVAACPDIGRRRRVWEDFLDGPGGEAAQRG--EHAAARQVLDHLLAGAQT----
CYSG_GLUOX       QSRRAFVSGRYPNVQDRKRIWEDFLDGPGAEAARSG--DESRADARLEVLLDGERK----
CYSG1_HALHL      GRMREQVRVALPDKDWRLRFWEQIFDGAAAESVLAG--REAEGEAELLRLLEQEQARPAP
CYSG2_HALHL      GRLRERVAAVLPTGRQRLRFWEQVFDGPAAESMLAG--REREAEQAMLELLRREQARRDE
CYSG_ALKEH       ERYRRPVREVLPEAWQRQRFWEEVLSGEVAERVFAG--QDDAAREGLEEAIGRATRELQT
CYSG_CHRVO       SSFRDAVKARFPDVDARRRFWETVLEGPLADAVMNG--DEAAARAEMEKRIAAGGA---D
CYSG_METFK       AEFREAVKQRFSTGQQRRIFWEDVFQGVIGEQVLSG--QEEAARHAMQQVLSGRGE---L
CYSG_METCA       ADLRERVRQAIPEPRARRHFWERTLEGPAAELALQG--RAEDAERVLLEAADAAARQERP
CYSG_NITOC       ARYRSRIKQRITGIRARRIFWEKVLQGSIAERIFAG--QEEEAEGALEAALEGGFVPEQ-
CYSG_NITEU       ARFRDKVRQRFIHQENRRFFWERMLQGPFAEMVFAG--RDQAAQDYLSEALENSTD--QF
CYSG_NITEC       AQFRGQVRQHFSRQENRRFFWEKMLQGPFAEMVFAG--KDQAAQDYLLETLNNSVD--QP
CYSG_NITMU       GEFRDRVKHRFSQPAQRRRFWERVLQGPFAEMVFAG--KDQAAKAWLERELENETE--EP
CYSG_THIDA       SRYKARVREAIQ-PGQRRAFWEKVFLSSVAEMVFSG--RDSEAEAQLEAMIKDSAAH-EP
CYSG_RUTMC       GNFRDKVKEKFSNIEDRRYFWEKTFSGIIAEKVFSG--KIQEAKADLQVQLD-GSTKTQ-
CYSG_VESOH       GNFRDQVKAKFSRIEDKRYFWEEIFSGIIAEKVFSG--KIQEAKADLQAQLN-NTVEAQ-
CYSG_PSEA6       EKFRETVKARFNSVTKRRYFWEDILDGDVAEQVLQG--NNSKAEQMMQDKLALDEHDSG-
CYSG_PSYA2       GEFRGDVKAKIPTLTGRRQFWERAFEGKVSQLMFAG--NENEALAQLQADLDNTAASITA
CYSG_PSYCK       GEFRGDVKAKIPTLTGRRQFWEQVFEGKVSQLMFSG--NENEAIAQLQADLDNTAANITA
CYSG_PSYWF       GDMRDEVKSKIPTLTGRRQFWEKAFEGKVSELMFAG--RSVEAEQALKQQLEQTHQQLSS
CYSG_HYDCU       GRYRQTVKNVISDIDGRKTFWETLLSGLFIDKAVHG--NTGEAEALLEAELETIKNNGQS
CYSG_ACTSZ       GKWRHKVKTKLKTVTERRRFWESLF-NGRFSQLLKN-RQTEAAKKELELQLDK-------
CYSG_MANSM       GKWRHKVKQQLKTITERRRFWESLF-NGRFSRLLKN-RQIEAAKKELELQLTK-------
CYSG_NEIMA       GRWRDAVKGKLKSVTERRRFWEKQF-NGRFAALVKN-RQNTLAERELAGQLEQSR-----
CYSG_NEIMF       GRWRDAVKGKLKSVTERRRFWEKQF-NGRFAALVKN-RQNTLAERELAKQLEQ-------
CYSG_NEIMB       GRWRDAVKGKLKSVTERRRFWEKQF-NGRFAALVKN-RQNTLAERELAGQLEQSR-----
CYSG_NEIM0       GRWRDAVKAKLKSVTERRRFWEKQF-NGRFAALVKN-QQTAQAEQELAKQLEQ-------
CYSG_PHOPR       GNFRARLAKTVTSFSARRQFWEQVF-DGRFSDLVAC-GQEQDAKQELINLTQS-------
CYSG2_AERHH      GRVRDQAKRVLSSISDRRRFWERAFASNTLAGLIEK-EDWQGAEQWLNDGLDQA------
CYSG2_AERS4      GRVRDKAKQVLSSISDRRRFWERAFASNTLAGLIEK-QDWQSAETWLNDGLDKA------
CYSG_BAUCH       GTWRNRIKQHIHNIAWRRRFWETIL-NGRFAHLISQ-GKWEHAEKEIESQLY-------H
CYSG_SODGM       GAWRGRVKQRIRSMAGRRRFWEKAL-NGRFASLMAQ-GRLEQAEQALEQALN-------A
CYSG1_CROS8      GGFRDRIKARIPTTDGRRRFWEKAF-RGRFASLMAA-GDTRAAEAVLEAELD-------A
CYSG1_KLEP7      SYWRNHLKTRLTTTEARRRFWERVF-TGRFASLMVA-GNSAEAEKALQDELD-------K
CYSG1_YERPN      GRWRGRVKQHMASMGERRRFWEHAF-SGRFASLISR-GQLTEAENELQLSLE-------G
CYSG2_YERPP      GRWRGRVKQHMASMGERRRFWEHAF-SGRFASLISR-GQLTEAENELQLSLE-------G
CYSG1_YERPS      GRWRGRVKQHMASMGERRRFWEHAF-SGRFASLISR-GQLTEAENELQLSLE-------G
CYSG1_YERP3      GRWRGRVKQHMASMGERRRFWEHAF-SGRFASLISR-GQLTEAENELQLSLE-------G
CYSG1_YERE8      GRWRGRVKQHIASMGERRRFWENAF-SGRFASLISR-GQLAQAEEELQLSLE-------G
CYSG1_SERP5      GRWRGQVKQRLNAIGERRRFWEKTF-GGRFATLVAN-GQTAEAQRQLEQDLEQFA---QG
CYSG1_PECAS      GSWRDRIKTRLHSMPARRRFWERLF-VGRFASLVSA-GQLEQAEGELQQQLVNQQDEQQL
CYSG_PHOLL       GKWRERVKQRLTSMRQRRSFWEQAF-NGRFAMLVAN-GQIQQAEKQLEQQLE--------
CYSG_ZYMMO       GKWRPRIKEKLPAIKDRRLFWEKAF-NGLFAHKVAS-GDWESAEKTLAEQLE-------K
CYSG_BLOFL       GIWRNKIKQHITDIVYRRFFWEKLF-YNGQISLLVEKGNFRKANRVIKDAVLNQL---HN
CYSG_BLOPB       GAWRNKVKQHIVDTVLRRQFWEKIF-YNGHVVTLMEKGRPKEANKVLNYALNNSV---KN
CYSG_BUCAI       GKWRLAIKKHFSNFLERRKFWEKLF-HSIFVEHILN-GNKEQAINVLKKNMNQNI---SL
CYSG_SALCH       GQLRARVKKQFATMGERRRFWEKFFVNDRLAQSLAN-ADEKAVNATTERLFSEPL-----
CYSG_SALPB       GQLRARVKKQFATMGERRRFWEKFFVNDRLAQSLAN-ADEKAVNATTERLFSEPL-----
CYSG_SALPA       GQLRARVKKQFATMGERRRFWEKFFVNDRLAQSLAN-ADEKAVNATTERLFSEPL-----
CYSG_SALTY       GQLRARVKKQFATMGERRRFWEKFFVNDRLAQSLAN-ADEKAVNATTERLFSEPL-----
CYSG_SALTI       GQLRARVKKQFATMGERRRFWEKFFVNDRLAQSLAN-ADEKAVNATTEHLFSEPL-----
CYSG_SALAR       GQLRARVKKQFITMGERRRFWEKFFVNDRLAQSLAN-ADEKAVNATTEQLFSEPL-----
CYSG_CITK8       GQLRARVKKQFATMGERRRFWEKLFINDRLAQSLAN-ADAKAVSEITEQMLSEPL-----
CYSG_ENT38       GQLRARVKTTFATIGERRRFWEKFFVNDRLAQSLAN-QDQQAVEETTERLLTEPL-----
CYSG_ECOLC       GQLRGRVKQQFATMGERRRFWEKLFVNDRLAQSLAN-NDQKAITETTEQLINEPL-----
CYSG_ECOLI       GQLRGRVKQQFATMGERRRFWEKLFVNDRLAQSLAN-NDQKAITETTEQLINEPL-----
CYSG_ECO57       GQLRGRVKQQFATMGERRRFWEKLFVNDRLAQSLAN-NDQKAITETTEQLINEPL-----
CYSG_ECOHS       GQLRGRVKQQFATMGERRRFWEKLFVNDRLAQSLAN-NDQKAITETTEQLINEPL-----
CYSG_ECOUT       GQLRGRVKQQFATMGERRRFWEKLFVNDRLAQSLAN-NDQKAITETTEQLINEPL-----
CYSG_ECOK1       GQLRGRVKQQFATMGERRRFWEKLFVNDRLAQSLAN-NDQKAITETTEQLINEPL-----
CYSG_ECOL5       GQLRGRVKQQFATMGERRRFWEKLFVNDRLAQSLAN-NDQKAITETTEQLINEPL-----
CYSG_ECOL6       GQLRGRVKQQFATMGERRRFWEKLFVNDRLAQSLAN-NDQKAITETTEQLINEPL-----
CYSG_SHIDS       GQLRGRVKQQFATMGERRRFWEKLFVNDRLAQSLAN-NDQKAITETTEQLINEPL-----
CYSG_SHIFL       GQLRGRVKQQFATMSERRRFWEKLFVNDRLAQSLAN-NDQKAITETTEQLINEPL-----
CYSG_SHIF8       GQLRGRVKQQFATMSERRRFWEKLFVNDRLAQSLAN-NDQKAITETTEQLINEPL-----
CYSG_SHISS       GQLRGRVKQQFATMSERRRFWEKLFVNDRLAQSLAN-NDQKAITETTEQLINEPL-----
CYSG_SHIBS       GQLRGRVKQQFTTMSERRRFWEKLFVNDRLAQSLAN-NDQKAITETTEQLINEPL-----
CYSG_ECO24       GQLRGRVKQQFATMSERRRFWEKLFVNDRLAQSLAN-NDQKAITETTEQLINEPL-----
CYSG2_KLEP7      GHLRARVKQQFATVGERRRFWEKLFVNDRLAQSLAN-DDRQAVADTTEQLLTEPL-----
CYSG2_CROS8      GQLRRRVKQTFTSMSERRRFWEKFFVNDRLAQSLAN-DDEQAVTRITETLLSEPL-----
CYSG_YERPE       GNLRQRVKQHFTVMTERRRFWEKLLTHDRLAQSLAN-NDHVQADQHVEQLFSAPL-----
CYSG_YERPA       GNLRQRVKQHFTVMTERRRFWEKLLTHDRLAQSLAN-NDHVQADQHVEQLFSAPL-----
CYSG2_YERPN      GNLRQRVKQHFTVMTERRRFWEKLLTHDRLAQSLAN-NDHVQADQHVEQLFSAPL-----
CYSG1_YERPP      GNLRQRVKQHFTVMTERRRFWEKLLTHDRLAQSLAN-NDHVQADQHVEQLFSAPL-----
CYSG2_YERPS      GNLRQRVKQHFAAMTERRRFWEKLLTHDRLAQSLAN-NDHVQADQHVEQLFSAPL-----
CYSG2_YERP3      GNLRQRVKQHFAAMTERRRFWEKLLTHDRLAQSLAN-NDHVQADQHVEQLFSAPL-----
CYSG2_YERE8      GNLRQRVKQHFAAMTDRRRFWEKLLTHDRLAQSLAN-EDQVQVEQHVEQLFNAPL-----
CYSG2_SERP5      GSLRQRVKKHFSDIGSRRRFWEKLFAHDRLAQSLAN-NDVALAERQIEQLFSHQP-----
CYSG2_PECAS      GELRSRVKIRFCKMSARRRFWEKLFVHDRLAQALAS-EDRERVQQLTELLFSAPL-----
CYSG1_AERHH      GKLRERVKAIPDKL-ARRRFWERLFSHERLACQLAR-GQQQAAEESVAELLNEPQ-----
CYSG3_AERHH      GSLRERVKARFASMGERRRFWERLLGADRLGQALAR-GDSASANQLADSLFADES-----
CYSG1_AERS4      GGLRARVKARFASMGERRQFWERLLSADRLGQALAR-GDKASANQLADTLFAEET-----
CYSG_PSYIN       AQFRHRVKEVIKVAPLRRRYWEKLFGNGMLANLLQK-GQTEKAIALMETSLSEDI-----
