CLUSTAL format seed alignment for MF_01652

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

MHPA_ECOLI       MAIQHPDIQPAVNHS----------VQVAIAGAGPVGLMMANYLGQMGIDVLVVEKLDKL
MHPA_ECO57       MAIQHPDIQPAVNHS----------VQVAIAGAGPVGLMMANYLGQMGIDVLVVEKLDKL
MHPA_ECO24       MAIQHPDIQPAVNHS----------VQVAIAGAGPVGLMMANYLGQMGIDVLVVEKLDKL
MHPA_ECOHS       MAIQHPDIQPAVNHS----------VQVAIAGAGPVGLMMANYLGQMGIDVLVVEKLDKL
MHPA_SHISS       MAIQHPDIQPAVNHS----------VQVAIAGAGPVGLMMANYLGQMGIDVLVVEKLDKL
MHPA_KLEP7       MTTSTPDIQPAVQHT----------AQVAIVGAGPVGLMMANYLGQMGISVLVVEKLATL
MHPA_PARXL       MPASNDPVAASRRCE-------TVSADVAIIGAGPVGLMIANYLGLQGVRVVVLEKLEQI
MHPA_CUPPJ       MNTTATQTVHADRLP-------DVDTDVAIIGAGPVGLMIANILGLQGVRVTVVEKLDQL
MHPA1_BURVG      MRPAFEPAAGLGRAHPHETTPRSIDADVAIIGAGPVGLMIANILGLQGVRVVVVEKLTQI
MHPA_MYCA1       ----MIAPGPRATDH---------DTDVLVVGAGPVGLTLANILGLQGIRTVVVEERDTL
MHPA_MYCPA       ----MIAPGPRATDH---------DTDVLVVGAGPVGLTLANILGLQGIRTVVVEERDTL
MHPA_MYCS2       ----MNSPG---------------AVDVVIVGAGPVGLTLANILGGQGVRTLIIEERETL
MHPA_MYCGI       ------MTEQT-------------DVDVVIVGAGPAGLTLANILGLEGVRVLVVDERDKL
MHPA_MYCVP       ------MTAPSGSTP---------DVDVVVVGAGPSGLTLANILGLQGVATLVVDERDTL
MHPA_MYCSK       MTPATARDATERDAT---------DTDVVIVGAGPVGLTLANILGLQGVRTMIVEERATL
MHPA_MYCSS       MTPATARDATERDAT---------DTDVVIVGAGPVGLTLANILGLQGVRTMIVEERATL
MHPA_MYCSJ       MTP-----ATERDDT---------DTDVVIVGAGPVGLTLANILGLQGVRTMIVEERATL
MHPA_BURCA       ------MKANNRNR-----------TSVAIVGAGPNGAAMANLLGLYGVDTIVVERAPQI
MHPA_BURCH       ------MKANNRNR-----------TSVAIVGAGPNGAAMANLLGLYGVDTIVVERAPQI
MHPA2_BURVG      ------MKADNRNR-----------TSVAIVGAGPNGAALANLLGLYGVDTVVVERAPQI
                                          ..* : **** *  :** **  *: . :::.   :

MHPA_ECOLI       IDYPRAIGIDDEALRTMQSVGLVDDVLPHTTPWHAMRFLTPKGRCFADIQPMTDEFGWPR
MHPA_ECO57       IDYPRAIGIDDEALRTMQSVGLVDNVLPHTTPWHAMRFLTPKGRCFADIQPMTDEFGWPR
MHPA_ECO24       IDYPRAIGIDDEALRTMQSVGLVENVLPHTTPWHAMRFLTPKGRCFADIQPMTDEFGWPR
MHPA_ECOHS       IDYPRAIGIDDEALRTMQSVGLVENVLPHTTPWHAMRFLTPKGRCFADIQPMTDEFGWPR
MHPA_SHISS       IDYPRAIGIDDEALRTMQSVGLVENVLPHTTPWHAMRFLTPKGRCFADIQPMTDEFGWPR
