CLUSTAL format seed alignment for MF_01658

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

A8NGR8_COPC7          --------MWKTAATRLPR-RLQ---------------------------------ASTV
Q5KIZ4_CRYNJ          MSSIKSDNIRRTVASRLPTYRTL---------------------------------VSHA
COQ7_SCHPO            ---------MLSRRQLIPI-------------------------------------ATKS
COQ7_YEAST            ----MLSRVSVFKPASRGFSVLS----------------------------------SLK
Q75CT1_ASHGO          -----MLPFATNQATKRSFSVLA----------------------------------TLK
A0A1D8PN46_CANAL      ----MLSRTTIYSVRQLSSTSAL----------------------------------LNK
C4QWB1_KOMPG          -----MIRHSRNLIKLQSVRYAS----------------------------------TKG
Q6C5T9_YARLI          -----MARHA--------------------------------------------------
Q4WIG9_ASPFU          --------MNSLSSFRKYFLSRSAQSTSPLMLDFLVPSVLR----------------QSR
C8V7X1_EMENI          --------MKAFAALQRYH-----RPTAPLLLDFLAPSAL-----------------HIR
J3KFX5_COCIM          --------MDVHAALLRHA-RLVRGSVCSQCLRTLQPRVRH----------------SST
C0NZF5_AJECG          --------MDSVPALRMSLSVCRRSVRTPYVVQGWRIQIQHQHPHQQARRNIYPTPATSR
M2V064_COCH5          --------MSFAVHSSRTISRSICRSLQYPVLDFLAPCTST---------------CAPR
G2WW39_VERDV          --------MSCSRCLLRPHLAL-SRPLHHLAR---PSLAASRQ--------------LSS
Q7RZB1_NEUCR          ----------MLRPATRPALVA-TRQVRQCAARFFSSPVSPDT--------------SSS
C7YRD0_FUSV7          --------MASTRTLIRPLCSLGARPVASFYR------PCVRS--------------IAT
D5GPG3_TUBMM          ---MTTRRLTSLLPHLRCQRRSQFPYTGTPS--------------------------SNL
F4P407_BATDJ          ---MRIIHILPKSSAGVAFKRLY----------------------------------STT
COQ7_MOUSE            --------MSAAGAI--------------------------------------AAASVGR
H0VHI5_CAVPO          --------MICAGAA--------------------------------------AAPALWR
COQ7_HUMAN            --------MSCAGAA--------------------------------------AAPRLWR
K7D5U8_PANTR          --------MSCAGAA--------------------------------------AAPCLWR
A0A2I3H0N0_NOMLE      --------MSCAGAA--------------------------------------AAPCLWR
A0A2J8S241_PONAB      --------MSCARAA--------------------------------------AAPCLWQ
F6XXM7_CALJA          --------MSCPGVA--------------------------------------AAPCLWR
G1LWZ2_AILME          --------MSCAAVAV-------------------------------------AVHSRWR
E2RF61_CANLF          --------MSCAARA--------------------------------------AVRSLWR
M3YPM7_MUSPF          --------MGCAAEA--------------------------------------AGRSLWQ
M3WJK9_FELCA          --------MSCAGAA--------------------------------------AVRSLWL
COQ7_BOVIN            --------MSCARAL--------------------------------------AACCLWR
G1SGS8_RABIT          --------MTCAGAA--------------------------------------AARSLWR
I3M379_ICTTR          --------MSCAGAA--------------------------------------AAPSLWR
G3STP5_LOXAF          --------MSCARAA--------------------------------------VARPLWR
G3X113_SARHA          -------MIGCAGAA--------------------------------------AAPPLWR
K7EG75_ORNAN          --------MSSEGAWSVAVHFPS----------------------RRRDGAMGRAGGLGR
H3A8N6_LATCH          -----MEKMALSARCIF------------------------------------GCQGKLS
U3KI02_FICAL          -------MAAAAGPA--------------------------------------VRCSLWQ
A0A669EDW8_ORENI      --------MQTAALR-------------------------------------VFCHWSQ-
A0A087XVU4_POEFO      --------MHRAAHT-------------------------------------AFCDWPQ-
G3Q652_GASAC          --------MHGALRA-------------------------------------ALRDWST-
Q4S7R6_TETNG          --------MQMAAHA-------------------------------------GAH-----
W5KBK8_ASTMX          --------MQRAQLC-------------------------------------ALRSGFLR
F1QW05_DANRE          --------MQTAGKC-------------------------------------AVRLDLSR
F7DI76_XENTR          --------MARVVGI-------------------------------------SFRTLGL-
G4VRU9_SCHMA          --------MARSVSP---------------------------------------------
H2YVI5_CIOSA          --------MNLCKSL--------------------------------------------Q
F7AYB2_CIOIN          --------MALFKLS--------------------------------------------R
A8XZN1_CAEBR          ----------------------------------------------------MNVFEVKN
A0A2H2HVF8_CAEJA      ------------------------------------------------------------
COQ7_CAEEL            ------------------------------------------------------------
B3RUQ6_TRIAD          ------------------------------------------------------------
E9FV04_DAPPU          --------MTYRPQK---------------------------------------------
W5JEX7_ANODA          --------MLHIT------------------------------------------RQLHT
Q7PRZ9_ANOGA          --------MLQIT------------------------------------------RGVHT
Q7Q596_ANOGA          --------MLQLTI-----------------------------------------RSIHT
Q1HQL9_AEDAE          --------MQRVLS-----------------------------------------RSLHL
Q9W3W4_DROME          --------MNGMLR-----------------------------------------RGLSR
Q29IL9_DROPS          --------MAPMLR-----------------------------------------SVLFR
A0A087ZZV1_APIME      --------MLHLRQ-----------------------------------------YGI--
COQ7_DICDI            --------MNSLIKS-----------------------------------------TKFL
F0ZWR6_DICPU          ----------MISRS-----------------------------------------IRQL
A4I4U9_LEIIN          ---------------------------------------------------------MKS
A4HHN4_LEIBR          ---------------------------------------------------------MRS
Q582P6_TRYB2          --------------------------------------------------------MLRR
Q4CPK7_TRYCC          --------------------------------------------------------MMRR
COQ7_ACIAC            -----------------------------------------------------MDKLLIA
COQ7_ACISJ            -----------------------------------------------------MDTLLVA
COQ7_DELAS            -----------------------------------------------------MDKILTA
COQ7_VEREI            --------------------------------------------------MSPADSLLAA
COQ7_POLNA            -------------------------------------------------MTTALDLALNA
COQ7_POLSJ            -------------------------------------------------MTPALDTALNA
COQ7_RHOFT            ------------------------------------------------MPNTLQDRFFTT
COQ7_VARPS            -------------------------------------------------MTSTLDPVLTA
COQ7_METPP            -----------------------------------------------MRSLSRTDQVISS
COQ7_BURCJ            ---------------------------------------------------MVLDELISE