CYSG_PSET1       GGFRSKVKQRFKHFADRRQFWEGVFDSSVVSKVQTG--DTQAAEQQLEHMLNAKA-----
CYSG_BORBR       ARYRPRIRAARPDLGQRRRFYDWLL-DGPVAARLRQ-QQPGLAEQELEQALRAPQ-----
CYSG_BORPA       ARYRPRIRAARPDLGQRRRFYDWLL-DGPVAARLRQ-QQPGLAEQELEQALRAPQ-----
CYSG_BORPE       ARYRPRIRAARPDLGQRRRFYDWLL-DGPVAARLRQ-QQPGLAEQELEQALRAPQ-----
CYSG_BORA1       ARYRPAIRAARADLKERRRFYDWLL-DGPVAAALRR-AQPQQAQEALDEALARPA-----
CYSG_XYLFA       AQRRDTIRARYPNIEARRRFFETQL-TGPLQRLLRK-QRHAEAEAVLEAALAETP-----
CYSG_XYLFT       AQRRDTIRARYPNIEARRRFFETQL-AGPLQRLLRK-QRHAEAEAVLEAALAKTP-----
                    :            :   ::                                      

CYSG_ACIAD       -----------------------------KGEVYLVGAGPGDPELLTLKALRLMQQADVV
CYSG_ALCBS       S----------------------------RGEVYLVGAGPGDPDLLTFRALRLLQKADVV
CYSG_HAHCH       D----------------------------TGEVYLVGAGPGDPDLLTFRALRLMRQADVV
CYSG_PSEAE       -----------------------------TGEVYLVGAGPGDPDLLTFRALRLMQQADVV
CYSG_PSEAB       -----------------------------TGEVYLVGAGPGDPDLLTFRALRLMQQADVV
CYSG_PSEA7       -----------------------------TGEVYLVGAGPGDPDLLTFRALRLMQQADVV
CYSG_PSEMY       -----------------------------LGEVYLVGAGPGDPDLLTFRALRLMQQADVV
CYSG_PSEP1       -----------------------------GGEVYLVGAGPGDPDLLTFRALRLMQQADVV
CYSG_PSEPK       -----------------------------GGEVYLVGAGPGDPDLLTFRALRLMQQADVV
CYSG_PSEE4       -----------------------------GGEVYLVGAGPGDPDLLTFRALRLMQQADVV
CYSG_PSEF5       -----------------------------PGEVYLVGAGPGDPDLLTFRALRLMQQADVV
CYSG_PSEPF       -----------------------------TGEVYLVGAGPGDPDLLTFRALRLMQQADVV
CYSG_PSE14       -----------------------------TGEVYLVGAGPGDPDLLTFRALRLMQQADVV
CYSG_PSEU2       -----------------------------TGEVYLVGAGPGDPDLLTFRALRLMQQADVV
CYSG_PSESM       -----------------------------TGEVYLVGAGPGDPDLLTFRALRLMQQADVV
CYSG_PSEU5       -----------------------------LGEVYLVGAGPGDPDLLTFRALRLMQQADVV
CYSG_SACD2       -----------------------------TGEVYLVGAGPGDPDLLTFKALRLMQQAEVV
CYSG_GLUDA       -----------------------------GGEVWLVGAGPGDPDLLTLRALHLMQNADSV
CYSG_GLUOX       -----------------------------SGEVWLVGAGPGDPDLLTLKALHLMQNADSV
CYSG1_HALHL      -----------------------------QGEVFLVGAGPGDPDLLTFRALRLMQRADVV
CYSG2_HALHL      -----------------------------RGEVYLVGAGPGDPDLLTFRALRLMQRADVV
CYSG_ALKEH       R----------------------------RGEVYLVGAGPGDPDLLTLRALRLMQQADAV
CYSG_CHRVO       R----------------------------AGAVYLVGAGPGNPDLLTFRALRLMQQADVV
CYSG_METFK       H----------------------------HGEVYLVGGGPGDPDLLTFRALRLMQQADVC
CYSG_METCA       A----------------------------WGSVALVGAGPGDPDLLTLRALRLIQEADVI
CYSG_NITOC       ------------------------------GEVYLVGAGPGDPDLLTFRALRLMQQADVV
CYSG_NITEU       P----------------------------TGEVYLVGAGPGDPDLLTFRAMRLMQQADVV
CYSG_NITEC       P----------------------------IGEVYLVGAGPGDPDLLTFRAMRLMQQADVV
CYSG_NITMU       V----------------------------KGEVYLVGAGPGDPELLTFRAMRLMQQADVV
CYSG_THIDA       A----------------------------RGEVYLVGAGPGNPDLLTFRALRLMQQADVV
CYSG_RUTMC       -----------------------------VGEVYLVGGGPGDPDLLTFKALRLMQQADVV
CYSG_VESOH       -----------------------------VGAVYLVGGGPGDPDLLTFRALRLMQQADVV
CYSG_PSEA6       -----------------------------KGEVYLVGAGPGDPDLLTFRALRLMQKADVV
CYSG_PSYA2       KDATDDNGLSTASTSAPAIANEFTAARNTMGEVYIVGAGPGDPELLTFKALRLMQQADIV
CYSG_PSYCK       KNATDES----------------TEAQNTMGEVYIVGAGPGDPELLTFKALRLMQQADIV
CYSG_PSYWF       NSDVKQAD------------------PKSVGEVYIVGAGPGDPELLTFKALRLMQQADIV
CYSG_HYDCU       LP---------------------------QGEVYIIGAGPGDPDLMTFKGLRLLQQADVI
CYSG_ACTSZ       --------------------------DYRGGFVSLVGAGPGDAGLLTLKGLQEIQQADVV
CYSG_MANSM       --------------------------DYQGGSVSLVGAGPGDAGLLTLKGLQEIQQADVV
CYSG_NEIMA       Q-------------------------NDQGGSVSLVGAGPGDAGLLTLKGLQEIQQADVV
CYSG_NEIMF       --------------------------NYQGGFVSLVGAGPGDAGLLTLKGLQEIQQADVV
CYSG_NEIMB       Q-------------------------NDQGGSVSLVGAGPGDAGLLTLKGLQEIQQADVV
CYSG_NEIM0       --------------------------NYQGGFVSLVGAGPGDAGLLTLKGLQEIQQADVV
CYSG_PHOPR       --------------------------TSPQGQVALIGSGPGDAGLLTLRALQLMQQADVV
CYSG2_AERHH      --------------------------KNEVGEVVLVGAGPGDPGLLTLKALQQIQQAEVV
CYSG2_AERS4      --------------------------QSEVGEVVLVGAGPGDPGLLTLKALQQIQQAEVV
CYSG_BAUCH       Y-------------------------QSPIGNVALVGAGPGDSGLLTLRGLQLMQQADIV
CYSG_SODGM       G-------------------------PEHGGEVALVGAGPGDSGLLTLRGLQLMQQADVV
CYSG1_CROS8      P-------------------------QGPQGEIILVGAGPGDAGLLTLRGLQVMQQADVV
CYSG1_KLEP7      P-------------------------ERETGEIILVGAGPGDAGLLTLRGLQAIQQADVV
CYSG1_YERPN      Q-------------------------HRALGEVALVGAGPGDAGLLTLRGLQVMQQADVV
CYSG2_YERPP      Q-------------------------HRALGEVALVGAGPGDAGLLTLRGLQVMQQADVV
CYSG1_YERPS      Q-------------------------HRALGEVALVGAGPGDAGLLTLRGLQVMQQADVV
CYSG1_YERP3      Q-------------------------HRALGEVALVGAGPGDAGLLTLRGLQVMQQADVV
CYSG1_YERE8      Q-------------------------NRNQGEVALVGAGPGDPGLLTLRGLQVIQQADVV
CYSG1_SERP5      S-------------------------EGTQGEIALVGAGPGDVGLLTLRGLQVMQQADVV
CYSG1_PECAS      P-------------------------AAARGEVALVGAGPGDAGLLTLRGLQVMQQADVV
CYSG_PHOLL       Q-------------------------SDLQGELALVGAGPGDPGLLTLKGLQVIQQADVV
CYSG_ZYMMO       D-------------------------NPKQGEIILVGAGPGDAGLLTLRGLQALQQADIV
CYSG_BLOFL       R---------------------------KQGSVSLVGAGPGDKGLLTIRGLQVIQTADII
CYSG_BLOPB       K-------------------------NNKTGHVTLVGAGPGDIGLLTIRGLQVIQQADII
CYSG_BUCAI       T-----------------------------GEIILVGAGPGDSGLLTLRGLQVLQQADVV
CYSG_SALCH       ---------------------------DHRGEVVLVGAGPGDAGLLTLKGLQQIQQADIV
CYSG_SALPB       ---------------------------DHRGEVVLVGAGPGDAGLLTLKGLQQIQQADIV
CYSG_SALPA       ---------------------------DHRGEVVLVGAGPGDAGLLTLKGLQQIQQADIV
CYSG_SALTY       ---------------------------DHRGEVVLVGAGPGDAGLLTLKGLQQIQQADIV
CYSG_SALTI       ---------------------------DHRGEVVLVGAGPGDAGLLTLKGLQQIQQADIV
CYSG_SALAR       ---------------------------DHRGEVVLVGAGPGDAGLLTLKGLQQIQQADIV
CYSG_CITK8       ---------------------------DHRGEVVLVGAGPGDAGLLTLKGLQQIQQADVV
CYSG_ENT38       ---------------------------NHRGEVVLVGAGPGDAGLLTLKGLQQIQQADIV
CYSG_ECOLC       ---------------------------DHRGEVVLVGAGPGDAGLLTLKGLQQIQQADVV
CYSG_ECOLI       ---------------------------DHRGEVVLVGAGPGDAGLLTLKGLQQIQQADVV
CYSG_ECO57       ---------------------------DHRGEVVLVGAGPGDAGLLTLKGLQQIQQADVV
CYSG_ECOHS       ---------------------------DHRGEVVLVGAGPGDAGLLTLKGLQQIQQADVV
CYSG_ECOUT       ---------------------------DHRGEVVLVGAGPGDAGLLTLKGLQQIQQADVV