MHPA_KLEP7       IDYPRAIGIDDESLRAMQAVGLVNDVLPHTTPWHAMRFLTPKGRCFADIQPMTDEFGWSR
MHPA_PARXL       IDYPRAIGLDDEALRVFQSVGLADVLLPHTTPDHWMRFVTHTGHCFASIEPRTDEFGWSR
MHPA_CUPPJ       IDYPRAIGLDDEALRVFQAIGLADTLLPHTTPDHWMRFVTKDGHCFASIEPRTDEFGWSR
MHPA1_BURVG      IDYPRAIGLDDEALRVFQSVGLAEALLPHTTPNHWMRF-TLNGKCFASIEPRTDEFGWPR
MHPA_MYCA1       IDYPRGVGLDDEALRTFQSIGLVERVLPHTVPNQILRFMDAKRRVLAEMAPPDARFGWPK
MHPA_MYCPA       IDYPRGVGLDDEALRTFQSIGLVERVLPHTVPNQILRFMDAKRRVLAEMAPPDARFGWPK
MHPA_MYCS2       IDYPRGVGLDDESLRTFQSIGLVDAILPHTVPNQILRFYDANRRLLAEMAPPDARFGWPK
MHPA_MYCGI       IDYPRGVGLDDESLRTFQAIGLVDRVLPHTVPNQILRFFDAKRNLLAEMAPPDARFGWPK
MHPA_MYCVP       IDYPRGVGLDDESLRTFQAIGLVERVLPHTVPNQILRFFDADRRLLAEMAPPDARFGWPK
MHPA_MYCSK       IDYPRGVGLDDEALRTFQAIGLVDKVLPHTVPNQILRFFDGNRRLLAEMAPPDARFGWPK
MHPA_MYCSS       IDYPRGVGLDDEALRTFQAIGLVDKVLPHTVPNQILRFFDGNRRLLAEMAPPDARFGWPK
MHPA_MYCSJ       IDYPRGVGLDDEALRTFQAIGLVDKVLPHTVPNQILRFFDGNRRLLAEMAPPDARFGWPK
MHPA_BURCA       VEFPRAVGIDDEALRLFQTAGLADELSRDIIQNVPLRMFKANGECFADIRPSIREFGWWR
MHPA_BURCH       VEFPRAVGIDDEALRLFQTAGLADELSRDIIQNVPLRMFKANGECFADIRPSIREFGWWR
MHPA2_BURVG      VDFPRAVGIDDEALRLFQTAGVADELSRDIIQNVPLRMFNARGECFADVRPSVREFGWWR
                 :::**.:*:***:** :*: *:.: :  .      :*:     . :*.: *   .*** :

MHPA_ECOLI       RNAFIQPQVDAVMLEGVSRFPNVRCLFSRELEAFSQQDDEVTLHLKTAE---------GQ
MHPA_ECO57       RNAFIQPQVDAVMLEGVSRFPNVRCLFSRELEAFSQQDDEVTLHLKTAE---------GL
MHPA_ECO24       RNAFIQPQVDAVMLEGLSRFPNVRCLFARELEAFSQQNDEVTLHLKTAE---------GQ
MHPA_ECOHS       RNAFIQPQVDAVMLEGLSRFPNVRCLFARELEAFSQQNDEVTLHLKTAE---------GQ
MHPA_SHISS       RNAFIQPQVDAVMLEGLSRFPNVRCLFSRELEAFSQQDDEVTLHLKTAE---------GQ
MHPA_KLEP7       RNAFIQPQVDAVMYHGLQRFPQVRCLFSREVGAFSQTGDSVTLNLKGPD---------GE
MHPA_PARXL       RNAFIQPLADRVLYEGLRRFPHVQVLFGTSVSGFTQDPAGVTIEADDEK---------GG
MHPA_CUPPJ       RNAFIQPLADRVLFEGLQRFEHVQVLFGHGVEAFTQDGHGVSVEVTTSA---------GR
MHPA1_BURVG      RNAFIQPLADQILYRGLERFDHVSTLLGHNVDRFAQDESGVTIDATDAH---------GV
MHPA_MYCA1       RNGFVQPLVDAELLAGLDRFAHVQVRWGSPMTGCREDADGVNVELGADGGNVGDGGGDGH
MHPA_MYCPA       RNGFVQPLVDAELLAGLDRFAHVQVRWGSPMTGCREDADGVNVELGADGGNVGDGGGDGH