COQ7_BURPS            ---------------------------------------------------MVFDELITE
COQ7_PARXL            ---------------------------------------------------MFLDELISE
COQ7_CUPNH            -----------------------------------------------------MDTLIKE
COQ7_CUPMC            -----------------------------------------------------MDTLIRE
COQ7_RALPJ            ----------------------------------------------------MLDRFIPE
COQ7_RALSO            ----------------------------------------------------MLDRFLPE
COQ7_POLNS            --------------------------------------------------MSPIDRLILE
COQ7_POLAQ            --------------------------------------------------MSLIDRFIAE
COQ7_HERAR            -----------------------------------------------MEYISPFDRFIRH
COQ7_AZOSB            ----------------------------------------------------MFDKAIIE
COQ7_AROAE            ----------------------------------------------------MIDEAIVQ
COQ7_DECAR            ---------------------------------------------------MSPDQLVVE
COQ7_CHRVO            ----------------------------------------------------MLDKLITE
COQ7_LARHH            ----------------------------------------------------MLDKLIIE
COQ7_NITEU            --------------------------------------------------MLNIDKLIIG
COQ7_NITMU            --------------------------------------------------MPNLDKLIIG
COQ7_THIDA            --------------------------------------------------MNRLDQLIST
COQ7_BORPE            -------------------------------------MSTSSSASALGRRAGPLDGLIGE
COQ7_BORPD            ----------------------------------MSVASTSSGFTPFSRRRGPLDPLFAE
COQ7_BORA1            ------------------------------------------MNYASPRHAGPLDALLIE
COQ7_XANCP            -----------------------------------------MTQIPPSRLHSPLDRLLVE
COQ7_XYLFA            -----------------------------------------MDVILSTRHHSHLDSLLIE
COQ7_AZOVD            --------------------------------------------MANERHYSATDRLLLQ
COQ7_PSEU5            --------------------------------------------MPSQRHYSPADRLLMQ
COQ7_PSEAE            --------------------------------------------MSADRHYSPIDRFLLQ
COQ7_PSEMY            --------------------------------------------MASERQYSPVDRLLLQ
COQ7_PSEF5            --------------------------------------------MTTQRHYSPIDRLLLQ
COQ7_PSEFS            --------------------------------------------MTTQRHYSPIDRLLLQ
COQ7_PSEPK            --------------------------------------------MATERHYSPLDRLLLQ
COQ7_PSESM            --------------------------------------------MATERQYSPIDRLLLQ
COQ7_MARMS            -------------------------------------------------MISFLDKAVLQ
COQ7_SACD2            -----------------------------------------MTHAAASRNLSFIDKLVGE
COQ7_CHRSD            ----------------------------------------------MSRQLSRTDNLIHQ
COQ7_ACIAD            -----------------------------------------------MRHYTGIDRLINS
COQ7_ALCBS            ---------------------------------------------MTERRLSPLDKLLAR
COQ7_LEGPH            -----------------------------------------------MRTSSFLDRLIGE
COQ7_NITOC            ---------------------------------------------MEGRRLSQLDRVIIN
COQ7_COXBU            -------------------------------------------MSNNSRHYSAIDEAILQ
COQ7_FRATT            -----------------------------------------------MRKLSFLDRVIEE
COQ7_PSYA2            ---------------------------------------------MALRPLSKIDQLLLG
COQ7_PSYWF            ----------------------------------------------MAKNLSIIDRAIVG
                                                                                  

A8NGR8_COPC7          FTRGLASSAYVDPQ-----RAKEPAVSTTPDD-----------ITPEERKTLEAALRVDQ
Q5KIZ4_CRYNJ          YSPPPRSSSFKPPSDSEISQSSIEATTETPGN-----------LTEEQKKLIERIIRVDH
COQ7_SCHPO            VSPFLRSS------------ITCRRISMGRKE-----------LSEKDSNILDSVIRVDQ
COQ7_YEAST            ITEHTSAKHTEKPEHA-----------PKCQN-----------LSDAQAAFLDRVIRVDQ
Q75CT1_ASHGO          TSAAAKAGEGQK-----------------FDA-----------MSDPQLAYLERVVRVDQ
A0A1D8PN46_CANAL      STKPKSKAPKKKSQKE-----------VIYGP-----------LSDAQKAYLDRVIRVDQ
C4QWB1_KOMPG          KE--NSATENLR-----------------LGY-----------LSDAQNAYMDRVIRVDQ
Q6C5T9_YARLI          -------------------------------------------LSKAEASFITKLIRVDQ
Q4WIG9_ASPFU          TRHSSTAASSSPDGAQQSSQNSGAGSSKPTYI-----------LSKKQREYLDSALRVNQ
C8V7X1_EMENI          QYHATPARLAE-------SQSN----SKPKYV-----------LSKEQREFLDSALRVNQ
J3KFX5_COCIM          TSHRTASPAE-----------------KPRMA-----------LTKEQRDFLDSALRVNQ
C0NZF5_AJECG          NVHSSTSNPTQTIASGGDDNPP-----KKRMV-----------LTQAQRDYLDSALRVNQ
M2V064_COCH5          QTLRFSSTASTP------PSPQTTRDGKPIRP-----------LTPEQREFLSSALRVNQ
G2WW39_VERDV          TSTSYATTQTSSPTTPPK-----------LKP-----------LTQEQRDFLSSALRVNQ
Q7RZB1_NEUCR          HVHSPSTTPETNPAPPPPNSRSSTSSSKGKKP-----------LTAEQRAFLSSALRVNQ
C7YRD0_FUSV7          TSNAQASVAAGSAEAPKK-----------RKP-----------LTKEQSDFLDSALRVNQ
D5GPG3_TUBMM          QAHRLASTKAANISETEPS--------SKSRP-----------LTEEEREFLQSAIRVNQ
F4P407_BATDJ          VHSNTGSISHTHLPTS-------------RNP-----------LTVQQKEHVDMMLRVDQ
COQ7_MOUSE            LRTGVRRP--FSEYGRG---LIIRCHSSGMTL-----------D-NINRAAVDRIIRVDH
H0VHI5_CAVPO          LCTGARWP--LSAYAKK---ISIRFCSSRMTL-----------D-NINRAAVDRIIRVDH
COQ7_HUMAN            LRPGARRS--LSAYGRR---TSVRFRSSGMTL-----------D-NISRAAVDRIIRVDH
K7D5U8_PANTR          LRPGARRS--LSAYGRR---ISVRFRSSGMTL-----------D-NINRAAVDRIIRVDH
A0A2I3H0N0_NOMLE      LRPGAQRS--LSAYGRR---ISVRFRSSGMTL-----------D-NINRAALDRIIRVDH
A0A2J8S241_PONAB      LRPGVRRF--LSAYGRR---ISVRFRSSGMTL-----------D-NINRAAVDRIIRVDH
F6XXM7_CALJA          LRQGVQRS--LSARGGR---IGVRFRSSGMTL-----------D-NINWAAVDRIIRVDH
G1LWZ2_AILME          LRAAVLRR--LSAYGRR---ISVRFYSSGMTL-----------D-NINWATVDRIIRVDH
E2RF61_CANLF          LRAGTLRP--LTAYGRR---IGVRFYSSGMTL-----------D-NVNRAAVDRIIRVDH
M3YPM7_MUSPF          LRTGALRP--YSAFGRR---ISVRFSSSGMTL-----------D-SISRAAVDRIIRVDH
M3WJK9_FELCA          LRTGALWP--LPAYGRR---ISVRFYSSGMTL-----------D-NINWAAVDRIIRVDH
COQ7_BOVIN            LRTGALQP--LSAYGRR---ISVRFCSSGMTL-----------D-NINREAVDRIIRVDH
G1SGS8_RABIT          LRAGNQRP--LSACGRR---IGVRFRSSGTTL-----------D-GISRAAVDRIIRVDH
I3M379_ICTTR          LRLGARRP--LSACGSR---VGTRARSSGMTL-----------D-NVNRAALDRIIRVDH
G3STP5_LOXAF          LRTGARRP--LSAYGRK---IGVRFCSSRMTL-----------D-NINWAVVDRIIRVDH
G3X113_SARHA          LSSAARRF--PSGYARN---ASIRFCNTGMTY-----------K-NINHATVDRIIRVDH
K7EG75_ORNAN          LCAGAWRC--PADYGGGGGGRLRRFYSTGMTL-----------E-NVNRATVDRIIRVDH