CYSG_ECOK1       ---------------------------DHRGEVVLVGAGPGDAGLLTLKGLQQIQQADVV
CYSG_ECOL5       ---------------------------DHRGEVVLVGAGPGDAGLLTLKGLQQIQQADVV
CYSG_ECOL6       ---------------------------DHRGEVVLVGAGPGDAGLLTLKGLQQIQQADVV
CYSG_SHIDS       ---------------------------DHRGEVVLVGAGPGDAGLLTLKGLQQIQQADVV
CYSG_SHIFL       ---------------------------DHRGEVVLVGAGPGDAGLLTLKGLQQIQQADVV
CYSG_SHIF8       ---------------------------DHRGEVVLVGAGPGDAGLLTLKGLQQIQQADVV
CYSG_SHISS       ---------------------------DHRGEVVLVGAGPGDAGLLTLKGLQQIQQADVV
CYSG_SHIBS       ---------------------------DHRGEVVLVGAGPGDAGLLTLKGLQQIQQADVV
CYSG_ECO24       ---------------------------DHRGEVVLVGAGPGDAGLLTLKGLQQIQQADVV
CYSG2_KLEP7      ---------------------------EHRGEVVLVGAGPGDAGLLTLKGLQQIQQADVV
CYSG2_CROS8      ---------------------------DDRGEVVLVGAGPGDPGLLTLKGLQQIQQADIV
CYSG_YERPE       ---------------------------TDRGEVVLVGAGPGDAGLLTLKGLQQIQQADVV
CYSG_YERPA       ---------------------------TDRGEVVLVGAGPGDAGLLTLKGLQQIQQADVV
CYSG2_YERPN      ---------------------------TDRGEVVLVGAGPGDAGLLTLKGLQQIQQADVV
CYSG1_YERPP      ---------------------------TDRGEVVLVGAGPGDAGLLTLKGLQQIQQADVV
CYSG2_YERPS      ---------------------------TDRGEVVLVGAGPGDAGLLTLKGLQQIQQADVV
CYSG2_YERP3      ---------------------------TDRGEVVLVGAGPGDAGLLTLKGLQQIQQADVV
CYSG2_YERE8      ---------------------------SDRGEVVLVGAGPGDAGLLTLKGLQQIQQADVV
CYSG2_SERP5      ---------------------------QECGEVVLVGAGPGDAGLLTLKGLQQIQQADVV
CYSG2_PECAS      ---------------------------DDRGEVTLVGAGPGDAGLLTLKGLQHLQQADIV
CYSG1_AERHH      ---------------------------QSKGSVTLVGAGPGDAGLLTLNGLQQLQQADVV
CYSG3_AERHH      ---------------------------QSGGEVVLVGAGPGDPGLLTLHALRQMQQADVV
CYSG1_AERS4      ---------------------------GAKGEVILVGAGPGDPGLLTLHALRHMQQADLV
CYSG_PSYIN       ----------------------------TQGDVALVGAGPGDPSLLTLKALQLMQQADVV
CYSG_PSET1       ---------------------------EPEGEVYVVGAGPGDPELLTLKALQLMQQADVV
CYSG_BORBR       --------------------------AAPRGSVVLVGAGPGDPGLLTLKALRALNEADII
CYSG_BORPA       --------------------------AAPRGSVVLVGAGPGDPGLLTLKALRALNEADII
CYSG_BORPE       --------------------------AAPRGSVVLVGAGPGDPGLLTLKALRALNEADII
CYSG_BORA1       --------------------------LSQDGRVVLVGAGPGDPGLLTLKGLRALNEADVI
CYSG_XYLFA       --------------------------PTGSGSVTLVGAGAGDAGLLTLNALRALNEADII
CYSG_XYLFT       --------------------------PTESGSVTLVGAGAGDAGLLTLNALRALNEADII
                                               * : ::*.*.*:  *:*:..:: :. *:  

CYSG_ACIAD       IYDRLVSAPILELCRRDAEKVYVGKA-RSNHSVPQEGINALLVKYAQAGKRVCRLKGGDP
CYSG_ALCBS       LYDRLVGKGIVDLARRDAELVYVGKA-RDKHALPQDNINELLVHYAKQGKKVCRLKGGDP
CYSG_HAHCH       LYDRLVSPQILDLVRRDAKRINVGKA-RSNHTLPQQEINAMLVELAKEGKRVLRLKGGDP
CYSG_PSEAE       LYDRLVAPSILELCRRDAERLYVGKR-RAEHAVPQDRINRLLVELASQGKRVLRLKGGDP
CYSG_PSEAB       LYDRLVAPSILELCRRDAERLYVGKR-RAEHAVPQDRINRLLVELASQGKRVLRLKGGDP
CYSG_PSEA7       LYDRLVAPAILELCRRDAERLYVGKR-RAEHAVPQERINRLLVELASQGKRVLRLKGGDP
CYSG_PSEMY       LYDRLVAPAIIELCRRDAERIYVGKR-RADHAVPQEQINQLLIDLARQGKRVLRLKGGDP
CYSG_PSEP1       LYDRLVAPAIIDMCRRDAERIYVGKR-RADHSVPQDQINRLLVDLARQGKRVLRLKGGDP
CYSG_PSEPK       LYDRLVAPAIIDMCRRDAERIYVGKR-RADHSVPQDQINRLLVDLARQGKRVLRLKGGDP
CYSG_PSEE4       LYDRLVAPAIIEMCRRDAERIYVGKR-RADHAVPQDQINRLLVDLARQGKRVLRLKGGDP
CYSG_PSEF5       LYDRLVAPAILELCRRDAERIYVGKR-RADHAVPQEQINQQLVTLAQQGKRVVRLKGGDP
CYSG_PSEPF       LYDRLVAPAILELCRRDAERVYVGKR-RADHAVPQDQINQQLVDLAKAGKRVVRLKGGDP
CYSG_PSE14       LYDRLVAPTILDLCRRDAERVYVGKR-RAEHAVPQEQINQQLVALAKQGKRVVRLKGGDP
CYSG_PSEU2       LYDRLVAPTILDLCRRDAERVYVGKR-RAEHAVPQEQINQQLVALAKQGKRVVRLKGGDP
CYSG_PSESM       LYDRLVAPTILDLCRRDAERVYVGKR-RAEHAVPQEQINQQLVALAKQGKRVVRLKGGDP
CYSG_PSEU5       LYDRLVAPAIIDLCRRDADRIYVGKQ-RADHAVPQEQINQQLVTLAKQGKRVLRLKGGDP
CYSG_SACD2       LYDRLVSEPILEMTRRDAERIYVGKK-RAEHAVPQQKINQMLLELAQQGKRVLRLKGGDP
CYSG_GLUDA       LYDQLLPPALMDRVRRDAERVFVGKQ-RDRHTMPQDDINAELIRRARAGERVLRLKGGDP
CYSG_GLUOX       LYDNLVSPALLDMVRRDAELVFVGKQ-RDRHALPQDEINREMVRRAQGGERVLRLKGGDP
CYSG1_HALHL      LYDRLAAPALLDLVRKEAERIPVGKR-RGRHTLPQERINERLVELARAGKRVLRLKGGDP
CYSG2_HALHL      LYDHLAAPGLLRLVRKDAERIPVGKR-RGQHTLPQEAINDKLIELAAAGKRVLRLKGGDP
CYSG_ALKEH       VYDRLVNPAIMAKVNQDAERIDVGKR-CGHHPVPQHAINDKLVTLARQGYRVLRLKGGDP
CYSG_CHRVO       LYDKLVAPELLELVRRDAERVYVGKA-RANHALPQDDINQLLVDLARQGKRVLRLKGGDP
CYSG_METFK       VYDKLVSKEVMALVRRDAELIYVGKS-RDQHTLPQEDINQLLVRLAKEGKRVLRLKGGDP
CYSG_METCA       VYDRLVSAEILALARRDARRIYAGKE-RSRHSIPQDDINALLANLAAEGNRVVRLKGGDP
CYSG_NITOC       FHDRLVSPEVLALVRREAERIYVGKK-RSWHAVRQEEINMMLVRSAREGKRVLRLKGGDP
CYSG_NITEU       IYDRLVSPAILDMVRQDATRIYVGKV-RNQHTLPQTSINELLVKLAQEGKHVLRLKGGDP
CYSG_NITEC       IYDRLVAPAILDMVRQDADRIYAGKE-RNRHTLPQTSINNLLIKLAQEGKRVLRLKGGDP
CYSG_NITMU       VYDRLVSPEILDMLRRDTPRIYAGKE-RNRHTMPQESINDLLVRLAKEGKRVLRLKGGDP
CYSG_THIDA       VYDRLVSQPILDMCRRDAERIYVGKE-RDDHAVPQEEINMMLVRLAKEGKRTLRLKGGDP
CYSG_RUTMC       LYDRLVSNGVMGLVRRDAQLIYVGKE-RDNHVVPQGDINQLLVNLAKQGRRVCRLKGGDP
CYSG_VESOH       LYDRLVSDRVMELVRRDAQLIYVGKE-CDNHAVPQGDINQLLVDLAKEGRRVCRLKGGDP
CYSG_PSEA6       VYDRLVSKEILELVRRDAEKIYVGKA-RSLHTVPQDEINALLADLALKGNRVVRLKGGDP
CYSG_PSYA2       YYDALVSPQVLDLCRRDADKVFVGKK-RRNHAVAQLGINELLVNSAKEGRRVVRLKGGDP
CYSG_PSYCK       YYDALVSPQVLDLCRRDADKVFVGKK-RSNHAVAQLGINELLVNSAKEGRRVVRLKGGDP
CYSG_PSYWF       YYDALVSREVLDLCRRDADKVFVGKK-RSNHAVAQQGINQLMIDAASSGKRVVRLKGGDP
CYSG_HYDCU       LYDRLVAPEILEMGRREAERIYVGKK-EKWHKMDQKDINQMLVDLARQGKRVARLKGGDP
CYSG_ACTSZ       LYDALVSDEILELVRRDAKLVFVGKR-AQGKQVAQENTNALLVKYAQQGKRVVRLKGGDP
CYSG_MANSM       LYDALVSAEILDLVRRDAELIFVGKR-AQGRQVAQQETNQLLADLALQGKRVVRLKGGDP
CYSG_NEIMA       LYDALVSDGILSLVRRDAERIFVGKR-ARGGRTPQEDTNALMVRLAREGRRVVRLKGGDP
CYSG_NEIMF       LYDALVSDGILSLVRRDAERIFVGKR-ARGGRTPQEDTNALMVRLAREGRRVVRLKGGDP
CYSG_NEIMB       LYDALVSDGILSLVRRDAERIFVGKR-ARGERTPQEDTNALMVRLAREGRRVVRLKGGDP
CYSG_NEIM0       LYDALVSDGILSLVRRDAERIFVGKR-ARGDRTPQEDTNALMVRLAREGRRVVRLKGGDP
CYSG_PHOPR       LYDYLVSDEVMDLVRRDAELVCVGKK-AGFHSVPQEETNQLIVKYAQQGKRVVRLKGGDP
CYSG2_AERHH      LYDQLVSPEILDLVRRDATLVSVGKK-AGAHSVPQEETNRLLVEYAKAGNRVVRLKGGDP
CYSG2_AERS4      LYDQLVSPEILDLVRRDATLVSVGKK-AGAHSVPQEETNRLLVEYARAGNRVVRLKGGDP
CYSG_BAUCH       LYDYLVSPEILDLVRRDADRIYVGKQ-AGKHSMPQAEINSLLVKLALQGKNVVRLKGGDP
CYSG_SODGM       LYDYLVSPEVLELVRRDAERICAGKR-VGEHSMPQQEINRLLVTLAQQGKKVVRLKGGDP
CYSG1_CROS8      LYDHLVSDGVLDLVRRDADRICVGKR-AGAHAVAQHETNQMLIDFAREGKTVVRLKGGDP
CYSG1_KLEP7      FHDHLVTQPVLELVRRDAELICVGKR-AGEHSVPQHETNQLLVEAAKAGKTVVRLKGGDP