MHPA_MYCS2       RNGFVQPMVDAELLAGLDRFDHVEVMWGRRMQTIAEDADGVTVEVSGPDG----------
MHPA_MYCGI       RNGFVQPMVDAELFGGLQRFDNVEVRFGHRMHQCTQTTDRVEVEFD------------GG
MHPA_MYCVP       RNGFVQPLVDAELFGGLERFDHVEVRFDHRMQSCSETAGGVTVTFD------------GD
MHPA_MYCSK       RNGFVQPMVDAELHAGLARFPHVEVRWGHRMAECEETADGVTVRLD------------GD
MHPA_MYCSS       RNGFVQPMVDAELHAGLARFPHVEVRWGHRMAECEETADGVTVRLD------------GD
MHPA_MYCSJ       RNGFVQPMVDAELHAGLARFPHVEVRWGHRMAECEETADGVTVRLD------------GD
MHPA_BURCA       RNIFMQHLAERTLRDALARYPHVSLRTGEEVVGLEQDDECVTLQVRAAD---------GQ
MHPA_BURCH       RNIFMQHLAERTLRDALARYPHVSLRTGEEVVGLEQDDECVTLQVRAAD---------GQ
MHPA2_BURVG      RNIFMQHLAERTLRDALARYPHVSLRTGEEVVGLEQDDAHVTLRVQGAD---------GQ
                 ** *:*  .:  :  .: *: :*       :    :    * :                 

MHPA_ECOLI       REIVKAQWLVACDGGASFVRRTLNVPFEGKTAPNQWIVVDIANDPLSTPHIYLCCDPVRP
MHPA_ECO57       REIVKAQWLVACDGGASFVRRTLNVPFEGKTAPNQWIVVDIANDPLSTPHIYLCCDPVRP
MHPA_ECO24       RETVKAQWLVACDGGASFVRRTLNVPFEGKTAPNQWIVVDIANDPLSTPHIYLCCDPVRP
MHPA_ECOHS       RETVKAQWLVACDGGASFVRRTLNVPFEGKTAPNQWIVVDIANDPLSTPHIYLCCDPVRP
MHPA_SHISS       RETIKAQWLVACDGGASFVRRTLNVPFEGKTAPNQWIVVDIANDPLSTPHIYLCCDPVRP
MHPA_KLEP7       RETVRADWLVACDGGASFIRRTLNIPFEGKTAPNQWIVIDIANDPLATPHVYLCCDPVRP
MHPA_PARXL       RRTVRASYMVGADGGNSFVRRLLDVPFEGRTKPNQWIVVDVRNDPIGSPHIYMHCDPQRP
MHPA_CUPPJ       RRTIRAAYMVGADGGNSIVRRALQVPFEGRTKPNQWIVVDVRNDPVGSPHIYMHCDHERP
MHPA1_BURVG      RTTIRAAYMVGADGGNSFVRRTLDVPFEGRTKPNQWIVIDVRNDPIGSPHVYLHCDARRP
MHPA_MYCA1       PAGLRARYVVGCDGGRSMTRRVMGVSFDGTTSSTRWLVVDIANDPLGHPNSEVGADPERP
MHPA_MYCPA       PARLRARYVVGCDGGRSMTRRVMGVSFDGTTSSTRWLVVDIANDPLGHPNSEVGADPERP
MHPA_MYCS2       PASVHAQYVVGCDGGRSATRHLMGVSFDGTTSSTRWVVIDLANDPLGHPNSEVGADPQRP
MHPA_MYCGI       QASVSARYVVGCDGGRSVTRRLMGVSFDGTTSSTRWLVVDIANDPLGHPNSEVGADPRRP
MHPA_MYCVP       RDPVRARYVVGCDGGRSTTRRQMGVSFDGTTSSTRWLVVDVANDPLGHPNSEVGADPARP
MHPA_MYCSK       PTPVRARYLVGCDGGRSATRRLMGVSFDGTTSPTRWLVVDIANDPLGHPNSEVGADPARP
MHPA_MYCSS       PTPVRARYLVGCDGGRSATRRLMGVSFDGTTSPTRWLVVDIANDPLGHPNSEVGADPARP
MHPA_MYCSJ       PTPVRARYLVGCDGGRSATRRLMGVSFDGTTSPTRWLVVDIANDPLGHPNSEVGADPARP