H3A8N6_LATCH          YLTGTSLT--RKCNGRIGQ-TSYRYCSSRADP-----------D-GQNKALLDRIIRVDH
U3KI02_FICAL          RRSLRCGPGPRPVPGGG---APLRLCSTQAVP-----------QAGINKPVIDRIIRVDH
A0A669EDW8_ORENI      SNSTAMIRQCLKCRALTLQQSS-RAYGVIPPP-----------RDSEEKEMVHRMLRVDH
A0A087XVU4_POEFO      FVRPAMIRQSLKCTG-CLQNSA-RAYSVVPAP-----------RDSKEKEMMHRMLRVDH
G3Q652_GASAC          AAGSTTIRQCLKSRV-PLQRSS-RVYSVVPTP-----------RDSEEKDMLDRILRVDH
Q4S7R6_TETNG          LFGPLLTRQCLRCKA-HLRLRS-CAYSVIPPP-----------LDSEEKRMLDRFLRVDH
W5KBK8_ASTMX          VFYPLNAENTPAVRNRVNSSLLCRKYTVLPPP-----------RDKEEKAMLDSMLRVDH
F1QW05_DANRE          VFCPSSVWNCRAV-NRVNGLVSCRRYSVIPPP-----------RDEQEKAMLDRMLRVDH
F7DI76_XENTR          SSRVFHRRQGEKLQSFHVNITT-VRLCRASNL-----------VDNEEKAVLDRIIRVDH
G4VRU9_SCHMA          ----------------------------------------------KVRALVDRIIRVDH
H2YVI5_CIOSA          LFSPRLS-------------FQISARLNSSNS-----------IDPETKAIYSKFIRVDH
F7AYB2_CIOIN          VIQTR---------------CNLGVRNVSFQS-----------LDPATRKVYSRFIRVDH
A8XZN1_CAEBR          RFFDLFSNFFEFPAKSRSKKKMFRVIVRHAHQ-----------QSAARQALIEKIIRVDH
A0A2H2HVF8_CAEJA      ---------------------MLRVIVRGAHN-----------SSAARQALIEKIIRVDH
COQ7_CAEEL            ---------------------MFRVITRGAH------------TAASRQALIEKIIRVDH
B3RUQ6_TRIAD          --------------------MAFRVTTRLLG------------KKSDYNKLIDRVLRVDH
E9FV04_DAPPU          -IPQLFRQ---------------FATSTKISP-----------KEARENITRDRFLRVDH
W5JEX7_ANODA          GQRMQ-AQRCS--------------------------------------KLIDSVLRVDH
Q7PRZ9_ANOGA          GRELL-AQRCS--------------------------------------KLVDSVIRVDH
Q7Q596_ANOGA          DAKLL-KQRCS--------------------------------------KLVDRIIRVDQ
Q1HQL9_AEDAE          NAALSSAKRCS--------------------------------------ETIDRIIRVDH
Q9W3W4_DROME          PEPRLLSKRYLSSATGGGSAGTTEGGSSETTP-----------LRPRPNALTDEIIRVDH
Q29IL9_DROPS          PEARLLTVRCLSNKN-TASSGSEAGAGN---P-----------LRPRANALTDEIIRVDH
A0A087ZZV1_APIME      ---RLASTSAISGTT-------------------------------KPGKLLDSIIRVDH
COQ7_DICDI            KKTNIIRSYCTKTNNNNN--TNITKNVLSEIE-----------KEKLKRQIIERIIRVDH
F0ZWR6_DICPU          NKSGYLNKSVLNYTTTTN--NGTNEQFVNKSE-----------KERIKREILERIIRVDH
A4I4U9_LEIIN          LFHPSLVA-------------------LGPVF-----------AIPLKQQKIDEVVRVDH
A4HHN4_LEIBR          LFHPSLVV-------------------FGPVF-----------AIPFKQQKIDEVIRVDH
Q582P6_TRYB2          SVVNLQN--------------------PARVF-----------RSAAKRQKLDEAVRVDQ
Q4CPK7_TRYCC          TFPRILGL-------------------PSRTF-----------ANSARKSKIDEVLRVDQ
COQ7_ACIAC            ADNALRTLFARPR-AAQ----PSPARGLPEG-----------DLSPAQRREAGALMRVNH
COQ7_ACISJ            ADSALRTLFARPR-AGE----PSPARSLPAV-----------DLSVEQRRLSSALMRVNH
COQ7_DELAS            ADAALRTLFAQPS-AAE----RSPAAGIAEG-----------ELTEAQRRLSGALMRVNH
COQ7_VEREI            ADNALRTLFAKPG-AAE----KSPADAVAEA-----------ALDPAEKRLAGALMRVNH
COQ7_POLNA            ADGALRTLFAKPR-ASR----TCPTVPAQAT-----------ELSLEDKALSGALMRVNH
COQ7_POLSJ            ADGALRTLFAKPQ-ASR----TCPTVAGQRT-----------ELSTQEKALSGALMRVNH
COQ7_RHOFT            CDAALRTLFVTPH-AER----ACPTLPGEAT-----------ALTDAEKVQSGALMRVNH
COQ7_VARPS            ADAALRTLFARPH-ATR----AAPAPAQAPG-----------EMTDSERREAGALMRVNH
COQ7_METPP            LDKALSTVFAAHS-ASR----PAPKPAVDPGL----------AMTPQDKSLSASLMRVNH
COQ7_BURCJ            FDRGLRSLTGISR-MSR----PVPAPAD----------APDAELTPAERTHAAGLMRVNH
COQ7_BURPS            FDRGLRSIAGVSR-MSR----PVPKPAA----------AAPAELSAAERKHAAGLMRVNH
COQ7_PARXL            FDRGLRSMTGVSR-MSR----PLPVPQESAV------TEAAPELSPAERAHSAGLMRVNH
COQ7_CUPNH            FDVALRAIAGATR-TAR----ANPADRLAPD---------TEQMSADERRHVAGLMRINH
COQ7_CUPMC            FDVALRAIAGATR-AER----ANPADRLAPE---------TEQMNPEERRHVSGLMRINH
COQ7_RALPJ            FDRALRAVAGVTR-ASR----PNPADAVIASAASTNTADNATKLSEADRRHAAGLMRVNH
COQ7_RALSO            FDRALRAVAGITR-ASR----PNPADAIVAP------TDDGAKLSDTERRHAAGLMRVNH
COQ7_POLNS            FDTALRSVVGGAN-AQR----PTPGSEFASN----------SGVDAAERKHAAGLMRVNH
COQ7_POLAQ            FDTALRSVVGGAH-SRR----PTPGSGEISH----------ANLDVAQRKHAAGLMRVNH
COQ7_HERAR            FDSALRVMSGVSA-ASR----PSPASGVADG-----------VLDDAERRHSAGLMRVNH
COQ7_AZOSB            FDKALRTVFAPAR-SVR----PVPG-DDVPD----------APLDDEQKRHAAALMRVNH
COQ7_AROAE            FDKALRTLFAPAR-SVR----PTPG-AGVPE----------THLGDRDRQHVAALMRVNH
COQ7_DECAR            FDRALRTILAPAR-SMR----PLPG-AALPD----------AELPAAQRSHVAGLMRVNH
COQ7_CHRVO            LDKGLRTLCAPAH-SGR----AHPD-QDIAE----------ADLSAAEKKHALGLMRVNH
COQ7_LARHH            FDKGLRTVFAPAQ-TLR----PHPD-TGLEE----------AGLSDLEKRHALGLMRVNH
COQ7_NITEU            FDSALRTLLAPAN-TLR----PVPG-KDLPE----------NELSEIEKRESAALMRINH
COQ7_NITMU            FDHALRTLLTPAQ-TLR----PVPG-TQLPE----------AELNDLEKSESAALMRVNH
COQ7_THIDA            FDLGLRTVFATPH-AGR----PYPG-SPQ-E----------AELSETERAHAAALMRVNH
COQ7_BORPE            IDRALRVLSGAAT-AAR----PYPAQAPEAP----------DALSEREKRHAAGLMRVNH
COQ7_BORPD            VDRALRVLSGAAS-SAR----PYPASAAEPV----------PPLSDQQKRHAAGLMRVNH
COQ7_BORA1            VDRALQVLSRSAV-AGR----AYPAHAAEA------------PLADTEKRHAAGLMRVNH
COQ7_XANCP            AQRALDTVFGNPP-AER----PNPA-GDTPD----------AALAPAQRQHAAGLMRINH
COQ7_XYLFA            TQRVLEVVFGHPV-AQR----PSPA-NAFPN----------PLLSPKDRRHAAGLMRINH
COQ7_AZOVD            ADAALRTLLPFSGKPYR----PSPAQGEPETQ-----------LDAGKARHVAGLMRINH
COQ7_PSEU5            ADAALRTLLPFSGQPSR----PSPALLKTEAE-----------LSESEARHVAGLMRINH
COQ7_PSEAE            ADSALRTLLPFSGQPAR----PSPAIVEPDGE-----------LSEEDTRHIAGLMRINH
COQ7_PSEMY            ADAALRTLLPFSGASSR----PSPAIVQAETD-----------LNPEESRHIAGLMRINH
COQ7_PSEF5            ADMAMRTLLPFSGQPYR----PSPAIVQPEAQ-----------MSDEDTRHVAGLMRINH
COQ7_PSEFS            ADMAMRTLLPFSGQPYR----PSPAIVQPDAQ-----------MSETETRHVAGLMRINH
COQ7_PSEPK            ADTAMRTLLPFSGQPTR----PSPAIVQPDAD-----------LDEQQARHIAGLMRINH
COQ7_PSESM            ADSAMRTLLPSSAHSRR----PSPAIVQPDHK-----------MSDVDTRHVAGLMRINH
COQ7_MARMS            FDRALQTLVPHAAKATR----PSPANTLEEAE-----------LDQVERKHSSGLMRINH
COQ7_SACD2            VDKALRALSPDTKPHSR----PSPK--AECGE-----------LSDAEKRLSASLMRVNH
COQ7_CHRSD            FDTILRTLVPHAATASR----ANPAAGTQDKA-----------MSDAERRHAAGLMRINH
COQ7_ACIAD            FDQALRSLVPGTTAAQR----SNPAE-QTQAP-----------LTVSDARHVAGLMRVNH
COQ7_ALCBS            ADNALRTLTPGTTQAERTPAHAAPAPDAPEAGT----------LPSDQRRHVLGLMRINH
COQ7_LEGPH            VDSALRTLVLPQKRITTR---QSPAENLADTV-----------LSAQEKKHISGLMRVNH