CYSG1_YERPN      LYDHLVSPEVLDLVRRDAERICVGKR-AGAHSVTQEATNQLLVTLAQQGKRVVRLKGGDP
CYSG2_YERPP      LYDHLVSPEVLDLVRRDAERICVGKR-AGAHSVTQEATNQLLVTLAQQGKRVVRLKGGDP
CYSG1_YERPS      LYDHLVSPEVLDLVRRDAERICVGKR-AGAHSVTQEATNQLLVTLAQQGKRVVRLKGGDP
CYSG1_YERP3      LYDHLVSPEVLDLVRRDAERICVGKR-AGAHSVTQEATNQLLVTLAQQGKRVVRLKGGDP
CYSG1_YERE8      LYDHLVSPEVLDLVRRDAQRICVGKR-AGAHSVAQEETNQLLVTLAQRGKRVVRLKGGDP
CYSG1_SERP5      LYDHLVSDEILDLVRRDAERICVGKR-AGAHSVIQEETNRLLVELAQQGKRVVRLKGGDP
CYSG1_PECAS      LYDHLVSADVLDLVRRDAERICVGKR-ASTHSLPQGEINQLLVKLAQEGKRVVRLKGGDP
CYSG_PHOLL       LYDHLVSSDVLDLIRRDADKICVGKR-AGNHSVSQEETNRLIVKFARQGKKVVRLKGGDP
CYSG_ZYMMO       LYDYLVSPAVLEMIRRDAQKICVGKR-AGHHSVAQEETNRRLIEWAQQGKKVVRLKGGDP
CYSG_BLOFL       LYDYLVNPDILDLSRKDANKICVGKI-AKKHSISQNNLNHFMIQLAQQGNNVVRLKGGDS
CYSG_BLOPB       LYDYLVNSDILDLARRDADKICVGKH-VGNHSISQKKLNQFIVQLAQKGNKVVRLKGGDP
CYSG_BUCAI       LYDYLVSEDILDLIRRDAKRICVGKR-VGLKNITQNEIIKLLIFFAQKGKKVVRLKGGDP
CYSG_SALCH       VYDRLVSDDIMNLVRRDADRVFVGKR-AGYHCVPQEEINQILLREAQKGKRVVRLKGGDP
CYSG_SALPB       VYDRLVSDDIMNLVRRDADRVFVGKR-AGYHCVPQEEINQILLREAQKGKRVVRLKGGDP
CYSG_SALPA       VYDRLVSDDIMNLVRRDADRVFVGKR-AGYHCVPQEEINQILLREAQKGKRVVRLKGGDP
CYSG_SALTY       VYDRLVSDDIMNLVRRDADRVFVGKR-AGYHCVPQEEINQILLREAQKGKRVVRLKGGDP
CYSG_SALTI       VYDRLVSDDIMNLVRRDADRVFVGKR-AGYHCVPQEEINQILLREAQKGKRVVRLKGGDP
CYSG_SALAR       VYDRLVSDDIMNLVRRDADRVFVGKR-AGYHCVPQEEINQILLREAQKGKRVVRLKGGDP
CYSG_CITK8       VYDRLVSDDIMNLVRRDADRVFVGKR-AGYHCVPQEEINQILLREAQKGRRVVRLKGGDP
CYSG_ENT38       VYDRLVSDDIMNLVRRDADRVFVGKR-AGYHCVPQEEINQILLREALKGKRVVRLKGGDP
CYSG_ECOLC       VYDRLVSDDIMNLVRRDADRVFVGKR-AGYHCVPQEEINQILLREAQKGKRVVRLKGGDP
CYSG_ECOLI       VYDRLVSDDIMNLVRRDADRVFVGKR-AGYHCVPQEEINQILLREAQKGKRVVRLKGGDP
CYSG_ECO57       VYDRLVSDDIMNLVRRDADRVFVGKR-AGYHCVPQEEINQILLREAQKGKRVVRLKGGDP
CYSG_ECOHS       VYDRLVSDDIMNLVRRDADRVFVGKR-AGYHCVPQEEINQILLREAQKGKRVVRLKGGDP
CYSG_ECOUT       VYDRLVSDDIMNLIRRDADRVFVGKR-AGYHCVPQEEINQILLREAQKGKRVVRLKGGDP
CYSG_ECOK1       VYDRLVSDDIMNLIRRDADRVFVGKR-AGYHCVPQEEINQILLREAQKGKRVVRLKGGDP
CYSG_ECOL5       VYDRLVSDDIMNLVRRDADRVFVGKR-AGYHCVPQEEINQILLREAQKGKRVVRLKGGDP
CYSG_ECOL6       VYDRLVSDDIMNLVRRDADRVFVGKR-AGYHCVPQEEINQILLREAQKGKRVVRLKGGDP
CYSG_SHIDS       VYDRLVSDDIMNLVRRDADRVFVGKR-AGYHCVPQEEINQILLREAQKGKRVVRLKGGDP
CYSG_SHIFL       VYDRLVSDDIMNLVRRDADRVFVGKR-AGYHCVPQEEINQILLREAQKGKRVVRLKGGDP
CYSG_SHIF8       VYDRLVSDDIMNLVRRDADRVFVGKR-AGYHCVPQEEINQILLREAQKGKRVVRLKGGDP
CYSG_SHISS       VYDRLVSDDIMNLVRRDADRVFVGKR-AGYHCVPQEEINQILLREAQKGKRVVRLKGGDP
CYSG_SHIBS       VYDRLVSDDIMNLVRRDADRVFVGKR-AGYHCVPQEEINQILLREAQKGKRVVRLKGGDP
CYSG_ECO24       VYDRLVSDDIMNLVRRDADRVFVGKR-AGYHCVPQEEINQILLREAQKGKRVVRLKGGDP
CYSG2_KLEP7      VYDRLVSDDIMNLVRRDADRVFVGKR-SGYHCVPQEEINQILLREAQKGRRVVRLKGGDP
CYSG2_CROS8      VYDRLVSDEIMNLVRRDADRVFVGKR-AGYHCVPQEEINQILLREAQRGKRVVRLKGGDP
CYSG_YERPE       VYDRLVSDEVMNLVRRDAERIFVGKQ-SGHHCVPQEQINQILLQQAQSGKRVVRLKGGDP
CYSG_YERPA       VYDRLVSDEVMNLVRRDAERIFVGKQ-SGHHCVPQEQINQILLQQAQSGKRVVRLKGGDP
CYSG2_YERPN      VYDRLVSDEVMNLVRRDAERIFVGKQ-SGHHCVPQEQINQILLQQAQSGKRVVRLKGGDP
CYSG1_YERPP      VYDRLVSDEVMNLVRRDAERIFVGKQ-SGHHCVPQEQINQILLQQAQSGKRVVRLKGGDP
CYSG2_YERPS      VYDRLVSDEVMNLVRRDAERIFVGKQ-SGHHCVPQEQINQILLQQAQSGKRVVRLKGGDP
CYSG2_YERP3      VYDRLVSDEVMNLVRRDAERIFVGKQ-SGHHCVPQEQINQILLQQAQSGKRVVRLKGGDP
CYSG2_YERE8      VYDRLVSDEVMNLVRRDAERIFVGKE-SGRHTVPQDQINQILLQQAQQGKRVVRLKGGDP
CYSG2_SERP5      VYDRLVSDEIMTLVRRDAERIFVGKR-AGHHCVPQEQINQILLQQAQLGKRVVRLKGGDP
CYSG2_PECAS      VYDRLVSKEILNLSRRDAERIFVGKA-SGYHSVPQDQINQLLEEKARAGHRVVRLKGGDP
CYSG1_AERHH      VYDRLVSQEVLAHVRRDAERIFVGKE-AGCHCVPQQAINQLLLEQARLGKQVVRLKGGDP
CYSG3_AERHH      VYDRLVSDEVMALVRRDARRIFVGKQ-AGNHCVPQEGINQLLLDEAKKGQRVVRLKGGDP
CYSG1_AERS4      VYDQLVSDEVMALVRRDARRIFVGKQ-AGNHCVPQEGINQLLLEEASKGQRVVRLKGGDP
CYSG_PSYIN       LYDRLVSSDILDLVRRDADLISVGKA-AGNHEVEQSRTNQMLVEFAREGKKVVRLKGGDS
CYSG_PSET1       VYDYLVSDEIMELVRRDADLICVGKR-LGDHSVAQQDTNQMLVDLAKQGKKVCRIKGGDP
CYSG_BORBR       LYDRLVSEGVLALARRDAERVPVGKLPGEDHDATQARIHALMLAQARAGRRVVRLKGGDA
CYSG_BORPA       LYDRLVSEGVLALARRDAERVPVGKLPGEDHDATQARIHALMLAQARAGRRVVRLKGGDA
CYSG_BORPE       LYDRLVSEGVLALARRDAERVPVGKLPGKGHDATQARIHALMLAQARAGRRVVRLKGGDA
CYSG_BORA1       LHDRLVSAEVLALARRDAERITVGKRLGENHNATQARIHELMVEHARAGRRVVRLKGGDA
CYSG_XYLFA       LYDRLVSDTVLQVARRDAEQIEVGKS-ATGHSVRQEDIHSLMLQHARAGQRVVRLKGGDP
CYSG_XYLFT       LYDRLVSDTVLQMARRDAEQIEVGKS-ATGHSVRQEDIHTLMLQHARAGQRVVRLKGGDP
                  :* *    ::   .:::  : .**         *      :   *  *  . *:****.

CYSG_ACIAD       FIFGRGGEEIQELFAAGIPFQVVPGITAASGCSAYAGIPLTHRDYAQSVRFLTGHLKEGS
CYSG_ALCBS       FIFGRGGEEIDLIVAEGIDFQVVPGITAASGCASYAGIPLTHRDHAQSVRFVTGHRKDGS
CYSG_HAHCH       FIFGRGGEEIDQLADAGVPFQVVPGITAASGCAAYSGIPLTHRDHSQSVRFVTGHLKSDT
CYSG_PSEAE       FIFGRGGEEIDELAAHGIPFQVVPGITAASGCAAYAGIPLTHRDHAQSVRFVTGHLKDGT
CYSG_PSEAB       FIFGRGGEEIDELAARGIPFQVVPGITAASGCAAYAGIPLTHRDHAQSVRFVTGHLKDGT
CYSG_PSEA7       FIFGRGGEEIDELAAHGIPFQVVPGITAASGCAAYAGIPLTHRDHAQSVRFVTGHLKDGT
CYSG_PSEMY       FIFGRGGEEIEQLAAEDIPFQVVPGITAASGCAAYAGIPLTHRDHAQSVRFVTGHLKDGS
CYSG_PSEP1       FIFGRGGEEIEELAEHGIPFQVVPGITAASGCSAYGGIPLTHRDYAQSVRFVTGHLKDGT
CYSG_PSEPK       FIFGRGGEEIEELAEHGIPFQVVPGITAASGCSAYGGIPLTHRDYAQSVRFVTGHLKDGT
CYSG_PSEE4       FIFGRGGEEIEELADEGIPFQVVPGITAASGCSAYGGIPLTHRDYAQSVRFVTGHLKDGT
CYSG_PSEF5       FIFGRGGEEIEELAAHGIPFQVVPGITAASGCSAYAGIPLTHRDYAQSVRFVTGHLKDGT
CYSG_PSEPF       FIFGRGGEEIEELAAHGIPFQVVPGITAASGCAAYAGIPLTHRDYAQSVRFVTGHLKDGS
CYSG_PSE14       FIFGRGGEEIEELAVHGIPFQVVPGITAASGCAAYAGIPLTHRDHAQSVRFITGHLKDGT
CYSG_PSEU2       FIFGRGGEEIEELAAHGIPFQVVPGITAASGCAAYAGIPLTHRDHAQSVRFITGHLKNGT
CYSG_PSESM       FIFGRGGEEIEELAAHGIPFQVVPGITAASGCAAYAGIPLTHRDHAQSVRFITGHLKNGT
CYSG_PSEU5       FIFGRGGEEIEELAAHGVPFQVVPGITAASGCAAYAGIPLTHRDHAQSVRFVTGHLKDGS
CYSG_SACD2       FIFGRGGEEIDLLAEHKIPFQVVPGITAASGCASYSGIPLTHRDYSQSVRFITGHLQEGK
CYSG_GLUDA       FIFGRGGEEIEALMAAGIPFQVVPGITAASGCAAYAGIPLTHRDCAQSCLFVTGHARRDG
CYSG_GLUOX       FIFGRGGEEIEALVEAGVAFRLVPGISAANGCAAYSGIPLTHRDCAQACLFVTGHAKADG
CYSG1_HALHL      FLFGRGGEEIEGLIEQDIPFQVVPGISAAQGAASYAGIPLTHRDYAQTCRLLTGHRRA-G
CYSG2_HALHL      FIFGRGGEEIEGLIEHGIPFQVVPAVTAAQGAAAYAGIPLTHRDHAQSCRFLTGHRRH-G
CYSG_ALKEH       FVFGRGGEELQTLVDAGVPFQVVPGITAATGCAAYSGIPLTHRDYAHSCAFYTGHLKN-D
CYSG_CHRVO       FTFGRGGEEIATLAEHGIAFEVVPGITSASGAAAYAGIPLTHRDYAQSVTFVTGHKQD-G
CYSG_METFK       FIFGRGGEEIETLMENGIPFQVVPGITAANGVSSYAGIPLTHRDYAQSCLFTTGHLKD-G
CYSG_METCA       FIFGRGGEEIETLMACGIPFQVVPGITAASGCAAYAGIPLTHRAHAHACVFVAGHLKDGT