MHPA_BURCA       QYELDADYVVAADGGRSPVREMLGIRLAGTTHPMKWVVVDVKNARLDQPCTALNCDPRRP
MHPA_BURCH       QYELDADYVVAADGGRSPVREMLGIRLAGTTHPMKWVVVDVKNARLDQPCTALNCDPRRP
MHPA2_BURVG      HYALDADYVVAADGGRSPLREMLGIPLAGTTHPMKWVVVDVKNAGLDQPCTALNCDPRRP
                    : * ::*..*** *  *. : : : * * . :*:*:*: *  :  *   : .*  **

MHPA_ECOLI       YVSAALPHAVRRFEFMVMPGETEEQLREPQNMRKLLSKVLPNPDNVELIRQRVYTHNARL
MHPA_ECO57       YVSAALPHAVRRFEFMVMPGETEEQLREPQNMRKLLSKVLPNPDNVELIRQRVYTHNARL
MHPA_ECO24       YVSAALPHAVRRFEFMVMPGETEEQLREPQNMRKLLSKVLPNPDNVELIRQRVYTHNARL
MHPA_ECOHS       YVSAALPHAVRRFEFMVMPGETEEQLREPQNMRKLLSKVLPNPDNVELIRQRVYTHNARL
MHPA_SHISS       YVSAALPHAVRRFEFMVMPGETEEQLREPQNMRKLLSKVLPNPDNVELIRQRVYTHNARL
MHPA_KLEP7       YVSAALPHGVRRFEFMVMPGETEAQLSEPHNMRRLLSKVLPDPDRVELIRQRVYTHNARL
MHPA_PARXL       YVSAALPHGIRRFEFMVMPGETEEELSKPENMAALIRKVVADPQKVDYIRKRVYTHNARL
MHPA_CUPPJ       YVSAALPHGIRRFEFMVMPGETEEELSKPENMAALIRKVVADPDKVDYIRKRVYTHNARL
MHPA1_BURVG      YVSAALPHGIRRFEFMVMPGETEEELSKPENMAALVRGVVDDPDKVDYIRQRVYTHNARL
MHPA_MYCA1       YASISIAHGIRRFEFMIHADESDEQAEDPEFLTRMLARMVPHPDRVDVIRRRVYTHHSRI
MHPA_MYCPA       YASISIAHGIRRFEFMIHADESDEQAEDPEFLTRMLARMVPHPDRVDVIRRRVYTHHSRI
MHPA_MYCS2       YASISIAHGIRRFEFMIHADETDEQAEDPEFVAELLRPFVPHPDRVDVIRRRVYTHHSRI
MHPA_MYCGI       YVSIAIAHGIRRFEFMIHPDETDEEADDPAFVRRMLGQLIPYPERVDMIRHRVYTHHSRI
MHPA_MYCVP       YVSISIAHGIRRFEFMIHPDETDEQADDPAFVRRMLGQRVPYPERVDIIRHRVYTHHSRI
MHPA_MYCSK       YASISIAHGIRRFEFMIHADETDEQAEDPAFIHRMLGLLVPHPERVEVIRHRVYTHHSRI
MHPA_MYCSS       YASISIAHGIRRFEFMIHADETDEQAEDPAFIHRMLGLLVPHPERVEVIRHRVYTHHSRI
MHPA_MYCSJ       YASISIAHGIRRFEFMIHADETDEQAEDPAFIHRMLGLLVPHPERVEVIRHRVYTHHSRI
MHPA_BURCA       NVCIYLPFNYRRWEFLVFPHEDEEAIAQPESIRALIAPYVDDVDRIEIVRARTYTHHSRV
MHPA_BURCH       NVCIYLPFNYRRWEFLVFPHEDEEAIAQPESIRALIAPYVDDVDRIEIVRARTYTHHSRV
MHPA2_BURVG      NVCIYLPFNYRRWEFLVFPHEDEQAIAQPESIRALIAPYVEDVERLEIVRARTYTHHSRV
                  ..  :..  **:**:: . * :    .*  :  ::   :   :.:: :* *.***::*:

MHPA_ECOLI       AQRFRIDRVLLAGDAAHIMPVWQGQGYNSGMRDAFNLAWKLALVIQGKARDALLDTYQQE
MHPA_ECO57       AQRFRIDRVLLAGDAAHIMPVWQGQGYNSGMRDAFNLAWKLALVIQGKARDALLDTYQQE