COQ7_NITOC            FDDALRT-VFGQPRTTER---ASPASGIAEGA-----------LSEKERRLSGCLMRVNH
COQ7_COXBU            GQAMLETLFGKPV-AQR----ENPAKGLSQPA-----------LTSAEKKQSIGFMRVNH
COQ7_FRATT            LDSYARFTKVPLN-PSK----KSPSSDTIDGK-----------LSEIEKKHSAGLMRVDY
COQ7_PSYA2            VDKALRAVVPHSNPSTR----PLPVSSDEIPE-----------LSITESRHVAGLMRINH
COQ7_PSYWF            FDSSLRAIIPHSNQTAR----PLPVSSDALPQ-----------LSITESRHVAGLMRINH
                                                                             : :: 

A8NGR8_COPC7          AGEIAANWIYRGQYAVLGR--DRKTGELIQ-DMWDQEKKHLVVMDKLQLQHNVRPTLLTD
Q5KIZ4_CRYNJ          AGELGANWIYRGQKWAMDVKGDNKTARQVE-EMWENERHHLKTLSLLSAQHRARPTLLYP
COQ7_SCHPO            AGELGANQIYKGQHFILQFT-DPKVAPTIQ-HMWDQEKYHLATFDNYVLKNRVRPTFLRP
COQ7_YEAST            AGELGADYIYAGQYFVLAHR-YPHLKPVLK-HIWDQEIHHHNTFNNLQLKRRVRPSLLTP
Q75CT1_ASHGO          AGELGANYIYAGQFFVLANK-HPHLKPVLQ-HMWDQEIHHHDTFNDLQLRRRVRPSLLTP
A0A1D8PN46_CANAL      AGELGANYIYMGQYAVLASK-YPHLKPVLH-HMWEQEIHHHNTFNKLQTKRRVRPSLLTP
C4QWB1_KOMPG          AGELGANFIYNGQYLALSHK-RPDLKPILK-HMWEQEIHHHNTFNNLQVERRVRPSLLTP
Q6C5T9_YARLI          AGELGADLIYRGQYMVLSRT-KPEIEPLIK-HMWEQEQHHRRTFNELQQKYRVRPSLLTP
Q4WIG9_ASPFU          AGELAATLIYAAQTPQVVRS-HPHLRPLMK-HMYDQEVGHFSTFNKLIAKHRIRPTVMYP
C8V7X1_EMENI          AGELAATLIYTAQTPQVVRS-HPHLRPLMK-HMYDQEAGHLRTFNQMIAKHRVRPTAMYP
J3KFX5_COCIM          AGELAATLIYTAQSPPVVRS-HPHLRPLMK-HMYDQEAGHFDTFNKLIAKHRVRPTVMYP
C0NZF5_AJECG          AGELAATLIYAAQTPLVTRS-NPNLRPLMK-HMYDQEAGHFTTFNNLVAKHRVRPTAMYP
M2V064_COCH5          TGELAAILIYAAQSPVITRS-HPHLRPLMK-HMYDQEAGHYKYFNDVISKHRIRPTAMTP
G2WW39_VERDV          AGELAATLIYTAQTPPIVTR-HPHLRPLMK-HMYDQEAGHLQTFNALLAKHRVRPTALYP
Q7RZB1_NEUCR          AGELAATLIYTGQTPPLVTR-DPSLRPLMK-HMYDQEAAHLRTFNDLIYRHRVRPTALYP
C7YRD0_FUSV7          AGELAAVLIYAAQSPVILRS-KPHLRKLMG-HMYDQEDGHFKTFNSLIHKHRIRPTALYP
D5GPG3_TUBMM          AGELGANLIYEGQYAILKR--DPRLKPLIR-HMWDQEVHHLETFNKLVAKHRIRPTALRP
F4P407_BATDJ          AGEVGANFIYMGQMAILGKD--PHLKKVIG-DMWEQEKTHLRVFDSILSENRVRPSILRP
COQ7_MOUSE            AGEYGANRIYAGQMAVLGRT---SVGPVIQ-KMWDQEKNHLKKFNELMIAFRVRPTVLMP
H0VHI5_CAVPO          AGEYGADRILAGQMAVLGRT---SVGPVIQ-KMWDQEKAHLKKFSELMVAFRVRPTALMP
COQ7_HUMAN            AGEYGANRIYAGQMAVLGRT---SVGPVIQ-KMWDQEKDHLKKFNELMVTFRVRPTVLMP
K7D5U8_PANTR          AGEYGANRIYAGQMAVLSRT---SVGPVIQ-KMWDQEKDHLKKFNELMVTFRVRPTVLMP
A0A2I3H0N0_NOMLE      AGEYGANRIYAGQMAVLGRS---SVGPVIQ-KMWDQEKDHLKKFNELMVTFRVRPTVLMP
A0A2J8S241_PONAB      AGEYGANRIYAGQMAVLGRT---SVGPVIQ-KMWDQEKDHLKKFNELMVTFRVRPTVLMP
F6XXM7_CALJA          AGEYGANRIYAGQMVVLGRT---SVGPVIQ-KMWDQEKDHLKKFSELMVTFRVRPTVLMP
G1LWZ2_AILME          AGEYGANRIYAGQMAVLGRT---SVGPVIQ-KMWDQEKDHLKKFNELMVTFRVRPTVLMP
E2RF61_CANLF          AGEYGANRIYAGQMAVLGRT---SVGPVIQ-KMWDQEKDHLKKFNELMVAFRVRPTILMP
M3YPM7_MUSPF          AGEYGANRIYAGQMAVLGRT---SVGPVIQ-KMWDQEKDHLKKFNELLVAFRVRPTILMP
M3WJK9_FELCA          AGEYGANRIYAGQMAVLGRT---SVGPVIQ-KMWDQEKDHLKKFNELMVAFRVRPTILMP
COQ7_BOVIN            AGEYGANRIYAGQMAVLGRT---SIGPVIQ-KMWDQEKDHLKKFNELMVAFRVRPTVLMP
G1SGS8_RABIT          AGEYGANRIYAGQMAVLGRT---SVGPVIQ-KMWDQEKDHLKKFNELMVAFRVRPTVLLP
I3M379_ICTTR          AGEYGANRIYAGQMAVLGRT---SVGPVIQ-KMWDQEKDHLKKFNELMVAFRVRPTVLMP
G3STP5_LOXAF          AGEYGANRIYAGQMAVLGRT---SVGPVIQ-KMWDQEKDHLKKFNELMVAFRVRPTILMP
G3X113_SARHA          AGEYGANRIYAGQMAVLGRT---SMGPVIQ-KMWDQEKAHLKKFNELMVTFRVRPTILMP
K7EG75_ORNAN          AGEYGANRIYAGQMVVLGRT---SVGPVIQ-KMWDQEKDHLKKFNDLMITFRVRPTLLMP
H3A8N6_LATCH          AGEYGANRIYEGQMVVLGKT---AVGPVIQ-EMWDQEKDHLQKFNELMVEHRVRPTILLP
U3KI02_FICAL          AGEFGANRIYAGQMAVLGRS---SVGPVIQ-QMWNQEKDHLKKFNELMVAYRVRPTVLLP
A0A669EDW8_ORENI      AGEYGANRIYAGQMAVLGRS---KTGPFIQ-EMWDQEKKHLEKFNEILAENRVRPTALLP
A0A087XVU4_POEFO      AGEYGANRIYAGQMAVLGRS---RTGPLIQ-QMWDQEKKHLSKFNEILAENRVRPTALLP
G3Q652_GASAC          AGEYGANRIYAGQMAVLGRS---SIGPLIQ-EMWDQEKKHLKKFNEILAENRVRPTALLP
Q4S7R6_TETNG          AGEYGANRIYAGQMAVLGRS---RTGPLIQ-EMWDQEKKHLQKFNEIMADSRVRPTALLP
W5KBK8_ASTMX          AGEYGANRIYAGQMAVLGRT---QSGPIIQ-NMWDQEKMHLQKFNEILGENRVRPTLLLP
F1QW05_DANRE          AGEYGANRIYAGQMAVLGRT---QTGPLIQ-HMWDQEKIHLEKFNEILGEHRVRPTLLLP
F7DI76_XENTR          AGEYGANRIYAGQMAVLGRS---TVGPIIQ-HMWDQEKEHLKKFSELMVSHRVRPTVLMP
G4VRU9_SCHMA          AGELGANRIYQGQLIVLGKS---SIGPKIK-KMHDQEEEHLKKFQELIPIHRVRPTLLLP
H2YVI5_CIOSA          AGELGADRIYAGQMAVLGKT---DVGPTIQ-HMWDQEKEHLQTFTNMISEYRVRPTVLHP
F7AYB2_CIOIN          AGEFGADRIYAGQMAVLGKT---DVGPTIQ-HMWDQEKDHLQTFTNMISEYRVRPTVLHP
A8XZN1_CAEBR          AGELGADRIYAGQLAVLQGS---SVGSVIR-KMWDEEKEHLDTMERLAAKHNVPHTIFSP
A0A2H2HVF8_CAEJA      AGELGADRIYAGQLAVLKGS---SVGSVIK-KMWDEEKEHLDTMEKLAAKHNVPHTVFSP
COQ7_CAEEL            AGELGADRIYAGQLAVLQGS---SVGSVIK-KMWDEEKEHLDTMERLAAKHNVPHTVFSP
B3RUQ6_TRIAD          AGELGADRIYAGQLAVLGKT---PVGPVIK-KMWEQEKEHLQTFEKLIPDHRARPTALLP
E9FV04_DAPPU          AGEVGADRIYAGQMAVLGKS---DVGSVIQ-HMWDQEKEHRKKFDELLPKYRARPTVMLP
W5JEX7_ANODA          AGEVGANQIYRGQMAVLGHT---KAGKTIQ-HMWEQEKVHKEEFDRLLYKYRARPTALLP
Q7PRZ9_ANOGA          AGELGANQIYRGQMAILGHT---KAGKTIQ-HMWEQEKAHKEEFDRLINKYRVRPTALLP
Q7Q596_ANOGA          AGELGANQIYRGQLVILGHT---KAGKTIR-HMWEQERAHKAAFDRLVNEYRVRPSALQP
Q1HQL9_AEDAE          AGELGANQIYKGQLAVLGNT---KVGKTIE-HMWEQEKVHKAEFDRLMNKYRARPTALLP
Q9W3W4_DROME          AGELGADRIYAGQMAILGNG---PLGKTIG-HMWEQEKEHRKQFEQLIQQHRVRPTIMTP
Q29IL9_DROPS          AGELGADRIYAGQMAILGNG---PLGKTIG-HMWEQEKCHRAQFEQLIQQHRVRPTVMTP
A0A087ZZV1_APIME      AGELGADRIYAGQMAVLGRT---SVGPTIQ-HMWDQEKKHRAKFEELITKYRVRPTVLIP
COQ7_DICDI            AGEFGAARIYEGQLAVLANT---KEGPLIR-EMADQEKEHQAKFNQLIYEKRVRPTILSP
F0ZWR6_DICPU          AGEFGAARIYEGQLAVLAKT---KEGPLIR-EMADQEKEHQAKFNQLIYEKRVRPTVLSP
A4I4U9_LEIIN          AGEVAAVRIARHQLEWMSPL---DDAFPITQEILADELVHQRVMSELAKQHGVRTTSLDP
A4HHN4_LEIBR          AGEVAAVRIARHQLEWMSPL---NDAFPIAQEILDDEIVHQDVMTELAERHGVRTTTLDP
Q582P6_TRYB2          AGEVAAVRICKYQLLWMSPL---DSGVPVVKEILRDELVHEEVMGHLARKHSVRLTLLDP
Q4CPK7_TRYCC          AGETAAVRICGYQLLWMSPL---DSAVPVVKEILKDELVHEKTMNDLAKKHSVRLTALDP
COQ7_ACIAC            VGEVCAQALYMGQAAVTRDP----ALRARLMEAAREETDHLAWTAERLQALGSRPSLLNP
COQ7_ACISJ            VGEVCAQGLYMAQSCVTRDP----QLRSDLLAAAREETDHLAWTRERLDALGSRPSLLNP
COQ7_DELAS            VGEVCAQALYNAQAMVTRDM----VLREHLLEAAREETDHLAWTRDRLNALGDRPSLLNP
COQ7_VEREI            VGEVCAQALYTAQAALTRDA----RLRARLQQAAREEIDHLAWTRQRLDALGARTSLLDP
COQ7_POLNA            VGEVCAQALYAAQALGTRDA----VLRKHFLKASQEEGDHLAWTKDRLDELGARPSLLNP
COQ7_POLSJ            VGEVCAQALYAAQAVTTRDP----ALRRHFLAASREEGDHLAWTRERLDELGARPSLLNP