CYSG_NITOC       FIFGRGGEEIATLAAENIPFQVVPGITAASGCASYAGIPLTHRDHAHACIFVTGQLKEGR
CYSG_NITEU       FIFGRGGEEIETLSQHHIPFQVVPGITAASGVASYAGIPLTHRDHAQSCVFVTGHLKDNT
CYSG_NITEC       FIFGRGGEEIETLSQHQIPFQVVPGITAASGVASYAGIPLTHRDYAHSCVFVTGHLKDNT
CYSG_NITMU       FIFGRGGEEIETLAGHGIPFEVVPGITAANGAASYAGIPLTHRDYAQSCIFVTGHLKDGS
CYSG_THIDA       FIFGRGGEEIETLVEHGVAFQVVPGITAAAGVASYAGIPLTHRDYAQSVAFVTGHLKENT
CYSG_RUTMC       FIFGRGGEEIETLAENGISFQVVPGITAASGCSTYSGIPLTHRDYSQSCRFVTGHLKDGS
CYSG_VESOH       FIFGRGGEEIETLAENGIPFQVVPGITAASGCSTYSGIPLTHRDYSQSCRFVTGHLKDGS
CYSG_PSEA6       FIFGRGGEEIETLVEKGVSFQVVPGITAASGAASYAGIPLTHRDHAKSVVFATGHLRDNS
CYSG_PSYA2       FIFGRGGEEIESLRAHNIPYQVVPGITAANAAASYAGIPLTHRDHSQSVRFVTGFLKAGA
CYSG_PSYCK       FIFGRGGEEIESLRSHNVPYQVVPGITAANAAASYAGIPLTHRDHSQSVRFVTGFLKAGA
CYSG_PSYWF       FVFGRGGEEIQALRAAGIAYQVVPGITAAGAASCYTGIPLTHRDYAQSVRFVTGFLKSGE
CYSG_HYDCU       YIFGRGAEEVELLVQHDVPYQVVPGITAAAGCSVYADFPLTHRDYAQSVALITGHQQAGA
CYSG_ACTSZ       FVFGRGGEELEVLAERQIPFSVVPGITAAIGATAYAGIPLTHRDYAQSAVFVTGHRKA-N
CYSG_MANSM       FVFGRGGEELEVLAQQGIPFSVVPGITAAIGATAYAGIPLTHRDYAQSAVFVTGHRKA-D
CYSG_NEIMA       FVFGRGGEELETLARHQIPFSVVPGITAAVGATAYAGIPLTHRDYAQSAVFVTGHRKA-D
CYSG_NEIMF       FVFGRGGEELETLARHQIPFSVVPGITAAVGATAYAGIPLTHRDYAQSAVFVTGHRKA-D
CYSG_NEIMB       FVFGRGGEELETLARHQIPFSVVPGITAAVGATAYAGIPLTHRDYAQSAVFVTGHRKA-D
CYSG_NEIM0       FVFGRGGEELETLARHQIPFSVVPGITAAVGATAYAGIPLTHRDYAQSAVFVTGHRKA-D
CYSG_PHOPR       FVFGRGGEELEVLFDANILFQVVPGITAAAGATAYAGIPLTHRDYAQTAMFVTGHLKA-E
CYSG2_AERHH      FMFGRGGEELEVLAEEGIPFSVVPGITAAAGATAYAGIPLTHRDHAQSAVFITGHCQI-D
CYSG2_AERS4      FMFGCGGEELEVLAAEGIPFSVVPGITAAAGATAYAGIPLTHRDHAQSAVFITGHCQK-E
CYSG_BAUCH       FIFGRGGEELQAVAAAGISFQVVPGITAASGATAYAGIPLTHREYAHSVIFITGHQCDDS
CYSG_SODGM       FIFGRGGEELQAVATAGIPFQVVSGITAAAGATAYAGIPLTHREHAQSITFITGHLRD-G
CYSG1_CROS8      FIFGRGGEELEAAKAAGVPFQVVPGVTAASGATAYAGIPLTHRDYAQSAVFVTGHYKP-D
CYSG1_KLEP7      FIFGRGAEELQAAAEAGIPFQVVPGVTAAAGATAYAGIPLTHRDYAQSAVFVTGHYKP-D
CYSG1_YERPN      FIFGRGGEELQVVAQAGIPFQVVPGVTAAAGATAYAGIPLTHRDHAQSVTFITGHCRP-D
CYSG2_YERPP      FIFGRGGEELQVVAQAGIPFQVVPGVTAAAGATAYAGIPLTHRDHAQSVTFITGHCRP-D
CYSG1_YERPS      FIFGRGGEELQVVAQAGIPFQVVPGVTAAAGATAYAGIPLTHRDHAQSVTFITGHCRP-D
CYSG1_YERP3      FIFGRGGEELQVVAQAGIPFQVVPGVTAAAGATAYAGIPLTHRDHAQSVTFITGHCRP-D
CYSG1_YERE8      FIFGRGGEELQVVARAGIPFHIVPGVTAASGATAYAGIPLTHRDYAQSVTFITGHCRA-D
CYSG1_SERP5      FIFGRGGEELQVAAAAGIPFQVVPGVTAAAGATAYAGIPLTHRDHAQSVTFITGHCRP-D
CYSG1_PECAS      FIFGRGGEELQAVAQAGITFQVVPGVTAAAGVTAYAGIPLTHRDHAQSVIFITGHCRP-D
CYSG_PHOLL       FIFGRGGEELQVAASAGIPFQVVPGITAAIGATAYAGIPLTHREHSQSITFITGHCRE-K
CYSG_ZYMMO       FIFGRGGEELQAAKQASIPFQVVPGITAASGAAAYAGIPLTHRDYSQNVVFITGHCQK-D
CYSG_BLOFL       FIFGRGGEELQAVSKAGIMFQVVPGITSGIGVAAYAGIPLTHREYAHSVVFMTGHKRHQG
CYSG_BLOPB       FIFGRGGEELQAISEAGIAFQVVPGITAGIGVAAYSGIPLTHRKYAHSVVFITGHNTN-G
CYSG_BUCAI       FIFGRGSEEIEAAKDAGIHFQVVPGITSAIGIAAYTGIPLTHRKYSQGVIFITGHKCI-D
CYSG_SALCH       FIFGRGGEELETLCHAGIPFSVVPGITAASGCSAYSGIPLTHRDYAQSVRLVTGHLKT-G
CYSG_SALPB       FIFGRGGEELETLCHAGIPFSVVPGITAASGCSAYSGIPLTHRDYAQSVRLVTGHLKT-G
CYSG_SALPA       FIFGRGGEELETLCHAGIPFSVVPGITAASGCSAYSGIPLTHRDYAQSVRLVTGHLKT-G
CYSG_SALTY       FIFGRGGEELETLCHAGIPFSVVPGITAASGCSAYSGIPLTHRDYAQSVRLVTGHLKT-G
CYSG_SALTI       FIFGRGGEELETLCHAGIPFSVVPGITAASGCSAYSGIPLTHRDYAQSVRLVTGHLKT-G
CYSG_SALAR       FIFGRGGEELETLCHAGIPFSVVPGITAASGCSAYSGLPLTHRDYAQSVRLVTGHLKT-G
CYSG_CITK8       FIFGRGGEELETLCHAGIPFSVVPGITAASGCSAYSGVPLTHRDYAQSVRLVTGHLKT-G
CYSG_ENT38       FIFGRGGEELETLCNAGVPFSVVPGITAASGCSAYSGIPLTHRDYAQSVRLVTGHLKT-G
CYSG_ECOLC       FIFGRGGEELETLCNAGIPFSVVPGITAASGCSAYSGIPLTHRDYAQSVRLITGHLKT-G
CYSG_ECOLI       FIFGRGGEELETLCNAGIPFSVVPGITAASGCSAYSGIPLTHRDYAQSVRLITGHLKT-G
CYSG_ECO57       FIFGRGGEELETLCNAGIPFSVVPGITAASGCSAYSGIPLTHRDYAQSVRLITGHLKT-G
CYSG_ECOHS       FIFGRGGEELETLCNAGIPFSVVPGITAASGCSAYSGIPLTHRDYAQSVRLITGHLKT-G
CYSG_ECOUT       FIFGRGGEELETLCNAGIPFSVVPGITAASGCSAYSGIPLTHRDYAQSVRLITGHLKT-G
CYSG_ECOK1       FIFGRGGEELETLCNAGIPFSVVPGITAASGCSAYSGIPLTHRDYAQSVRLITGHLKT-G
CYSG_ECOL5       FIFGRGGEELETLCNAGIPFSVVPGITAASGCSAYSGIPLTHRDYAQSVRLITGHLKT-G
CYSG_ECOL6       FIFGRGGEELETLCNAGIPFSVVPGITAASGCSAYSGIPLTHRDYAQSVRLITGHLKT-G
CYSG_SHIDS       FIFGRGGEELETLCNAGIPFSVVPGITAASGCSAYSGIPLTHRDYAQSVRLITGHLKT-G
CYSG_SHIFL       FIFGRGGEELETLCNAGIPFSVVPGITAASGCSAYSGIPLTHRDYAQSVRLITGHLKT-G
CYSG_SHIF8       FIFGRGGEELETLCNAGIPFSVVPGITAASGCSAYSGIPLTHRDYAQSVRLITGHLKT-G
CYSG_SHISS       FIFGRGGEELETLCNAGIPFSVVPGITAASGCSAYSGIPLTHRDYAQSVRLITGHLKT-G
CYSG_SHIBS       FIFGRGGEELETLCNAGIPFSVVPGITAASGCSAYSGIPLTHRDYAQSVRLITGHLKT-G
CYSG_ECO24       FIFGRGGEELETLCNAGIPFSVVPGITAASGCSAYSGIPLTHRDYAQSVRLITGHLKT-G
CYSG2_KLEP7      FIFGRGGEELETLCEAGIPFSVVPGITAASGCSAYSGIPLTHRDFAQGVRLVTGHLKT-G
CYSG2_CROS8      FIFGRGGEELETLCDAGIPFSVVPGITAASGCSAYAGLPLTHRDYAQSVRLITGHLKN-G
CYSG_YERPE       FIFGRGGEELEELAGYGIPFSVVPGITAASGCSAYSGIPLTHRDHAQSVRLVTGHAKK-E
CYSG_YERPA       FIFGRGGEELEELAGYGIPFSVVPGITAASGCSAYSGIPLTHRDHAQSVRLVTGHAKK-E
CYSG2_YERPN      FIFGRGGEELEELAGYGIPFSVVPGITAASGCSAYSGIPLTHRDHAQSVRLVTGHAKK-E
CYSG1_YERPP      FIFGRGGEELEELAGYGIPFSVVPGITAASGCSAYSGIPLTHRDHAQSVRLVTGHAKK-E
CYSG2_YERPS      FIFGRGGEELEELAGYGIPFSVVPGITAASGCSAYSGIPLTHRDHAQSVRLVTGHAKK-E
CYSG2_YERP3      FIFGRGGEELEELAGYGIPFSVVPGITAASGCSAYSGIPLTHRDHAQSVRLVTGHAKK-E
CYSG2_YERE8      FIFGRGGEELETLADYNIPFSVVPGITAASGCSAYSGIPLTHRDHAQSVRLITGHAKK-D
CYSG2_SERP5      FIFGRGGEELETLADANIPFSVVPGITAASGCSAYSGIPLTHRDHAQSVRLVTGHAKS-D
CYSG2_PECAS      FIFGRGAEELEYLQQAGVPFSVVPGITAASGCSAYSGIPLTHRDHSQGVRLITGHVKH-D
CYSG1_AERHH      FIFGRGGEELETLAEAGIPFSVVPGITAASGCAAYSGIPLTHRDHAQRVQFITGHDKE-G
CYSG3_AERHH      FIFGRGGEELETLVGSGIGFQVVPGITAASGCAAYAGIPLTHRDHAQSVRFVTAHGKG-G
CYSG1_AERS4      FIFGRGGEELETLVGSGVGFQVVPGITAASGCAAYAGIPLTHRDHAQSVRFVTAHGKG-G
CYSG_PSYIN       FIFGRGGEELEELVEAGIAFQVVPGITAASGCSAYAGIPLTHRDFAQSVTFVTGHRKT-D
CYSG_PSET1       FIYGRGGEEVQVLAANKVNYQIVPGITAAAGCSAYAGIPLTHRDHAQAIQFVTGHCKK-D
CYSG_BORBR       FIFGRGGEELEYLRAHDVPYEVVPGITAALACAAYAGIPLTHRDHAQSVRMVTAHCRA-D
CYSG_BORPA       FIFGRGGEELEYLRAHDVPYEVVPGITAALACAAYAGIPLTHRDHAQSVRMVTAHCRA-D
CYSG_BORPE       FIFGRGGEELEYLRAHGVPYEVVPGITAALACAAYAGMPLTHRDHAQSVRMVTAHCRA-D
CYSG_BORA1       FIFGRGGEELEHLRAHGVDYEVVPGITAALACAAYAGIPLTHRDYAQSVHLVTAHCRA-D
CYSG_XYLFA       FVFGRGGEELEFLRTHNIPYEVIPGITAALACAAYAGIPLTHRDHAQSLCLITAHCQS-S
CYSG_XYLFT       FVFGRGGEELEFLRTHGIPYEVIPGITAALACAAYAGIPLTHRDHAQSLCLITAHCQS-S
                 : :* *.**:       : : ::..:::. . : * ..*****  ::   : :.      