MHPA_ECO24       AQRFRIDRVLLAGDAAHIMPVWQGQGYNSGMRDAFNLAWKLALVIQGKARDALLDTYQQE
MHPA_ECOHS       AQRFRIDRVLLAGDAAHIMPVWQGQGYNSGMRDAFNLAWKLALVIQGKARDALLDTYQQE
MHPA_SHISS       AQRFRIDRVLLAGDAAHIMPVWQGQGYNSGMRDAFNLAWKLALVIQGKARDALLDTYQQE
MHPA_KLEP7       AERFRINRVLLAGDAAHIMPVWQGQGYNSGMRDAFNLAWKLALVVNGKAGEALLDSYQQE
MHPA_PARXL       ASTFRVDRVLLAGDAAHIMPVWQGQGYNSGIRDASNLGWKLAMVVKQLAGDALLDTYTAE
MHPA_CUPPJ       ASTFRVDRVLLAGDAAHIMPVWQGQGYNSGIRDANNLGWKLAMVAKGLADGRLLDTYTAE
MHPA1_BURVG      ASVFRVKRILLAGDAAHIMPVWQGQGYNSGIRDASNLGWKLAMVVKGTARDALLDTYTME
MHPA_MYCA1       AGEFRRGRLLLAGDAAHLMPVWQGQGYNSGIRDAANLGWKLAAVVSGRAGDKLLDTYDME
MHPA_MYCPA       AGEFRRGRLLLAGDAAHLMPVWQGQGYNSGIRDAANLGWKLAAVVSGRAGDKLLDTYDME
MHPA_MYCS2       AGSFRKGRMLLAGDAAHLMPVWQGQGYNSGIRDAFNLGWKLAAVVRGQAGDALLDTYDAE
MHPA_MYCGI       AGSFREGRLMLAGDAAHLMPVWQGQGYNSGIRDAANLGWKLAAVVTGRAGEELLDTYDVE
MHPA_MYCVP       AGSFRKGRLMLAGDAAHLMPVWQGQGYNSGIRDAANLGWKLAAVVNGQADDALLDTYDLE
MHPA_MYCSK       AGAFRKGRMFLAGDAAHLMPVWQGQGYNSGIRDAANLGWKLAAVVDGRAGDALLDTYDVE
MHPA_MYCSS       AGAFRKGRMFLAGDAAHLMPVWQGQGYNSGIRDAANLGWKLAAVVDGRAGDALLDTYDVE
MHPA_MYCSJ       AGAFRKGRMFLAGDAAHLMPVWQGQGYNSGIRDAANLGWKLAAVVDGRAGDALLDTYDVE
MHPA_BURCA       AERFVAGRVALIGDAAHLSPPWIGQGLNAGLRDVGNLAWKLAGVVNGTLHRRVISTYESE
MHPA_BURCH       AERFVAGRVALIGDAAHLSPPWIGQGLNAGLRDVGNLAWKLAGVVNGTLHRRVISTYESE
MHPA2_BURVG      AERFVAGRIALVGDAAHLSPPWIGQGLNAGLRDVGNLAWKLAGIVHGRLNPGVLATYESE
                 *  *   *: * *****: * * *** *:*:**. **.**** :        :: :*  *

MHPA_ECOLI       RRDHAKAMIDLSVTAGNVLAPPKRWQGTLRDGVSWLLNYLPPVKRYFLEMRFKPMPQYYG
MHPA_ECO57       RRDHAKAMIDLSVTAGNVLAPPKRWQGTLRDGVSWLLNYLPPVKRYFLEMRFKPMPQYYG
MHPA_ECO24       RRDHAKAMIDLSVTAGNVLAPPKRWQGTLRDGVSWLLNYLPPVKRYFLEMRFKPMPQYYG
MHPA_ECOHS       RRDHAKAMIDLSVTAGNVLAPPKRWQGTLRDGVSWLLNYLPPVKRYFLEMRFKPMPQYYG
MHPA_SHISS       RRDHAKAMIDLSVTAGNVLAPPKRWQGTLRDGVSWLLNYLPPVKRYFLEMRFKPMPQYYG
MHPA_KLEP7       RRDHAKAMIDLSVTAGHVLAPPKRWQGAVRDGLSWLLNYLPPVKRYFLEMRFKPMPQYRE
MHPA_PARXL       RRAHARSMIHLSEVAGDIFAPTSRFGIKFRDAFVRTFNVVPAMKRYFVEMRFKPMPRYET
MHPA_CUPPJ       RRAHARSMIHLSEVAGDIFAPNTRFGVRFRDAFVRSFNVLPAVKRYFIEMRFKPMPRYEE
MHPA1_BURVG      RRAHARSMIHLSEVAGDIFAPTSFVGTRVRDAFVRCFDVLPSLKRYFVEMRFKPMPRYED