COQ7_RHOFT            VGEVCAQALYTAQAFATKNE----ALRAHFTKASADETNHLAWTQQRLDELGARPSLLNP
COQ7_VARPS            VGEVCAQALYTAQAAVARDP----VLRARLLEASHEEADHLAWTRQRLDELGARPSVLNP
COQ7_METPP            VGEVCAQALYASQALGTRNE----TLRAQFEHAAREETDHLAWTEARLAELNGRTSWLNP
COQ7_BURCJ            VGEVCAQALYQAQKLTARTA----SAKAMFEEAAREEEDHLAWTAHRLKELDSRPSLLNP
COQ7_BURPS            VGEVCAQALYQAQKLTTSSA----GLKEMFEHAAREEEDHLAWTAHRLKDLDSRPSLLNP
COQ7_PARXL            VGEVCAQALYQAQKLATRSP----SLRAVFNHAAIEEEDHLAWTAKRLEALDSRPSLLNP
COQ7_CUPNH            VGEVCAQALYQAQKLTARDG----AVRAQMDAAAREEEDHLAWCAERLRELGSRPSLLNP
COQ7_CUPMC            VGEVCAQALYQAQKLTARTP----AVRAQMDAAAKEEEDHLAWCADRLRELGSRPSLLNP
COQ7_RALPJ            VGEVCAQALYQGQALFARDP----AIRTQLDEAAREEEDHLAWCAQRLQELNDRPSLLNP
COQ7_RALSO            VGEVCAQALYQGQALFARDP----AIRAQLDEAAREEEDHLAWCAQRLQELHDRPSLLNP
COQ7_POLNS            VGEVCAQALYQSQKLVARNS----EIQAMLDYSGQEEMDHLAWCENRLQELGSHTSYLNP
COQ7_POLAQ            VGEVCAQALYQSQKMLARNP----QIQVMLEHSGQEEMDHLAWCETRLQELGSHPSYLNP
COQ7_HERAR            VGEVCAQALYQAQAQFAHSD----AIKQQFELAGREEEDHLAWTAQRLRELGSHPSLLNP
COQ7_AZOSB            VGEICAQALYQGQAIMSGDE----RVREELQRASHEETEHLAWTEQRIAELGGRKSLLNP
COQ7_AROAE            SGEICAQALYQGQSMSAGDL----DVKRELARASDEETEHLAWTEQRISELGGRKSLLNP
COQ7_DECAR            CGEICAQALYQGQALTSRDP----TIRDALRSAADEETEHLAWTERRISELGGRKSFLNP
COQ7_CHRVO            CGEVCAQALYQGQALTARDA----SAREALRQAAQEEVEHLAWTERRIRELGGRPSLLNP
COQ7_LARHH            CGEVCAQALYQGQALTARDP----ATREALKEAAWEETEHLAWTEKRIAELGGRKSLLNP
COQ7_NITEU            VGEVCAQALYQGQALTARND----RVRQALDQAAREETEHLAWTERRIAELGGRKSFLNP
COQ7_NITMU            VGEICAQALYQGQALTARNA----EVQQTLAQAAREETEHLAWTERRINELSGRKSLLNP
COQ7_THIDA            VGEVCAQALYAGQALTAKNA----QVRSELERAAREETDHLAWCEQRIDELGGRKSLLNP
COQ7_BORPE            VGEVCAQALYRGQAAACREP----AARALLREAAAEEVDHLAWCHERLRELGSRPSLLNP
COQ7_BORPD            VGEVCAQALYRGQAAACREA----PVRELLLHAAAEEVDHLAWCGRRLEELGSRPSLLNP
COQ7_BORA1            VGEICAQALYRGQAVACRDA----GTRELLREAAAEEVDHLVWCDRRLKELDSRPSLLNP
COQ7_XANCP            VGEVCAQGLYFGQAAVARDD----HTRQHLLTAAQEETDHLAWCADRLRELESRPSLFNP
COQ7_XYLFA            VGEICAQGLYFGQVAVARKE----ELRRHLLKAAQEETDHLSWCSDRLHELESRPSLFNP
COQ7_AZOVD            TGEVCAQALYQGQALTARLP----RVRGAMEQAANEEIDHLAWCEQRIRELNSRPSLLNP
COQ7_PSEU5            TGEVCAQALYQGQALTARLP----QVRQAMEQAADEEIDHLAWCEQRIRQLGSHTSVLNP
COQ7_PSEAE            TGEVCAQALYQGQSLTAKLP----EVREAMEEAAEEEIDHLAWCEQRIRQLGSRPSVLNP
COQ7_PSEMY            TGEVCAQALYQGQALTAKLP----EVRSAMEHAADEEIDHLAWCEQRIRELGSHPSVLNP
COQ7_PSEF5            TGEVCAQALYQGQALTAKLP----QVRQAMEHAAEEEIDHLAWCEQRIRQLGSHPSVLNP
COQ7_PSEFS            TGEVCAQALYQGQALTAKLP----QVRAAMEHAAEEEIDHLAWCEQRIRQLGSHPSVLNP
COQ7_PSEPK            TGEVCAQALYQGQALTAKLP----EVRKAMEHAAEEEVDHLAWCEQRIRQLNSHPSVLNP
COQ7_PSESM            TGEVCAQALYQGQALTAKLP----KVRKAMEHAAEEEIDHLVWCEQRIHQLGSHTSVLNP
COQ7_MARMS            TGEVCAQALYAGQATTAKLA----TVRQEMEHAADEEIDHLVWCEQRLYDLGSKPSILNP
COQ7_SACD2            TGEVCAQALYQGQALTAKLP----EIRQEMNNAADEEQDHLAWCEERVKALGSHTSFLNP
COQ7_CHRSD            TGEVCAQALYQGQGLTAKLH----ETRDQMEQAAAEEIDHLAWCDERLRELDSRTSYLNP
COQ7_ACIAD            SGEVCAQALYHGQALTAKLP----NVRLEMEQAAIEEQDHLAWCEDRLKELDSVPSLLNP
COQ7_ALCBS            TGEVCAQALYQGQASTASLP----HIRHAMEESAREEEDHLAWCEERIQELGGVPSKLNP
COQ7_LEGPH            AGEVCAQALYQGQALTARLT----HIKEQMASAAAEEVDHLAWCEERLYELGSKPSLLNP
COQ7_NITOC            AGEVAAQALYQGQALTARLT----EIRKAMENAAREENEHLVWCQQRVQELGAHTSYLGP
COQ7_COXBU            SGEVCAQALYHGQMATAKNP----AVRALFTTAAKEETDHLAWCQERLEELGGHTSYLNA
COQ7_FRATT            TGEICAQGLYRGQASVAKSP----QTKEHLYHAAAEEYDHLAWCGERLQELGARPSLLNP
COQ7_PSYA2            TGEVCAQGLYHGQAFTAKDE----NVKQAMQQSAEEEVDHLVWCETRLSELGSHPSVFTP
COQ7_PSYWF            TGEVCAQGLYHGQAFTAKDD----LVKQAMQHSADEEIDHLVWCETRLDELGSHPSVFTP
                       **  *  :   *                      :*  *               : :  

A8NGR8_COPC7          VAKVAGFGLGAVTALMGREAAMACTEAVETVIGEHYDDQLKELDAMSTK-----------
Q5KIZ4_CRYNJ          LWQTMAFALGAGTGLMSKEAAMACTEAVETVIGEHYDDQLRELEPMLNPPKDGASSAQ--
COQ7_SCHPO            FWDIAGFALGAGTALLGTKAAMACTEAVETVIGGHYNDQLRETAHLENK-----------
COQ7_YEAST            LWKAGAFAMGAGTALISPEAAMACTEAVETVIGGHYNGQLRNLANQFNLERTDGTKGP--
Q75CT1_ASHGO          LWKLGAFTMGSVTALLSPEAAMACTEAVETVIGGHYNDQLRCLNSQYEMRRSDGTCGQ--
A0A1D8PN46_CANAL      LWKLGAIGMGVGTALIGKEAAMACTVAVETVIGGHYNQQLRVLSNQYGVPIYDKKTGALL
C4QWB1_KOMPG          LWKVGAMGLGIATGLMGKEAAMACTEAVETVIGGHYNQQLRVLTNQFHVDVVNEETGV--
Q6C5T9_YARLI          IWKVAATGLGCATALLGQEGAMACTEAVETVIGGHYNTQLRWLHENFPPKEERSK-----
Q4WIG9_ASPFU          IWKVAATFLGWSTAAMGREAAMACTEAVETEIGTHYNDQVREILSWEADAKSRGEELD--
C8V7X1_EMENI          IWEAAATFLGWSTGVMGREAAMACTEAVETEIGTHYNEQIREILAWEADAHSRGEELD--
J3KFX5_COCIM          IWEGVSTFLGWSTGIMGREAAMACTEAVETEIGTHYNDQIRVILEWFADAEQRGEEID--
C0NZF5_AJECG          IWEIAATALGWSTGRMGREAAMACTEAVETEIGTHYNDQVREILGWFEDARERGEEPD--
M2V064_COCH5          IWTAAASILGWSTAVMGREAAMACTEAVETEIGTHYNEQVRVLLDWAKKCEKRGESLG--
G2WW39_VERDV          LWQVLATGLGWGTAVLGREAAMACTEAVETEIGDHYNAQIRVLLEMVARWRDDGYDVG--
Q7RZB1_NEUCR          LWSVMATGLGWGTAMLGKEAAMACTEAVETEIGGHYNAQIRKLLEMVSEWEAEGYEVG--
C7YRD0_FUSV7          LWSVMATGLGWSTAMMGYEAAMACTEAVETEIGGHYNEQIRTLLEMITQWEAEGYEVG--
D5GPG3_TUBMM          LWNVAGYALGVGTALLGEKAAMACTEAIETEIGCHYNDQLRTLLDMLKDDKDLLQNGE--
F4P407_BATDJ          LWEIAGFSLGAGTALLGKEAAMACTEAVETVIGEHYNSQIRELVLLKPD-----------
COQ7_MOUSE            LWNVAGFALGAGTALLGKEGAMACTVAVEESIANHYNNQIRMLME---------------
H0VHI5_CAVPO          LWNVMGFALGAGTALLGKEGAMACTVAVEETIAHHYNNQIRMLME---------------
COQ7_HUMAN            LWNVLGFALGAGTALLGKEGAMACTVAVEESIAHHYNNQIRTLME---------------
K7D5U8_PANTR          LWNVLGFALGAGTALLGKEGAMACTVAVEESIAHHYNNQIRTLME---------------
A0A2I3H0N0_NOMLE      FWNVLGFALGAGTALLGKEGAMACTVAVEESIAHHYNNQIRKLME---------------
A0A2J8S241_PONAB      FWNVLGFALGAGTALLGKEGAMACTVAVEESIAHHYNNQIRTLME---------------
F6XXM7_CALJA          LWNVLGFALGAGTALLGKEGAMACTVAVEESIAHHYNNQIRTLME---------------
G1LWZ2_AILME          FWNVVGFALGAGTALLGKEGAMACTVAVEESIAHHYNNQIRTLME---------------
E2RF61_CANLF          FWNVVGFALGAGTALLGKEGAMACTVAVEESIAHHYNNQIRTLME---------------
M3YPM7_MUSPF          FWNVAGFALGAGTALLGKEGAMACTVAVEESIAHHYNNQIRTLME---------------
M3WJK9_FELCA          FWNVVGFALGAGTALLGKEGAMACTVAVEESIAHHYNNQIRTLME---------------
COQ7_BOVIN            FWNVVGFALGAGTALLGKEGAMACTVAVEESIAHHYNNQIRTLME---------------