CYSG_ACIAD       P-ELPWSELVYENQTLVLYMGLVGLEHICQQLIAHGQRPDMPVALVSKGTTPEQKVVVGT
CYSG_ALCBS       V-DLDWKHLVSETETVVFYMGLVGLREICSQLIAHGRGGDTPIALVSRGTTNLQEVITGR
CYSG_HAHCH       C-DLPWHEFVQDNQTLVFYMGLVGLPIISRELIAHGMKPSTPIALVSRGTLPDQQVLVGE
CYSG_PSEAE       T-DLPWQDLVAPGQTLVFYMGLVGLPVICEQLVAHGRSAQTPAALIQQGTTAQQRVFTGT
CYSG_PSEAB       T-DLPWQDLVAPGQTLVFYMGLVGLPVICEQLVAHGRSAQTPAALIQQGTTAQQRVFTGT
CYSG_PSEA7       T-DLPWKDLVAPGQTLVFYMGLVGLPVICEQLVAHGRSAQTPAALIQQGTTAQQRVFSGT
CYSG_PSEMY       S-NLPWKDLVAPGQTLVFYMGLVGLYGICEQLIAHGRSAATPAALVQQGTTQNQRVFTGT
CYSG_PSEP1       S-NLPWTDLVAPAQTLVFYMGLVGLPTICAELIRHGRAASTPAALVQQGTTRNQRVFTGT
CYSG_PSEPK       S-NLPWNDLVAPAQTLVFYMGLVGLPTICAELIRHGRAASTPAALVQQGTTRNQRVFTGT
CYSG_PSEE4       S-NLPWNDLVAPAQTLVFYMGLVGLPTICAELIRHGRAASTPAALVQQGTTRNQRVFTGT
CYSG_PSEF5       S-NLPWSDLVAPAQTLVFYMGLVGLPTICEQLIKHGRGADTPAALVQQGTTSNQRVFTGT
CYSG_PSEPF       T-DLPWSDLVAPAQTLVFYMGLVGLPIICEQLIKHGRAAETPAALIQQGTTVNQRVFTGT
CYSG_PSE14       T-DLPWSDLVAPAQTLVFYMGLIGLPVICEELIRHGRSADTPAALVQQGTTVNQRVFTGT
CYSG_PSEU2       T-DLPWSDLVAPAQTLVFYMGLIGLPVICEQLIRHGRSADTPAALVEQGTTVNQRVFTGT
CYSG_PSESM       T-DLPWSDLVAPAQTLVFYMGLIGLPVICAELIKHGRSADTPAALVQQGTTVNQRVFTGT
CYSG_PSEU5       C-DLPWSELAAPAQTLVFYMGLVGLPVICQQLIAHGRSAETPAALVQQGTTSNQRVFTAT
CYSG_SACD2       E-NFRWSEFVDKQQTLVFYMGLAGLETICSKLIEYGKSPSTPAALIERGTLPEQRVHVSD
CYSG_GLUDA       TLDLPWDSMARPGQTIAIYMGVTALPDLCTMLVRHGLPPDWPAAVVERGTRPDQRVLTGT
CYSG_GLUOX       VLDLPWDDMADRRQTVVIYMGISTLPQLAAGLLGKGLPADWPVAIVERGTQPRQRVFTGT
CYSG1_HALHL      HPQMKAHAPYRQDETLIIYMGLVNLEAVCEQLCECGLPPEHPAAVVAQATTPQQRVVLGN
CYSG2_HALHL      ALELGQWAPFRSDETLVVYMGLTHLETVSAQLQAGGLPPDQPAAAVDQATTPAQRVITAP
CYSG_ALKEH       RLDLDWSRMVQPGQTLVFYMGVASLPELSRQLCWHGLPAETPAALVEKGTTPEQRTLTAT
CYSG_CHRVO       SIDLDWQALTRPQQTVVVYMGVSTAAELCQAFVDNGRAASTPAAAVEWATTERQRTVCGT
CYSG_METFK       SVNLDWDALVRPNQTVVIYMGLVGLPEICRQMVAHGAPENLPIAIVQQGTTQRQRVVEGT
CYSG_METCA       LQDLDWSQLVQPHQTVVVYMGLQGLPQICAELIRHGAPPSRPAALIQQGTTRDQKVLTAT
CYSG_NITOC       L-SLNWQALVQPQQTIVVYMGLSGLEILCQELIAHGMPAVTPAALVQQGTTSRQRVLTGT
CYSG_NITEU       I-QLDWPALARPNQTIVVYMGLLGVTELCRQLIAHGLQATTPAAIVQQGTTPNQRVLTGT
CYSG_NITEC       V-QLDWSALARPNQTIVVYMGLLGVSELCRQLIAHGLPKTTPAAIIQQGTTPNQCVLTGT
CYSG_NITMU       V-DLDWPMLARPKQTIVVYMGLLGLTVLCKQLIAHGLPNNTPAAIVQQGTTRKQRVLAAT
CYSG_THIDA       F-NMNWEGIARRDQTIVIYMGLKGLPMLCEALIKHGLTADTPAAIVQHGTLPTQRVITGT
CYSG_RUTMC       M-NLPWHELSVEQQTIVFYMALNGARHLSEQLITHGMSPDMPVALVEKGTTPEQKVYTTT
CYSG_VESOH       M-NLPWHELAIEQQTIVFYMALNSVEYLSGQLIIHNMRPDMPVALVEKGTTPEQKVYITT
CYSG_PSEA6       I-NLNWPMLAQPEQTTVFYMGLTGLPVICEKLIQHGLPDTTEIALVQSATTTEQKVVAGN
CYSG_PSYA2       P-NNNFKNFLDTDETVVFYMGLHSLPRLTEGLIDAGRSAETPIAIVSNASMPNQQVLTGT
CYSG_PSYCK       P-NNNFKSFLNTDETVVFYMGLHSLPRLTQGLIDAGRSAKTPIAIVSNASMPNQQVLTGT
CYSG_PSYWF       P-NTGFAALTNPNETVIFYMGLHSLERLTKGLMDAGRSPQTPIAIISQASMPTQQVMTGT
CYSG_HYDCU       Q-GIDYARLAQSGDTMVFYMGIKNAPKIQAGLIAHGLCPDTPAAIIENGTRLNQKVTVTS
CYSG_ACTSZ       ASDIEWQTLARSNQTLVIYMGTLKAKDIAERLQQFGRAGSTPIAVISQGTQARQKTHIGT
CYSG_MANSM       ASDIEWQTLARSNQTLVIYMGTLKAATIAQSLQQYGRAASTPVAVISQGTQETQHTQIGT
CYSG_NEIMA       APDIEWQTLARSRQTLVIYMGALKAALIAERLQQHGRSPDTPAAVISQGTLPAQKTATGT
CYSG_NEIMF       APDIEWQTLARSRQTLVIYMGALKAALIAERLQQHGRSPDTPAAVISQGTLPAQKTATGT
CYSG_NEIMB       APDIEWQTLARSRQTLVIYMGALKAALIAERLQQHGRSPDTPAAVISQGTLPAQKTATGT
CYSG_NEIM0       APDIEWQTLARSRQTLVIYMGALKAALIAERLQQHGRSPDTPAAVISQGTLPAQKTATGT
CYSG_PHOPR       SDQMDWSTLARGKQTLVIYMGLMKSGHIQQQLLINGRAGDTPIAIIERGTQKKQKVIKGQ
CYSG2_AERHH      GKEPDWQQLAATSQTLVIYMGLMRSEHIQQQLVSHGRSSATPIAIIERGTTARQRVLTGT
CYSG2_AERS4      GKEPDWQQLAVTQQTLVIYMGLMRSEHIQQQLVSHGRSCTTPIAIIEWGTTARQRVLTGT
CYSG_BAUCH       SNYLNWSLLARSNQTLVIYMGVIQAAVIKKKLLAHGRALQTPVAVISRGTLKDQSVIIGT
CYSG_SODGM       ADALDWQALARGRQTLAIYMGVVKAAEISSQLIRHGRSAQTPVAVISRGTCSDQYVQTGT
CYSG1_CROS8      SEPFDWALLAKSRQTLAIYMGTMKAAEISQQLIAHGRDATTPVAVISRGTREDQRVLTGT
CYSG1_KLEP7      SAPFDWSLLAKSQQTLAIYMGTMKAAEISAQLIAHGRDSDTPVAVISRGTRDDQQTITGT
CYSG1_YERPN      GDDLDWQTLARGRQTLAIYMGTVKAAAISQQLIAHGRSSTTPVAVIGRGTRVDQQVLIGT
CYSG2_YERPP      GDDLDWQTLARGRQTLAIYMGTVKAAAISQQLIAHGRSSTTPVAVIGRGTRVDQQVLIGT
CYSG1_YERPS      GDDLDWQALARGRQTLAIYMGTVKAAAISQQLIAHGRSSTTPVAVIGRGTRVDQQVLIGT
CYSG1_YERP3      GDDLDWQALARGRQTLAIYMGTVKAAAISQQLIAHGRSSTTPVAVIGRGTRVDQQVLIGT
CYSG1_YERE8      GDDVDWQALARGRQTLAIYMGTVKAAEISQQLIAHGRASTTPVAVIGRGTRADQQVLTGT
CYSG1_SERP5      GDGLDWADLARARQTLAIYMGTMKAADISQRLIAHGRAATTPVAVISRGTRADQLVQTGT
CYSG1_PECAS      GDSLDWSTLARGRQTLAIYMGTMKAAEISQQLIAHGRSAQTPVAVISRGTRHDQQVQIGT
CYSG_PHOLL       GNELDWPALARGHQTLVIYMGTVKAALISHQLILHGRAEDTPVAVIGCGTRLEQQVLTGT
CYSG_ZYMMO       GNGLDWATLARPHQTLVIYMGVMNAGKISEALIKHGRKADTPVAIIAHATLPNQQILNGR
CYSG_BLOFL       DYKINWSLLSDNKQTIVIYMGQLNAVNISKNLICHGRHIYTPVAIISRGTYLDQKILIGT
CYSG_BLOPB       DNQFNWNSLSNNQQTLVIYMGKINAISIRNNLIIHGRNMHTPVAVISRGTYQDQKILIGT
CYSG_BUCAI       GFLNNWSILSDPSYTLVVYMGTLKAVYIAQKLITFGRSKLTPIAIIVQGTTIHQKVIVGC
CYSG_SALCH       -GELDWENLAAEKQTLVFYMGLNQAATIQEKLIAFGMQADMPVALVENGTSVKQRVVHGV
CYSG_SALPB       -GELDWENLAAEKQTLVFYMGLNQAATIQEKLIAFGMQADMPVALVENGTSVKQRVVHGV
CYSG_SALPA       -GELDWENLAAEKQTLVFYMGLNQAATIQEKLIAFGMQADMPVALVENGTSVKQRVVHGV
CYSG_SALTY       -GELDWENLAAEKQTLVFYMGLNQAATIQEKLIAFGMQADMPVALVENGTSVKQRVVHGV
CYSG_SALTI       -GELDWENLAAEKQTLVFYMGLNQAATIQEKLIAFGMEANMPVALVENGTSVKQRVVHGV
CYSG_SALAR       -GELDWENLAAEKQTLVFYMGLNQAATIQEKLIAFGMQADMPVALVENGTSIKQRVVNGE
CYSG_CITK8       -GELDWENLAAEKQTLVFYMGLNQAATIQEKLIAFGMQADMPVALVENGTAVKQRVVSGV
CYSG_ENT38       -SELDWHNLAAEKQTLVFYMGLNQAATIQEKLLEHGMQHDMPVALVENGTAITQRVVSGV
CYSG_ECOLC       -GELDWENLAAEKQTLVFYMGLNQAATIQQKLIEHGMPGEMPVAIVENGTAVTQRVIDGT
CYSG_ECOLI       -GELDWENLAAEKQTLVFYMGLNQAATIQQKLIEHGMPGEMPVAIVENGTAVTQRVIDGT
CYSG_ECO57       -GELDWENLAAEKQTLVFYMGLNQAATIQQKLIEHGMPGEMPVAIVENGTAVTQRVIDGT
CYSG_ECOHS       -GELDWENLAAEKQTLVFYMGLNQAATIQQKLIEHGMPGEMPVAIVENGTAVTQRVIDGT
CYSG_ECOUT       -GELDWENLAAEKQTLVFYMGLNQAATIQQKLIEYGMPGEMPVAIVENGTAVTQRVIDGT
CYSG_ECOK1       -GELDWENLAAEKQTLVFYMGLNQAATIQQKLIEYGMPGEMPVAIVENGTAVTQRVIDGT
CYSG_ECOL5       -GELDWENLAAEKQTLVFYMGLNQAATIQQKLIEYGMPGEMPVAIVENGTAVTQRVIDGT
CYSG_ECOL6       -GELDWENLAAEKQTLVFYMGLNQAATIQQKLIEYGMPGEMPVAIVENGTAVTQRVIDGT
CYSG_SHIDS       -GELDWENLAAEKQTLVFYMGLNQAATIQQKLIEHDMPGEMPVAIVENGTAVTQRVIDGT
CYSG_SHIFL       -GELDWENLAAEKQTLVFYMGLNQAATIQQKLIEHGMPGEMPVAIVENGTAVTQRVIDGT
CYSG_SHIF8       -GELDWENLAAEKQTLVFYMGLNQAATIQQKLIEHGMPGEMPVAIVENGTAVTQRVIDGT
CYSG_SHISS       -GELDWENLAAEKQTLVFYMGLNQAATIQQKLIEHGMPGEMPVAIVENGTAVTQRVIDGT
CYSG_SHIBS       -GELDWENLAAEKQTLVFYMGLNQAATIQQKLIEHGMPGEMPVAIVENGTAVTQRVIDGT
CYSG_ECO24       -GELDWENLAAEKQTLVFYMGLNQAATIQQKLIEHGMPGEMPVAIVENGTAVTQRVIDGT
CYSG2_KLEP7      -GELDWANLAVEKQTLVFYMGLNQAPAIREKLIAHGMAEDMPAAIVENGTAVTQKVVSGT
CYSG2_CROS8      -GEFDWHNLAAEKQTLVFYMGLNQAAAIQEKLIEHGMDPQMPVALVENGTSVKQRVVAGV
CYSG_YERPE       -GQLDWANLAAEKQTLVFYMGLSQAGEIQQQLIQHGMPATTQVALVENGTSRHQRVVSGE
CYSG_YERPA       -GQLDWANLAAEKQTLVFYMGLSQAGEIQQQLIQHGMPATTQVALVENGTSRHQRVVSGE
CYSG2_YERPN      -GQLDWANLAAEKQTLVFYMGLSQAGEIQQQLIQHGMPATTQVALVENGTSRHQRVVSGE
CYSG1_YERPP      -GQLDWANLAAEKQTLVFYMGLSQAGEIQQQLIQHGMPATTQVALVENGTSRHQRVVSGE
CYSG2_YERPS      -GQLDWANLAAEKQTLVFYMGLSQAGEIQQQLIQHGMPATTQVALVENGTSRHQRVVSGE
CYSG2_YERP3      -GQLDWANLAAEKQTLVFYMGLSQAGEIQQQLIQHGMPATTQVALVENGTSRHQRVVSGE
CYSG2_YERE8      -SQLDWANLAAEKQTLVFYMGLSQAGEIQQQLIRHGMPAATPVALVENGTSRHQRVVSGE
CYSG2_SERP5      -GGLDWSTLAAGQQTLVFYMGLTQAADIQRQLIAHGMPAATPVALVENGTSCRQRVIEGE
CYSG2_PECAS      -TDLDWSSLAAEKQTLVFYMGLQQAEHIQNKLIEQQLPETVPVAIIENGTSTKQRVLSGQ