MHPA_MYCA1       RRKHARAMIDLSTMVGRVISPTNRRVAGARDLLVRSASIVPTLKRYVLEMRFKPMPRYEH
MHPA_MYCPA       RRKHARAMIDLSTMVGRVISPTNRRVAGARDLLVRSASIVPTLKRYVLEMRFKPMPRYEQ
MHPA_MYCS2       RRKHARAMIDLSTMVGRVISPTNRKVAALRDKLIRGASIVPTLKRYVLEMRFKPMPRYHE
MHPA_MYCGI       RRKHARAMIDLSTMVGRVISPTNRKVAALRDRVIHAASAVPSLKRYVLEMRFKPMPRYQQ
MHPA_MYCVP       RRKHARAMIDLSTMVGKVISPTNRGLAALRDRVIHAASVVPTLKRYILEMRFKPMPRYQQ
MHPA_MYCSK       RRKHARAMIDLSTMVGRVISPTNRRVAAVRDKLIRGASVVPTLKRYVLEMRFKPMPRYEQ
MHPA_MYCSS       RRKHARAMIDLSTMVGRVISPTNRRVAAVRDKLIRGASVVPTLKRYVLEMRFKPMPRYEQ
MHPA_MYCSJ       RRKHARAMIDLSTMVGRVISPTNRHVAAVRDKLIRGASVVPTLKRYVLEMRFKPMPRYEQ
MHPA_BURCA       RRDHAKAMIDLADTFGAMLMPTSRLVAFLRDRFLGLARYAPGLKDYVLQMRFKPMPSYTH
MHPA_BURCH       RRDHAKAMIDLADTFGAMLMPTSRLVAFLRDRFLGLARYAPGLKDYVLQMRFKPMPSYTH
MHPA2_BURVG      RRAHAKAMIDLADTFGAMLMPTSRPVAFLRDRLLAAARFAPGLKDYVLQMRFKPMPSYTR
                 ** **::**.*:   * :: * .      ** .       * :* *.::******* *  

MHPA_ECOLI       GALMR-------------------------------------------EGEAKHSPVGKM
MHPA_ECO57       GALVR-------------------------------------------EGEAKHSPVGKM
MHPA_ECO24       GALMR-------------------------------------------EGEAKHSPVGKM
MHPA_ECOHS       GALMR-------------------------------------------EGEAKHSPVGKM
MHPA_SHISS       GALVR-------------------------------------------EGEAKHSPVGKM
MHPA_KLEP7       GALLT-------------------------------------------DGAGKTSPVGKM
MHPA_PARXL       GVVLLAERKRKHGVMARVLERSGHSAPGRLLGLMSEKRESLLGRLVYGRDPSCHSPVGRM
MHPA_CUPPJ       GVVLLPPPQHRGGWLARMLERAGNSAPGRLLGLMSEKRESFLGRLVYGKDPLAGSPVGRM
MHPA1_BURVG      GVVLLARRARSEGMLARLIASRGHGAFGRLVGLMSEKRESLLGRIVHGRDAQAGTPVGRM
MHPA_MYCA1       GAVVHA------------------------------------------NPGRADSPVGTL
MHPA_MYCPA       GAVVHA------------------------------------------NPGRADSPVGTL
MHPA_MYCS2       GAVYHA------------------------------------------KPPTPASPVGTL
MHPA_MYCGI       GAVLHH------------------------------------------AHAAPNSPTGTL
MHPA_MYCVP       GAVYHD------------------------------------------AQPSPTSPTGTL
MHPA_MYCSK       GAVFHP------------------------------------------EAPSPTSPAGTL