G1SGS8_RABIT          FWNVVGFALGAGTALLGKEGAMACTVAVEESIAHHYNNQIRTLVE---------------
I3M379_ICTTR          FWNVVGFALGAGTALLGKEGAMACTVAVEESIAHHYNNQIRTLME---------------
G3STP5_LOXAF          FWNVVGFALGAGTALLGKEGAMACTVAVEESIAHHYNNQIRTLME---------------
G3X113_SARHA          FWNVMGFALGAGTALLGKEGAMACTVAVEESIAHHYNNQIRTLME---------------
K7EG75_ORNAN          FWNVVGFALGMGTALLGKEGAMACTVAVEESIANHYNNQIRTLME---------------
H3A8N6_LATCH          FWNVVGFALGAGTALLGKEGAMACTVAVEESISEHYNNQIRTLME---------------
U3KI02_FICAL          FWNVAGFVLGAGSALLGKKGAMACTVAVEESISEHYNNQIRTLIE---------------
A0A669EDW8_ORENI      FWNIAGFVLGASSALLGKEGAMACTVAVEESITEHYNNQIRTLME---------------
A0A087XVU4_POEFO      LWNLAGFVLGASTALLGKEGAMACTVAVEESISEHYNSQIRALME---------------
G3Q652_GASAC          LWNIAGFVLGASSALLGKEGAMACTVAVEESISEHYNSQIRALME---------------
Q4S7R6_TETNG          FWNIAGFALGASTALLGKEWAMACTVAVEESISEHYNSQIRALME---------------
W5KBK8_ASTMX          LWNVAGFLLGASTALLGKEGAMACTVAVEESISEHYNSQIRALME---------------
F1QW05_DANRE          LWNIAGFALGACTALLGKEGAMACTVAVEESISEHYNSQIRTLME---------------
F7DI76_XENTR          LWNVAGFALGAGTALLGKKGAMACTVAVEASISEHFNSQIRTLME---------------
G4VRU9_SCHMA          LWSIAGFALGVGSALLGSKSAMACTVAVESVISEHYNNQIRELVE---------------
H2YVI5_CIOSA          IWNVAGFVLGAGTAMLGKEAAMACTVAVEESITDHYNKQLRTLLEVE-------------
F7AYB2_CIOIN          LWNIAGFALGAGTALIGKEAAMACTVAVEESITDHYNKQLRYLLDSN-------------
A8XZN1_CAEBR          VFSVAAYALGVGSALLGKEGAMACTIAVEELIGQHYNDQLKELLAD--------------
A0A2H2HVF8_CAEJA      VFSVAAYALGVGSALLGKEGAMACTIAVEELIGQHYNDQLKELLAD--------------
COQ7_CAEEL            VFSVAAYALGVGSALLGKEGAMACTIAVEELIGQHYNDQLKELLAD--------------
B3RUQ6_TRIAD          LWTVAGYVLGAGTAMLGKEAAMACTVAVEEVIGDHYNNQLRQLVAHGNADDSI-------
E9FV04_DAPPU          IWNVAGFALGAGSAMLGPKMAMACTAAVETVITDHYNDQIRELMT---------------
W5JEX7_ANODA          FWNVAGFALGAGTALLGEKAAMACTVAVESVIVEHYNDQLRKLMDD--------------
Q7PRZ9_ANOGA          FWNVAGFALGAGTALLGEKAAMACTVAVESVIVEHYNDQLRKLMDD--------------
Q7Q596_ANOGA          VWRVAGFALGLGTALLGERAAMACTVAVESVIVEHYNDQLRTLMCDE-------------
Q1HQL9_AEDAE          LWNIAGFALGAGSALLGEKAAMACTVAVESVIVEHYNDQLRELMDN--------------
Q9W3W4_DROME          IWNVAGFVLGAGTALMGEKAAMACTVAVETVIVEHYNDQLRQIMEA--------------
Q29IL9_DROPS          IWNVAGFVLGAGTALMGEKAAMACTVAVETVIVEHYNDQLRQIMES--------------
A0A087ZZV1_APIME      IWNVAGFILGAGTALMGEKAAMACTVAVETVITEHYNDQLRALVEN--------------
COQ7_DICDI            IWNVAGFGLGYVSALMGKEAAMAVTVAVETVISDHYNDQLRQLND---------------
F0ZWR6_DICPU          IWNVAGFGLGYVSALMGKEAAMAVTVAVETVISDHYNDQLRQLND---------------
A4I4U9_LEIIN          LFKLGAFALGAGTAALGKGAMMCCHAAVETTIFNHYNDQLRELEVLEDSCSDIKESEA--
A4HHN4_LEIBR          LFKLGAFLLGSGTAVLGKDAMMCCHAAVEITIFDHYNDQLRELEVLEDKCSGMKESEV--
Q582P6_TRYB2          LFHVGAFVMGSCTALLGKDAVMCCHAAVEVTIAQHYNDQLRELQSLEESEGASKGK----
Q4CPK7_TRYCC          VFHVGGFAMATLTALLGKEAMMCCHAAVEITIVNHYNDQLRELEELENGGVNLNDD----
COQ7_ACIAC            LWFAGAFAIGWTAAQVSDAASLGFVVETENQVARHLQGHLERMPP---------------
COQ7_ACISJ            LWFAGAFAIGLVAARVSDQASLGFVVETERQVSAHLQGHLRRLPE---------------
COQ7_DELAS            LWFAGAFAIGVVAAKISDAASLGFVVETEEQVSAHLESHLGLLPE---------------
COQ7_VEREI            LWFAGAFALGLVAAKVGDRVSLGFVAETESQVAAHLQSHLQRLPQ---------------
COQ7_POLNA            LWYAGAFGLGLVASRLGDRLSLGFVVETERQVEAHLASHLERLPE---------------
COQ7_POLSJ            LWYAGAFGLGLLAGRLGDRVSLGFVVETERQVEAHLASHLERLPE---------------
COQ7_RHOFT            LWYGAAFGLGLLAGRLGDPISLGFVVETENQVEAHLESHLSLLPA---------------
COQ7_VARPS            LWYAGAFGLGLVAGRLGDPLSLGFVAETERQVEAHLESHLGRLPA---------------
COQ7_METPP            LWYAGAFGLGLIAGRLGDAASLGFVVETERQVEQHLLQHLDRLPV---------------
COQ7_BURCJ            LWYAGALAIGVAAGALGDKVSLGFMAETERQVESHLEGHMSELPA---------------
COQ7_BURPS            LWYAGALAIGVVAGRLGDKMSLGFMAETERQVESHLDGHLSELPA---------------
COQ7_PARXL            LWYTGALAIGLAAGRMGDRVSLGFMAETERQVEQHLDSHLEQLPE---------------
COQ7_CUPNH            LWYAGAFAIGWMAGRAGDRVSLGFVAETERQVEHHLGGHLDRLPE---------------
COQ7_CUPMC            VWYAGAFAIGVLAGRAGDKVSLGFVAETERQVEHHLTSHLDRLPT---------------
COQ7_RALPJ            LWYAGAFAIGAVAGRLGDKISLGFVAETERQVEHHLDGHLDTLPE---------------
COQ7_RALSO            LWYAGAFAIGALAGRLGDKISLGFVAETERQVEHHLDGHLDRLPE---------------
COQ7_POLNS            LWYAGSFAIGLAAGLAGDKWSLGFVAETEKQVESHLESHLKKLPK---------------
COQ7_POLAQ            FWYAGSFAIGMLAGLAGDRWSLGFVAETEKQVENHLESHLETLPQ---------------
COQ7_HERAR            LWYAGAYALGTVAAKLGDARSLGFVVETERQVEAHLNEHMNRLPP---------------
COQ7_AZOSB            LWYGGALAIGMLAGRFGDRWNLGFLAETERQVEAHLTSHLERLPA---------------
COQ7_AROAE            LWYGGSLALGLLAGRLGDRWSLGFLAETERQVEAHLDGHLEHLPP---------------
COQ7_DECAR            LWYLGSLSLGLVAGALGDKWSLGFLAETERQVEAHLNGHLRSLPE---------------
COQ7_CHRVO            LWYTGSLALGVAAGVLGDKWNLGFLQETERQVGAHLDSHLSALPP---------------
COQ7_LARHH            LWYGGSLAMGITAGLLGDRWNLAFLEETEYQVEAHLNEHLATLPE---------------
COQ7_NITEU            LWYGGSFTLGLVAGVLGDKWNLGFLAETERQVEAHLADHLQRLPH---------------
COQ7_NITMU            LWYGGSFAIGAFAGLLGDKWNLGFLAETERQVSAHLGGHLSRLPH---------------
COQ7_THIDA            LWFGGAFGIGVVAGLLGDKWNLGFLAETERQVEAHLDGHLQKLPE---------------
COQ7_BORPE            FWYTGSFALGVLASYAGVPRNLGFMAETERQVEAHLDGHLRTLPV---------------
COQ7_BORPD            LWYAGSFTLGVLASCAGTARNLGFMAETERQVEAHLDGHLRSLPE---------------
COQ7_BORA1            LWYAGSFALGVAASVAGVPRNLGFMAETERQVEAHLDEHLRTLPA---------------
COQ7_XANCP            LWYAGSYALGAVAGLRGDDWSLGFVVETERQVEAHLDEHLETLPE---------------
COQ7_XYLFA            LWYSSSYMLGVFAGLLGDPWSLGFVVETERQVEAHLEKHLQVLPE---------------
COQ7_AZOVD            LFYGLSFGIGATAGLISDRISLGFVAATEDQVCKHLDDHLKQLPE---------------
COQ7_PSEU5            IFYGLSFGIGASAGLISDRISLGFVAATEDQVCKHLDDHLGQLPA---------------
COQ7_PSEAE            IFYGLSFGVGAAAGLVSDRVSLGFVAATEDQVCKHLDEHLAQIPQ---------------
COQ7_PSEMY            LFYGLSFGVGAVAGLVSDRVSLGFVAATEDQVCKHLDEHLEQIPE---------------
COQ7_PSEF5            LFYGLSFGIGAAAGLISDKVSLGFVAATEDQVCKHLNEHLEQLPA---------------
COQ7_PSEFS            LFYGLSFGIGAAAGLISDKVSLGFVAATEHQVCKHLDEHLEQLPA---------------
COQ7_PSEPK            LFYGMSFGIGALAGLVSDKVSLGFVAATEHQVCKHLDEHLEQLPH---------------
COQ7_PSESM            LFYGLSFGIGAVAGVISDRVSLGFVAATEDQVCKHLGEHLEQLPI---------------
COQ7_MARMS            LFYGASFMIGAGAGFISDKLSLGFVAATEDQVCIHLQKHMAALPM---------------