CYSG1_AERHH      NIAQEWPALATPRQTLVFYMGLAHAGRIQDELQTHGLPGHTPVALVEQGTRLQQRVVRGK
CYSG3_AERHH      AQDLDWPLLAKDKQTLVFYMGLSSCTTIREQLLTHGKAGDTPVALIERGTQPSQRVIRGT
CYSG1_AERS4      TQDLDWPLLARDQQTLVFYMGLSSCATIRQKLTAHGKAGTTPVALIERGTQLNQRVIRGT
CYSG_PSYIN       GEELNWQALAAPNQTLVVYMGLIQSQEIQTQLLSHGRAPETPVALVNKGTTSDQHVVIGQ
CYSG_PSET1       GQELDWQSLAKPNQTLAIYMGVIKSPHIQAELLKHGRNANTPVAIIENGTRKNQRVITGK
CYSG_BORBR       QDTLDWAGLARDQQTLAFYMGVGQLDYVTARLLEHGRAPATPFALIENGSRPEQRVVTGT
CYSG_BORPA       QDTLDWAGLARDQQTLAFYMGVGQLDYVTARLLEHGRAPATPFALIENGSRPEQRVVTGT
CYSG_BORPE       QDTLDWAGLARDQQTLAFYMGVGQLDYVTARLLEHGRAPATPFALIENGSRPEQRVVTGT
CYSG_BORA1       EEALDWDGLARGQQTLAFYMGVGQLDILSARLVAHGRPGSTPFALIENGSRPSQRVVMGR
CYSG_XYLFA       LDTLDWAALAQERQTLAFYMGVAGLPTIQQRLCEAGRAETTPFALIENGARAQQRVLTGT
CYSG_XYLFT       LDTLNWAALAQERQTLAFYMGVAGLPTIQQRLCEAGRTETTPFALIENGARAQQRVLTGT
                               *  .**.      :   :           * :  .:   *      

CYSG_ACIAD       LSNIASKIAEYQIHAPTLTIIGEVVSLREQLQWL--------------------------
CYSG_ALCBS       LDQLPDDIEGREIHAPTLIIVGSVVSLHPKFGWFKP------------------------
CYSG_HAHCH       LGNIAKKVEEQQIPGPTIIIIGDVVTLRDRLRWMD-------------------------
CYSG_PSEAE       LENLPQLVAEHEVHAPTLVIVGEVVQLRDKLAWFEGAREDA-------------------
CYSG_PSEAB       LENLPQLVAEHEVHAPTLVIVGEVVQLRDKLAWFEGAREDA-------------------
CYSG_PSEA7       LENLPQLVAEHEVHAPTLVIVGEVVQLRDKLAWFEGAREGA-------------------
CYSG_PSEMY       LETLPQLVAQHEVHAPTLVIVGEVVTLRDKLAWFEGAQGSL-------------------
CYSG_PSEP1       LADLPDLVAQHEVHAPTLVIVGEVVQLRDKLAWFEGSQNS--------------------
CYSG_PSEPK       LADLPDLVAQHEVHAPTLVIVGEVVQLRDKLAWFEGSQNS--------------------
CYSG_PSEE4       LADLPELVARHEVHAPTLVIVGEVVKLRDKLAWFEGAQNS--------------------
CYSG_PSEF5       LGNLPALVAEHEVHAPTLVIVGEVVQLREKLAWFEGAQSEV-------------------
CYSG_PSEPF       LADLPRLVAEHEVHAPTLVIVGEVVQLREKLAWFEGAQGQI-------------------
CYSG_PSE14       LANLPQLVAEHEVHAPTLVIIGEVVKLREKLAWFEGAQATV-------------------
CYSG_PSEU2       LANLPQLVAEHDVHAPTLVIIGEVVKLREKLAWFEGAQATL-------------------
CYSG_PSESM       LANLPQLVAEHEVHAPTLVIIGEVVKLREKLAWFEGAQATL-------------------
CYSG_PSEU5       LGTLAGRIAQEDVQAPTLLIVGEVVQLREKLAWFEGAQAAGR------------------
CYSG_SACD2       LAGLAAKIEGLDVHAPTLLIIGDVVRCHEKLNWYK-------------------------
CYSG_GLUDA       LADLPALARAHAVGSPALVLVGQVVRHRVVTPPPLSGT----------------------
CYSG_GLUOX       LSTIAQQAAEAQVKSPALVIVGQVVRHRVVSP----------------------------
CYSG1_HALHL      LRTLAERVRAERVESPALVVVGPTVQLHPRLGWYRGEAEDRDAAASIDPCWTGGMRD---
CYSG2_HALHL      LAELPERVRTARLQGPALIVVGATVTLQPQLGWYHSSP-NAEPAFPEHGCLRGEPRPTRH
CYSG_ALKEH       LETLPGLARQQGFQSPALVIIGEVVRLYEQINWYRPPGDETPKAAEPGELNRRRPA----
CYSG_CHRVO       LAALPGLMASHGIASPALIIVGEVVELADKLSWYRRSENSAVTIQED-------------
CYSG_METFK       LATLPGLVERAGLRAPCLIIVGQVVRLREKLAWFAPSPE-VVSAG---------------
CYSG_METCA       LETLPDKVADAGIKAPTLIIIGEVVGLRKKLAWYRS--RQETEGRSGNG-----------
CYSG_NITOC       LATLPDIVQGEDIHAPTLVIIGGVVALYPQLAWFKVPDREPLDAR---------------
CYSG_NITEU       LETLPDIIQQNPLKPPTLIIVGNVVKLHQKLAWFNSTSEPMGTSSG-PGYP---------
CYSG_NITEC       LATLPTIIQENPLKPPTLIIVGEVVKLRQRLAWFNSTSESLGNTPGYSKHP---------
CYSG_NITMU       LETLPELTAAAHLVPPTLVIVGEVVNLHRKLAWFQPEGNLPGAE----------------
CYSG_THIDA       LATLPTLAVEAGLKAPTLIIVGNVVKLREKLAWYRPQAAGEAAAATPLEAPDHLA-----
CYSG_RUTMC       LKKLPDLVKNEIIHAPTLIIIGEVVTLREKLNWFDAKLASSKKSYLFGG-----------
CYSG_VESOH       LKELPNLVENETIHAPTLIIIGEVVKLREKLNWFDAKPISSKK-----------------
CYSG_PSEA6       LANIQQKVAEAGIKPPALIIVGSVVSLREKLNWFGADA----------------------
CYSG_PSYA2       LASIVELQEKNQLPTPALLIMGDVVSLHHDLAWYNLHNQQHNQNTSETDNNWLRGGTATT
CYSG_PSYCK       LASIVELQAQHQLPTPALLIMGDVVSLHHDLAWYN------NKKTSENDNNWLRGGTATT
CYSG_PSYWF       LADIVAKHEANPLPTPALLIVGEVAKLHDELAWYG-------EHIVNTD-----------
CYSG_HYDCU       LAKLSETIQKKSIKPPALLVIGEVIKVRERLQKKSLLDDRVPA-----------------
CYSG_ACTSZ       LTALAEIAENAP--TPALIVVGEVVTLHDKLAWFGEQKFAQ----KRPHFTLDSLRIESV
CYSG_MANSM       LKNLAELAEKAP--TPALIVVGEVVSLHEKLAWFGEDKFAQ----KRPHFTLDSLRIERV
CYSG_NEIMA       LANLAELAETAP--NPALIVIGEVVGLHEKLAWFGENAKKESNPAEHAYFALDGLGTGQE
CYSG_NEIMF       LANLSELAETAP--NPALIVIGEVVGLHEKLAWFGENAKKESNPAEHAYFALDGLGTGQE
CYSG_NEIMB       LANLAELAETAP--NPALIVIGEVVGLHEKLAWFGENGEGE-NRVGQTYPALGGLNAGQR
CYSG_NEIM0       LANLAELAETAP--NPALIVIGEVVGLHEKLAWFGENGEGE-NRVGQAYPALGGLNAGQR
CYSG_PHOPR       LSELEQLAKNAE--SPSLIVIGEVVNLSEKLHWFGKQ-----------EQSLQQSAVVKL
CYSG2_AERHH      LADLAELAAQAV--SPSLIVIGEVVALRERLAWFGE----------GQQQGTCDLKLVSL
CYSG2_AERS4      LAELAVLAQQAV--SPSLIVIGEVVSLRKQLAWFGEKSGEKRDVQAGTDMNGCDLKLVNL
CYSG_BAUCH       LEQLEMLTIQAL--SPTLLIIGEVVKISCEINWFGKI----------IKEQ---------
CYSG_SODGM       LEALDQLAQKAP--TPALVVIGEVVALHHEINWFGQQ----------NLAAQKRASVVNL
CYSG1_CROS8      LDTLNILAKDAP--MPALLVVGEVVQLHQQLAWFQHS----------TDAENLRSSVVNL
CYSG1_KLEP7      LQQLEHLAKDAP--MPALLVVGEVVQLHQQLAWFQHT----------SSAEGFNASVVNL
CYSG1_YERPN      LAQLESLAQQAP--TPALLVIGEVVNLHHQIAWFGQQ---------PQTESAISPSVVNL
CYSG2_YERPP      LAQLESLAQQAP--TPALLVIGEVVNLHHQIAWFGQQ---------PQTESAISPSVVNL
CYSG1_YERPS      LAQLESLAQQAP--TPALLVIGEVVNLHHQIAWFGQQ---------PQTESAISPSVVNL
CYSG1_YERP3      LAQLESLAQQAP--TPALLVIGEVVNLHHQIAWFGQQ---------PQTESAINPSVVNL
CYSG1_YERE8      LAELELLAHQAP--TPALLVIGEVVDLHHQIAWFGQQ---------PQTEQAISPSVVNL
CYSG1_SERP5      LQQLEQLAQQAP--LPALLVIGEVVELHHQIAWFGHQ---------PQAEGVSRPAVVNL
CYSG1_PECAS      LQELEHLARQAP--TPALLVIGEVVDLHHQIAWFGQTT--------PTVPQDSRPAVVNL
CYSG_PHOLL       LLELEQLAQQAP--SPALLVVGEVAQLHHQIAWFGQQ----------SIAKISRPAVVDF
CYSG_ZYMMO       LDQLESLAKQAE--TPALLIIGEVGGLQSDLSWFSSK----------TDKEDTKSSLINL
CYSG_BLOFL       LIELEKLIYMVK--KPTLLIIGDVVSLHNEISWFGNG-----------------------
CYSG_BLOPB       LIELEKLTQMAD--HPALLVIGDVVSLHSKINWFGQK----------ALHYYLINSIINL
CYSG_BUCAI       LGEIEKIIPFAA--TPSLLIIGDVVHLHKKLAWFQSE----------NILKKIKNKFSTL
CYSG_SALCH       LTQLGELAQQVE--SPALIIVGRVVGLRDKLNWFSNY-----------------------
CYSG_SALPB       LTQLGELAQQVE--SPALIIVGRVVGLRDKLNWFSNY-----------------------
CYSG_SALPA       LTQLGELAQQVE--SPALIIVGRVVALRDKLNWFSNH-----------------------
CYSG_SALTY       LTQLGELAQQVE--SPALIIVGRVVALRDKLNWFSNH-----------------------
CYSG_SALTI       LTQLGELAQQVE--SPALIIVGRVVALRDKLNWFSNH-----------------------
CYSG_SALAR       LAQLGELAKQVA--SPALIIVGRVVGLRDKLNWFSSH-----------------------
CYSG_CITK8       LAQLGELAKQVE--SPALIIVGRVVALRDKLNWFSNH-----------------------
CYSG_ENT38       LTQLGELAKQVE--SPALIVVGRVVELREKLNWFSNH-----------------------
CYSG_ECOLC       LTQLGELAQQMN--SPSLIIIGRVVGLRDKLNWFSNH-----------------------
CYSG_ECOLI       LTQLGELAQQMN--SPSLIIIGRVVGLRDKLNWFSNH-----------------------
CYSG_ECO57       LTQLGELAQQMN--SPSLIIIGRVVGLRDKLNWFSNH-----------------------
CYSG_ECOHS       LTQLGELAQQMN--SPSLIIIGRVVGLRDKLNWFSNH-----------------------
CYSG_ECOUT       LTQLGELAQQMN--SPSLIIIGRVVGLRDKLNWFSNH-----------------------
CYSG_ECOK1       LTQLGELAQQMN--SPSLIIIGRVVGLRDKLNWFSNH-----------------------
CYSG_ECOL5       LTQLGELAQQMN--SPSLIIIGRVVGLRDKLNWFSNH-----------------------
CYSG_ECOL6       LTQLGELAQQMN--SPSLIIIGRVVGLRDKLNWFSNH-----------------------
CYSG_SHIDS       LTQLGKLAQQMN--SPSLIIIGRVVGLRDKLNWFSNH-----------------------
CYSG_SHIFL       LTQLGELAQQMN--SPSLIIIGRVVGLRDKLNWFSNH-----------------------
CYSG_SHIF8       LTQLGELAQQMN--SPSLIIIGRVVGLRDKLNWFSNH-----------------------
CYSG_SHISS       LTQLGELAQQMN--SPSLIIIGRVVGLRDKLNWFSNH-----------------------
CYSG_SHIBS       LTQLGELAQQMN--SPSLIIIGRVVGLRDKLNWFSNH-----------------------
CYSG_ECO24       LTQLGELAQQMN--SPSLIIIGRVVGLRDKLNWFSNH-----------------------