MHPA_MYCSS       GAVFHP------------------------------------------EAPSPTSPAGTL
MHPA_MYCSJ       GAVFHP------------------------------------------EAPSPTSPAGTL
MHPA_BURCA       GVVVTG-------------------------------------------TSDA---VGRM
MHPA_BURCH       GVVVTG-------------------------------------------TSDA---VGRM
MHPA2_BURVG      GVVVTG-------------------------------------------ASDASGAIGRM
                 *.:                                                      * :

MHPA_ECOLI       FIQPKVTLENGDVTLLDNAIGANFAVIGWGCNPLWGMSDEQIQQWRALGTRFIQVVPEVQ
MHPA_ECO57       FIQPKVTLENGDVTLLDNAIGANFAVIGWGCNPLWGMSDEQIQQWRALSTRFIQVVPEVQ
MHPA_ECO24       FIQPKVTLENGDVTLLDNAIGANFAVIGWGCNPLWGMSDEQIQQWRALGTRFIQVVPEVQ
MHPA_ECOHS       FIQPKVTLENGDVTLLDNAIGANFAVIGWGCNPLWGMSDEQIQQWRALGTRFIQVVPEVQ
MHPA_SHISS       FIQPKVTLENGDVTLLDNAIGANFAVIGWGCNPLWGMSDEQIQQWRALGTRFIQVVPEVQ
MHPA_KLEP7       FIQPQVTLESGESVLLDEVIGANFAIIGWGCNPQWGLNAGQIARWRAIGVRFIQVVPEVQ
MHPA_PARXL       FIQPRVRTAEGSVVRLDDVLGSRFAIIGWGSDPTFGLSPLARETWQRLGGCFVLAKPDNQ
MHPA_CUPPJ       FIQPRVRTADDRLALLDDAIGNGFAVIGWGTNPTFGLTPQARALAEKAGMRFVLAKPDVQ
MHPA1_BURVG      YIQPRVRVADGSIVRLDDAIGNRFAILSWGTDPTFGLTPEARRIWSALGGCFVLAKPDPQ
MHPA_MYCA1       FIQPRVDTRDQQDVLLDDVLGPWFAVLCWNNNPRKILGETAFANWKALGARFFALRPATQ
MHPA_MYCPA       FIQPRVDTRDQQDVLLDDVLGPWFAVLCWNNNPRKILGETAFANWKALGARFFALRPATQ
MHPA_MYCS2       FIQPRVDTREQDNVLLDDVLGTGFAVLCWNNNPRTLLGEAAFTRWKALGATFIAARPSTQ
MHPA_MYCGI       FIQPRVDTRDTQNALLDDVLGTGFAVVCWSNNLRAVLGEEAFGRWKALGAKFVEVRPMSQ
MHPA_MYCVP       FIQPRVDTREEFNVLLDDVLGPGFAVVCWSNNLRAVLGDEAFDRWKGLGARFVEARPMTQ
MHPA_MYCSK       FIQPRVDTRDAQNVLLDEVLGTGFAVLCWNNNPRALLGADLFDRWKALGARFVAARPLTQ
MHPA_MYCSS       FIQPRVDTRDAQNVLLDEVLGTGFAVLCWNNNPRALLGADLFDRWKALGARFVAARPLTQ
MHPA_MYCSJ       FIQPRVDSRDAQNVLLDEVLGTGFAVLCWNNNPRALLGADLFDRWKALGARFVAARPLTQ
MHPA_BURCA       IVQPDVETADGARRKLDDVLGPWFAIIGWRCDPQACLSDDDRAFWTALGAKFVQIVRSRS
MHPA_BURCH       IVQPDVETADGARRKLDDVLGPWFAIIGWRCDPQACLSDDDRAFWTALGAKFVQIVRSRS
MHPA2_BURVG      IVQPDVETADGVRRKLDDVLGPWFSIIGWQCDPQASLSDDERAFWTALGAKFVQIVRSRS
                  :** *   .     **:.:*  *::: *  :    :           .  *.      .