COQ7_SACD2            VWYTLSFSIGAAAGLISDKVSLGFVAATEDQVCKHLQEHLARLPQ---------------
COQ7_CHRSD            AFYAASFGMGALAGKLGDNISLGFVAATEEQVGRHLDDHMHKLPM---------------
COQ7_ACIAD            VWYSLSFGMGAIAGIAGDKYSLGFVAETERQVSSHLQDHLKQLPT---------------
COQ7_ALCBS            LFYAMSYAVGATAGLIGDRWSLGFVTETENQVVKHLESHLYQVPE---------------
COQ7_LEGPH            IWYCGSVLLGALAGLAGDKVSLGFVAETERQVTAHLQRHLHYLPE---------------
COQ7_NITOC            FWYGGSFVIGALAGMAGDKWSLGFVAETEHQVVKHIERHLDRISA---------------
COQ7_COXBU            FWYTNSFLIGLLAGLSGDPLSLGFVEETEKQVEIHLADHLRKIPS---------------
COQ7_FRATT            FWYWTSFGIGAVAGSISDSLSYGFVVETEKQVMKHLDSHLKSLPV---------------
COQ7_PSYA2            LWYGMSFGLGAVAGAISNDFSLGFVAETEAQVSEHLQDHIGQLPP---------------
COQ7_PSYWF            VWYGLSFGLGAIAGIISDEFSLGFVAETEAQVSEHLQDHIDQLPE---------------
                           .  :.  :.  .           *  :  *   ::                    

A8NGR8_COPC7          -----------HPSIPLLKDVIREFRDDELEHLDIAVEN-DAQRAPAHALLSAVVGAGCM
Q5KIZ4_CRYNJ          ----------PHPSVPLMASILREFRDDELEHLDIAVEE-GAQKAPGHSLLSAVVGEGCK
COQ7_SCHPO            -----------APEFKEIRSHLAEFRDDELEHLNTAVEGWNAKEAPAHALLTNAIQMGCK
COQ7_YEAST            -----------SEEIKSLTSTIQQFRDDELEHLDTAIKH-DSYMAVPYTVITEGIKTICR
Q75CT1_ASHGO          -----------SDELRNLISTIRQFRDDELEHLDTAVQY-DSHKAVPYIALTEAIKAICR
A0A1D8PN46_CANAL      SPDTVEKTAQTSEELTELKNQISEFRDDELEHLNTALDH-DAEKAVPYMLITEGIKLICR
C4QWB1_KOMPG          ------NTPTVPEEIKDMQKLVSQFRDEELEHLDTAVEH-DAHGARPYWLLTEAIKLTCR
Q6C5T9_YARLI          -----------DEEITSLKSIVKQFRDEELEHLEIAVEN-DSHEARPYWLLTETIKAGCR
Q4WIG9_ASPFU          ------------DELKEMLVTFRRIRDEELEHLDHAIEN-DAKEAQPYDPLVNVIRLGCR
C8V7X1_EMENI          ------------DELKDMLATFRRIRDEELEHLDHAVEN-DSKEAQPYDPLVNVIRLGCR
J3KFX5_COCIM          ------------GELKELVSTLKRIRDEELEHLDHAVEN-DAKEANPYDPLVNVIRLGCR
C0NZF5_AJECG          ------------EELAALVRTLKRIRDEELEHLDHAVEN-DAKEARPYDPLVNVIRLGCR
M2V064_COCH5          ------------PELDKLVVELRRIRDEELEHLDHAVEN-DAKNAKPYELLTEVIRGGCR
G2WW39_VERDV          ------------PELTDLIATLRRIRDEELEHLDHAVEH-DAKKAEPHWLLTGVIRAGCK
Q7RZB1_NEUCR          ------------AEFRHLINTLRRIRDEELEHLDHAVEH-DAQKAEPHWLLTGVIRAGCR
C7YRD0_FUSV7          ------------EELSELVKTLRRIRDEELEHLDHAVEH-DARKAEPHWLLTGVIRAGCR
D5GPG3_TUBMM          --------------LKQLIDTIREFRDDELEHLDTAIEH-DSKGAEGYDVLFNVIRVGCK
F4P407_BATDJ          ------------VEVTKLTEVIRQFRDDELEHLETALDH-EAKKAPAYPILTNAIKTGCG
COQ7_MOUSE            ---------EDPEKYEELLQVIKQFRDEELEHHDTGLDH-DAELAPAYALLKRIIQAGCS
H0VHI5_CAVPO          ---------EDPEKYEELLQLIKTIRDEELEHHDTGLYH-DAELAPAYTVLKNVIQAGCR
COQ7_HUMAN            ---------EDPEKYEELLQLIKKFRDEELEHHDIGLDH-DAELAPAYAVLKSIIQAGCR
K7D5U8_PANTR          ---------EDPEKYEELLQLIKKFRDEELEHHDIGLDH-DAELAPAYAVLKSIIQAGCR
A0A2I3H0N0_NOMLE      ---------EDPEKYEELLQLIKKFRDEELEHHDIGLDH-DAELAPAYAVLKSIIQAGCR
A0A2J8S241_PONAB      ---------EDPEKYEELLQLIKKFRDEELEHHDIGLDH-DAELAPAYAVLKSIIQAGCR
F6XXM7_CALJA          ---------EDPEKYEELLQVIKKFRDEELEHHDIGLDN-DAELAPAYAILKSVIQAGCK
G1LWZ2_AILME          ---------KEPEKYEELLQVIRKFRDEELEHHDIGLEH-DAQLAPAYTVLKSLIQAGCS
E2RF61_CANLF          ---------KDPEKYEELLQVIRKFRDEELEHHDIGLEH-DAQLAPAYTILKNLIQAGCS
M3YPM7_MUSPF          ---------KEPEKYTELLQVIKKFRDEELEHHDIGLEH-DAQLAPAYTVLKSLIQAGCS
M3WJK9_FELCA          ---------EDPEKYEELLQVIRKFRDEELEHHDIGLEH-DAQLAPAYAVLKNVIQAGCR
COQ7_BOVIN            ---------KEPEKYEELLQVIKKFRDEELEHHDIGLEH-DAELAPAYVVLKSVIQAGCK
G1SGS8_RABIT          ---------EDPAKYGELLQVIRKFRDEELEHHDLGLEH-DAERAPAYTVLKSIIQAGCS
I3M379_ICTTR          ---------EDPDKYQELLQVIKKFRDEELEHHDLGLDH-DAELAPAYAVLKSVIQAGCS
G3STP5_LOXAF          ---------EDPEKYEELLQIIKKFRDEELEHHDIGLDH-DAELAPAYALLKSIIQVGCS
G3X113_SARHA          ---------EDAEKYEELLQTIKKFRDEELEHHDTGLDH-NAELAPAYSILKGAIQVGCK
K7EG75_ORNAN          ---------EDPEKYEELLQIIKKFRDEELEHHDTGLEH-DAELAPAYTLLKSAIQVGCT
H3A8N6_LATCH          ---------EDPEKYKELLEMIKKFRDEEMEHHDTGLEH-DAELAPAYSVLKNTIQLGCK
U3KI02_FICAL          ---------EDPEKYKELLQVIKQFRDEEQEHHDIGLEH-DAEATPAYSVLKTAIQLGCK
A0A669EDW8_ORENI      ---------KDPERYTELLQVIKEFRDDEMEHHDTGLEH-NAENVPGYWLLKNAIQLGCK
A0A087XVU4_POEFO      ---------SDPERYTELLQVIKEFRDDEMDHHDTGLEH-DAESLPGYWLLKNAIQLGCK
G3Q652_GASAC          ---------KDPERYTELLQVIKEFRDDEMEHHDTGLEH-DAEKVPGYWLLKNAIQLGCK
Q4S7R6_TETNG          ---------KDPERYVEFLHILKEFRDDEMEHHDTGLEH-EAESVPGYWLIKNAIQLGCK
W5KBK8_ASTMX          ---------EDPERYRELLQLIKEFRDDELEHHDTGLEH-DAESVPGYLLLKTVIQAGCK
F1QW05_DANRE          ---------ADPDRYTELLQLIKEFRDDEIEHHDTGLEH-DAESVPGYMLLKTAIQAGCT
F7DI76_XENTR          ---------SDPEKHRALLQTIKKCRDDELEHHDTGLEH-DAELAPGYFLLKNAIQLGCR
G4VRU9_SCHMA          ---------SDPETYQELLQTLTKFRDEEMEHHDTGLEH-DAEQAPFYDIMSQIIKAGCR
H2YVI5_CIOSA          ---------DKSEFHETLMSKIQQFRDEEMEHHDTGLEH-GALNAPAYQVLKQTIQVGCT
F7AYB2_CIOIN          ---------DKSEYRDHLLKKIKQFRDEEMEHHDTGLEH-GAVNAPAYQVLKQTIQAGCL
A8XZN1_CAEBR          ----------DPEAHKDLLKILTRLRDEELHHHDTGIEH-DGLKAPAYSALKWIIQTGCK
A0A2H2HVF8_CAEJA      ----------DPEAHAELLKTLTRLRDEELHHHDTGVEN-DGLKAPAYSALKWIIQTGCK
COQ7_CAEEL            ----------DPETHKELLKILTRLRDEELHHHDTGVEH-DGMKAPAYSALKWIIQTGCK
B3RUQ6_TRIAD          ---------SNSDEHKELLSVIKRFRDEELEHLDTGMEH-NATEAPLYDGLKQVIQGGCR
E9FV04_DAPPU          ----------NPEENGELLKVISKFRDEEMEHHDTAILH-KAEEAPLYQVFAQAVKIGCK
W5JEX7_ANODA          ----------PTFVDKELLATIRRFRDEEQEHHDTGLEH-GAEQAPFYQALTDVIKFGCR
Q7PRZ9_ANOGA          ----------PTFTDKELLDKIQRFRDEEQEHHDTGLEH-GAEQAPFYRALTDVIKFGCR
Q7Q596_ANOGA          ---------PPRCTDKVLLETIRRIRDEEQEQHDTGLEH-GAEQAPFYRALTSLIKSGCR
Q1HQL9_AEDAE          ----------PDFKDHELLETIQRFRDEEQEHHDIGLHE-GAEQAPFYKALTDVIKFGCR
Q9W3W4_DROME          ----------P-NPDKELLATITKFRDEEQEHHDTGIDH-GAEQAPFYQAMTEVIKFGCK
Q29IL9_DROPS          ----------P-NPDKELLETITKFRDEEQEHHDTGIDC-GAEQAPFYQAMTEVIKFGCK
A0A087ZZV1_APIME      ----------EEKVDEEILETIKKFRDEEQEHHDTGIEY-GAEQAPFYQALTNIIKFGCK
COQ7_DICDI            ----------AGIDDKELKETIKKFRDDELEHMHIGIEH-DAELAPLYKPFSELVKVGTK
F0ZWR6_DICPU          ----------YEIDDKDLRETIKKFRDDEMEHMHIGIEH-DAELAPLYKPLSELVKMGTK
A4I4U9_LEIIN          ----------EKEAWADVKSYIVKFRDEEKHHQELGEQN-GADQAPAYPLLYNGIRLACK
A4HHN4_LEIBR          ----------EKNAWRDVKNYIVKFRDEEKHHQELGEQN-GADRAPAYPLLYNGIRLACK
Q582P6_TRYB2          ----------DEKDWAEVMEYVARFRDEELHHQELGEQN-GAENAPAYPLLYNGIRIMCS
Q4CPK7_TRYCC          ----------DAKALKEIKDIVAKFRDEEEHHQRLGETN-GAAQAFCYPLLYNGIRLACR
COQ7_ACIAC            -------------QDAASLAVIERMQADEQRHADDARAA---GASDLPAPARVLMAAAAR