CYSG2_KLEP7      LGQLDILAQQMA--SPALIIVGRVVGLRDKLNWFSNH-----------------------
CYSG2_CROS8      LTELGALAQRVE--SPSLIIVGRVVALRDKLNWFSSK-----------------------
CYSG_YERPE       LSQLALLSQQVS--SPSLIIVGSVVSLREKLNWFSSR---------HHDDQPKVTECVAH
CYSG_YERPA       LSQLALLSQQVS--SPSLIIVGSVVSLREKLNWFSSR---------HHDDQPKVTECVAH
CYSG2_YERPN      LSQLALLSQQVS--SPSLIIVGSVVSLREKLNWFSSR---------HHDDQPKVTECVAH
CYSG1_YERPP      LSQLALLSQQVS--SPSLIIVGSVVSLREKLNWFSSR---------HHDDQPKVTECVAH
CYSG2_YERPS      LSQLALLSQQVS--SPSLIIVGSVVSLREKLNWFSSR---------HHDDQPKVTECVAH
CYSG2_YERP3      LSQLALLSQQVS--SPSLIIVGSVVSLREKLNWFSSR---------HHDDQPKVTECVAH
CYSG2_YERE8      LSQLALLSQQVS--SPSLIIVGSVVSLREKLNWFSSA---------EHG-KTGMKEQVER
CYSG2_SERP5      LSQLGTLALQAA--SPSLIIVGSVVSLRSKLNWFSSQ---------EPS------QPLAQ
CYSG2_PECAS      LSQLGELAQQAS--SPSLIIIGNVVGLREKLSWFSDQ---------TA------------
CYSG1_AERHH      LQQLAQLATQVE--SPSLIIIGSVVTLADKLDWYGEA---------NTLAGV--------
CYSG3_AERHH      LAQLPELALGVE--SPALIMVGSVVTLADQLAWFGQG---------GAADAALASA----
CYSG1_AERS4      LDQLPELAVGVE--SPALIMVGSVVTLADKLAWFGQT---------NHGVQAAALA----
CYSG_PSYIN       LSELEQLGGGLQ--GPTLMIIGEVVNLADKLAWYQSD---------NKPPLSRDPFLVNL
CYSG_PSET1       LGELADLITRNSVVSPALLIIGEVASLHQELHWFGAK----------AQTSSFAQPLTDV
CYSG_BORBR       LAELPEIARRRSVRPPALLVIGEVAALADTLQWFGQH----------QHGLPGPQALAA-
CYSG_BORPA       LAELPEIARRRSVRPPALLVIGEVAALADTLQWFGQH----------QHGLPGPQALAA-
CYSG_BORPE       LADLPEIARRRGVRPPALLVIGEVAALADTLQWFGQH----------QRGLPGPQALAA-
CYSG_BORA1       LSQLAERAREQAVASPALLIVGEVAALADRLAWFGKP-----------------------
CYSG_XYLFA       LKTLAHTAQTYAVRPPALLILGEVTTLAEHLHWFGTA----------PLSAPCPPALIL-
CYSG_XYLFT       LKTLAHTAQTYAVRPPALLILGEVTALAEHLHWFGTT----------PLSAPCPPRTHPI
                 *  :           * : ::* .                                    

CYSG_ACIAD       -----------------------------------
CYSG_ALCBS       -----------------------------------
CYSG_HAHCH       -----------------------------------
CYSG_PSEAE       -----------------------------------
CYSG_PSEAB       -----------------------------------
CYSG_PSEA7       -----------------------------------
CYSG_PSEMY       -----------------------------------
CYSG_PSEP1       -----------------------------------
CYSG_PSEPK       -----------------------------------
CYSG_PSEE4       -----------------------------------
CYSG_PSEF5       -----------------------------------
CYSG_PSEPF       -----------------------------------
CYSG_PSE14       -----------------------------------
CYSG_PSEU2       -----------------------------------
CYSG_PSESM       -----------------------------------
CYSG_PSEU5       -----------------------------------
CYSG_SACD2       -----------------------------------
CYSG_GLUDA       -----------------------------------
CYSG_GLUOX       -----------------------------------
CYSG1_HALHL      -----------------------------------
CYSG2_HALHL      PAPADTEQA--------------------------
CYSG_ALKEH       -----------------------------------
CYSG_CHRVO       -----------------------------------
CYSG_METFK       -----------------------------------
CYSG_METCA       -----------------------------------
CYSG_NITOC       -----------------------------------
CYSG_NITEU       -----------------------------------
CYSG_NITEC       -----------------------------------
CYSG_NITMU       -----------------------------------
CYSG_THIDA       -----------------------------------
CYSG_RUTMC       -----------------------------------
CYSG_VESOH       -----------------------------------
CYSG_PSEA6       -----------------------------------
CYSG_PSYA2       PKSNAQFNAHQQAHALSMITNLATEDGDLEQLIIG
CYSG_PSYCK       PKP----NPNQQAHALSMIANLATEDGGLEQLVID
CYSG_PSYWF       ----------QQAHALNML----------------
CYSG_HYDCU       -----------------------------------
CYSG_ACTSZ       A----------------------------------
CYSG_MANSM       A----------------------------------
CYSG_NEIMA       QQAA-------------------------------
CYSG_NEIMF       QQAA-------------------------------
CYSG_NEIMB       AA---------------------------------
CYSG_NEIM0       AA---------------------------------
CYSG_PHOPR       A----------------------------------
CYSG2_AERHH      A----------------------------------
CYSG2_AERS4      A----------------------------------
CYSG_BAUCH       -----------------------------------
CYSG_SODGM       A----------------------------------
CYSG1_CROS8      A----------------------------------
CYSG1_KLEP7      A----------------------------------
CYSG1_YERPN      A----------------------------------
CYSG2_YERPP      A----------------------------------
CYSG1_YERPS      A----------------------------------
CYSG1_YERP3      A----------------------------------
CYSG1_YERE8      A----------------------------------
CYSG1_SERP5      A----------------------------------
CYSG1_PECAS      A----------------------------------
CYSG_PHOLL       A----------------------------------
CYSG_ZYMMO       A----------------------------------
CYSG_BLOFL       -----------------------------------
CYSG_BLOPB       I----------------------------------
CYSG_BUCAI       TFI--------------------------------
CYSG_SALCH       -----------------------------------
CYSG_SALPB       -----------------------------------
CYSG_SALPA       -----------------------------------
CYSG_SALTY       -----------------------------------
CYSG_SALTI       -----------------------------------
CYSG_SALAR       -----------------------------------
CYSG_CITK8       -----------------------------------
CYSG_ENT38       -----------------------------------
CYSG_ECOLC       -----------------------------------
CYSG_ECOLI       -----------------------------------
CYSG_ECO57       -----------------------------------
CYSG_ECOHS       -----------------------------------
CYSG_ECOUT       -----------------------------------
CYSG_ECOK1       -----------------------------------
CYSG_ECOL5       -----------------------------------
CYSG_ECOL6       -----------------------------------
CYSG_SHIDS       -----------------------------------
CYSG_SHIFL       -----------------------------------
CYSG_SHIF8       -----------------------------------
CYSG_SHISS       -----------------------------------
CYSG_SHIBS       -----------------------------------
CYSG_ECO24       -----------------------------------
CYSG2_KLEP7      -----------------------------------
CYSG2_CROS8      -----------------------------------
CYSG_YERPE       VG---------------------------------
CYSG_YERPA       VG---------------------------------
CYSG2_YERPN      VG---------------------------------
CYSG1_YERPP      VG---------------------------------
CYSG2_YERPS      VG---------------------------------
CYSG2_YERP3      VG---------------------------------
CYSG2_YERE8      VG---------------------------------
CYSG2_SERP5      MA---------------------------------
CYSG2_PECAS      -----------------------------------
CYSG1_AERHH      -----------------------------------
CYSG3_AERHH      -----------------------------------
CYSG1_AERS4      -----------------------------------
CYSG_PSYIN       A----------------------------------
CYSG_PSET1       A----------------------------------
CYSG_BORBR       -----------------------------------
CYSG_BORPA       -----------------------------------
CYSG_BORPE       -----------------------------------
CYSG_BORA1       -----------------------------------
CYSG_XYLFA       -----------------------------------
CYSG_XYLFT       S----------------------------------