MHPA_ECOLI       IHTAQD---NHDGVLRVGDTQGRLRSWFAQHNASLVVMRPDRFVAATAIPQTLGKTLNKL
MHPA_ECO57       IHTAQD---NHDGVLRVGDTQGRLRSWFAQHNASLVVMRPDRFVAATAIPQTLGKTLNKL
MHPA_ECO24       IHTAQD---NHDGVLRVGDTQGRLRSWFAQHNASLVVMRPDRFVAATAIPQTLGKTLNKL
MHPA_ECOHS       IHTAQD---NHDGVLRVGDTQGRLRSWFAQHNASLVVMRPDRFVAATAIPQTLGKTLNKL
MHPA_SHISS       IHTAQD---NHDGVLHVGDTQGRLRSWFAQHNASLVVMRPDRFVAATAIPQTLGNTLNKL
MHPA_KLEP7       IHREQD---NAPGTLRVGDTQNRLKSWFALHNTAIAVVRPDRFVAALAIPQTLGAQLTAL
MHPA_PARXL       LDFHDD---VPAGVIAIGDVQGRLKEWFARVPESVVLLRPDRFVAGMCTPQQVSDCIGEL
MHPA_CUPPJ       LRHGDD---VPDGVIAIGDASGRLKEWFSRLPQSVVLLRPDRFVAGVCSPQQVSEAITEL
MHPA1_BURVG      LGFRDD---VPEDVIAIGDVDSRLRDWFARVPESVVLLRPDRFVAGMCSPQCVSECVSQL
MHPA_MYCA1       LRWTGH---DDPDVVVVGDRRGDLKSWFDIHAESVLFLRPDRCIAGACIAQRAPDLSAAL
MHPA_MYCPA       LHWTGH---DDPDVVVVGDRRGDLKSWFDTHAESVLFLRPDRCIAGACIAQRAPDLSAAL
MHPA_MYCS2       LHWTKD---DDPDVVIVGDRTGALKAFFDAHTESVLVLRPDRCIAGADIAQRAPELSTAL
MHPA_MYCGI       LRWPGH---DDPDVAVIGDRTGALKAWFDVHTESVLFVRPDRCIAAACIAQRAPEISEGL
MHPA_MYCVP       LHWPGY---DDADVEVVGDRTGALKKWFDVSTDSVLFVRPDRCIAGACIAQRAPEVSTAL
MHPA_MYCSK       LHWTGH---DDPDVTVIGDRTGALKGWFDAHAESVLFLRPDRCIAGACIAQRAPEVSTAL
MHPA_MYCSS       LHWTGH---DDPDVTVIGDRTGALKGWFDAHAESVLFLRPDRCIAGACIAQRAPEVSTAL
MHPA_MYCSJ       LHWTGH---DDPDVTVIGDRTGALKGWFDAHAESVLFLRPDRCIAGACIAQRAPEVSTAL
MHPA_BURCA       GTCREQRIASAHDSVCVEDVDNAMAEWFDRHAAPLVVVRPDRYVAAQTDAAGMAGVTAAF
MHPA_BURCH       GTCREQRIASAHDSVCVEDVDNAMAEWFDRHAAPLVVVRPDRYVAAQTDAAGMAGVTAAF
MHPA2_BURVG      GTCREQRIASAHGSECVEDVDNAMADWFDRHAGPLVVVRPDRYVAAQTDAVGIAGVTAAF
                             .   : *  . :  :*     .: .:**** :*.   .         :

MHPA_ECOLI       ASVMTLTRPD------------ADVSVEKVA----------------------
MHPA_ECO57       ASVMTLTRPD------------ADVSVEKVA----------------------
MHPA_ECO24       ASVMTLTRPD------------ADVSVEKVA----------------------
MHPA_ECOHS       ASVMTLTRPD------------ADVSVEKVA----------------------
MHPA_SHISS       ASVMTLTRPD------------ADVSVEKVA----------------------
MHPA_KLEP7       AEKMTLATGD------------TAHAEEKVA----------------------
MHPA_PARXL       ALKLSLKPAE------------QPAVKLAVPERAVAPESVAGVAAVAAVATRA
MHPA_CUPPJ       AGKLGMTEV-------------PPYAEASTPSKTSRPVLDPVTVTQAAGA---
MHPA1_BURVG      AQRLSLSVAT------------GAQADDATFAPAAGLVGA-------------
MHPA_MYCA1       FDALTLTPRG----GDPQSG---TGSVLYVAQPAPESSGAVAGPA--------
MHPA_MYCPA       FDALTLTPRG----GDPQSG---TGSVLYVAQPAPESSGAVAGPA--------
MHPA_MYCS2       FGILHLR-QG----GE-NGA---TGPVLYVPQPTAESSGTVGRAS--------
MHPA_MYCGI       FAALHLTSGAHLTQGGGTDGEKPDRAVLHVAQPAAESSGTGAGTS--------
MHPA_MYCVP       FAVLHLTREG----GAGSHGEKSDGTVLHVAQSAAEPSGTSAGTP--------
MHPA_MYCSK       FGVLHLTQGG----GNGHHG--ADRPVLHVAQSATEPSGTVAGTP--------
MHPA_MYCSS       FGVLHLTQGG----GNGHHG--ADRPVLHVAQSATEPSGTVAGTP--------
MHPA_MYCSJ       FGVLHLTQGG----GNGHHG--ADRPVLHVAQSATEPSGTVAGTP--------
MHPA_BURCA       QAFAARQ-----------------RETADVC----------------------
MHPA_BURCH       QAFAARQ-----------------RETADVC----------------------
MHPA2_BURVG      RAFAPQQQ----------------AEAAHVC----------------------
                                              .