COQ7_ACISJ            -------------ADLPSRAIVDRMQRDEERHAAQAQAA---GALPLPPPARWLMKAAAK
COQ7_DELAS            -------------EDRASLAVVARMKDDEERHAAAAREA---GALQLPPPARALMRLAAK
COQ7_VEREI            -------------QDLASRAVVARMKDDEERHAAQARAS---GALALPAPVRAAMKAAAR
COQ7_POLNA            -------------GDHESRAIVAQMKDDEALHASAAEDA---GALQLPAPVKMLMRSAAK
COQ7_POLSJ            -------------GDHDSRAIVAQMKDDEARHAQDAQNA---GALPMPAPVKALMQASAR
COQ7_RHOFT            -------------NDHASRAIVAQMKDDEVRHALDAQKA---GAVPLPPPVKSLMTAAAK
COQ7_VARPS            -------------ADSASRAVVEQMKIDEAQHAAQAIDA---GAAELPAPAKALMRLASR
COQ7_METPP            -------------ADVESRAIVAQMREDEARHAAAAEHA---GAATLPVPVRWMMRGMAK
COQ7_BURCJ            -------------TDTASRAIVDQMRIDEVKHGKAATDA---GGIELPLPARMLMRAASK
COQ7_BURPS            -------------ADVESRAIVEQMRADEVKHGKSATDA---GGIELPMPARMLMRAASK
COQ7_PARXL            -------------ADRESRAIVEQMRVDEVEHGKAAMEA---GGIELPFPVRGLMRAVSK
COQ7_CUPNH            -------------ADGRSRAILEQMRDDEIRHGNAARDA---GGIPLPAPVRALMRGASR
COQ7_CUPMC            -------------TDSRSRAILEQMRDDEVRHGDAARNA---GGIPLPGPVRALMQVASR
COQ7_RALPJ            -------------QDTRSRAIVAQMRDDEIRHGDNARQA---GGIDLPAPIRQAMRAASR
COQ7_RALSO            -------------HDARSRAIVAQMRDDEVRHGDNARAA---GGIDLPEPVRQAMRLASR
COQ7_POLNS            -------------EDQRSRAIVDQMRIDEIAHGQAAKNA---GGVNLPEPIQKIMHAMSK
COQ7_POLAQ            -------------EDLRSRAIVDQMRIDEIEHGQAALHA---GGVVLPDPVQKVMQAMSK
COQ7_HERAR            -------------QDAKSLAVVAQMSADEVAHGSAAQAL---GAQAVPPLAQKGMQAISK
COQ7_AZOSB            -------------DDRKSRAIVEQMRTDEVEHAETALKL---GGRELPLPVRSAMKLASR
COQ7_AROAE            -------------EDHKSREIIEQMKADEAHHADVALAL---GAHELPAPFRGAMRLMAR
COQ7_DECAR            -------------DDSRSRAIVDQMRLDEIQHAETAVRY---GAAELPSPAKVAMKVMAK
COQ7_CHRVO            -------------DDARSRAIVRQMRDDELQHAEMAHEL---GAAELPAPVKAAMKLSAK
COQ7_LARHH            -------------QDAKSRAIVTQMRDDEHRHAETAHAL---GAAAMPAPVKGLMHLTSQ
COQ7_NITEU            -------------QDVRSRAIVTQMKVDEACHATMAVSH---GGGQLPAPVKVAMKFSSR
COQ7_NITMU            -------------ADEKSRAIVTQMQIDEAGHATTAVAY---GGAELPMPVKLVMRMASS
COQ7_THIDA            -------------ADAKSRAVVEQMKLDEAQHAQIAIAH---GGASLPPPVKWAMRFAAD
COQ7_BORPE            -------------QDQRSRDIVQKMKEDEAQHRASAERA---GGVPLPAPVRGAMRAMSK
COQ7_BORPD            -------------ADQRSRQIVSQMKDDEAQHRASAERA---GGVPLPAPVRGAMRAMSR
COQ7_BORA1            -------------ADERSREIVRQMKDDEAGHRESAERA---GGIPLPAPVRGIMRAMSK
COQ7_XANCP            -------------TDQRSRAILRVMKIDEARHADHAEQA---GARILPPPIPSAMALASK
COQ7_XYLFA            -------------SDARSREILRVMKVEEARHADQADHA---GARLLPSPIPGAMAWAAR
COQ7_AZOVD            -------------EDRKSRAILEQMRIDEQQHATTALEA---GGLRFPAPVKFGMTLLSK
COQ7_PSEU5            -------------GDEKSRAILEQMREDEAQHSTAAIEA---GGLRFPAPVKFGMSLVSK
COQ7_PSEAE            -------------EDRKSRAILEQMRIDEEQHSSNALAA---GGLRFPAPVKLGMSLLAK
COQ7_PSEMY            -------------HDAKSRAILEQMRIDEEQHANSALAA---GGVRFPAPVKFGMTLLSK
COQ7_PSEF5            -------------EDEKSRAILEQMRIDEEHHAETALEA---GGFRFPAPVKFGMSLLAK
COQ7_PSEFS            -------------EDEKSRAILEQMRIDEEHHAESALDA---GGFRFPAPVRFGMSLLAK
COQ7_PSEPK            -------------EDEKSRAILEQMRIDEEQHAESALEA---GGYRFPAPVRFGMSLLAK
COQ7_PSESM            -------------EDGKSRAILEQMLSDEEHHAESALEA---GGFRFPAPVKFGMGVLAK
COQ7_MARMS            -------------QDAKSKAVLTQMHIDEAKHKAMALEA---GGYEFPQPIMAIMTQVSK
COQ7_SACD2            -------------QDAASRVIVEQMLIDEAKHAQTALAA---GGYNFPKPVKMGMTVMSK
COQ7_CHRSD            -------------GDRRSRAVLEQMRTDEAHHERWALEA---GGARFPAPLKLGMRLMSK
COQ7_ACIAD            -------------HDERSKRILEQMNQDELHHRDTALNA---GGVELPVAVKITMTAISK
COQ7_ALCBS            -------------SDLRTRAILEQMKTDELKHAVTAKDA---GGADLPSPVRHAMTLMSK
COQ7_LEGPH            -------------KDKKTIAILKRMQEDEEHHAHTAMEA---GAVELPYIIKQLMNAVSK
COQ7_NITOC            -------------QDAPSRAILEQMKEDEARHATVALEA---GGVELPSSIKALMGAASK
COQ7_COXBU            -------------NDLKSRKIVEYMQQDEIQHGLNARSS---GAKELPYLVKKLMAFQAK
COQ7_FRATT            -------------NDNRSREILKQMYIDESEHAVEAEKA---GGKKLPKTVKAIMKLQSK
COQ7_PSYA2            -------------QDQRSKEILAQMDSEELHHRELALAN---GGAALSPPIRHTMRWMAN
COQ7_PSYWF            -------------QDTRSKEILAQMNIEELEHREAALNH---GGKALSAPVRISMRWMAN
                                           .     :*  :   .                  :     

A8NGR8_COPC7          VAIELCKRI
Q5KIZ4_CRYNJ          LAIKVCQKI
COQ7_SCHPO            AAIWMCKRF
COQ7_YEAST            VAIWSAERI
Q75CT1_ASHGO          TAIWTAERV
A0A1D8PN46_CANAL      GAIWTAERI
C4QWB1_KOMPG          GAIWTAERV
Q6C5T9_YARLI          GAIWVAERV
Q4WIG9_ASPFU          AAIKISERV
C8V7X1_EMENI          AAIKISERV
J3KFX5_COCIM          AAIKISEKI
C0NZF5_AJECG          AAIQISQRV
M2V064_COCH5          GAIWVSERV
G2WW39_VERDV          GAIWVSEKV
Q7RZB1_NEUCR          GAIWVSERV
C7YRD0_FUSV7          GAIWVSERV
D5GPG3_TUBMM          AAIWLSQRV
F4P407_BATDJ          AAIWIASRF
COQ7_MOUSE            AAIYLSERF
H0VHI5_CAVPO          AAIYLSERL
COQ7_HUMAN            VAIYLSERL
K7D5U8_PANTR          VAIYLSERL
A0A2I3H0N0_NOMLE      VAIYLSERL
A0A2J8S241_PONAB      VAIYLSERL
F6XXM7_CALJA          AAIYLSERL
G1LWZ2_AILME          MAIYLSERF
E2RF61_CANLF          MAIYLSERF
M3YPM7_MUSPF          MAIYLSERF
M3WJK9_FELCA          VAIYLSERF
COQ7_BOVIN            VAIYLSERL
G1SGS8_RABIT          VAISLSERL
I3M379_ICTTR          AAIYLSERL
G3STP5_LOXAF          AAIYLSERF
G3X113_SARHA          AAIYLSERI
K7EG75_ORNAN          AAIYLSERI
H3A8N6_LATCH          AAIYLSERV
U3KI02_FICAL          AAIFLSERI
A0A669EDW8_ORENI      AAIYVSQRI
A0A087XVU4_POEFO      AAIYVSQRV
G3Q652_GASAC          VAISVSQRV
Q4S7R6_TETNG          AAIYASERI
W5KBK8_ASTMX          AAIYVSQRV
F1QW05_DANRE          AAIYISQRI
F7DI76_XENTR          AAIFLSERV
G4VRU9_SCHMA          ASIFLAERI
H2YVI5_CIOSA          AAIWLSERI
F7AYB2_CIOIN          AAIWLSERI
A8XZN1_CAEBR          GAIAIAEKV
A0A2H2HVF8_CAEJA      GAIAIAEKV
COQ7_CAEEL            GAIAIAEKI
B3RUQ6_TRIAD          IAIWLSERI
E9FV04_DAPPU          GAIWISERI
W5JEX7_ANODA          TAIKIAERV
Q7PRZ9_ANOGA          TAIKIAEKV
Q7Q596_ANOGA          TAIKIAEKV
Q1HQL9_AEDAE          TAIKIAEKV
Q9W3W4_DROME          TAIAISKKI
Q29IL9_DROPS          TAIAISKKI
A0A087ZZV1_APIME      TAISISKVI
COQ7_DICDI            TAIWLSTRV
F0ZWR6_DICPU          TAIWLSTRV
A4I4U9_LEIIN          IGVACAKRI
A4HHN4_LEIBR          IGVALAKRI
Q582P6_TRYB2          LGVALAKRI
Q4CPK7_TRYCC          MGVNFAKKV
COQ7_ACIAC            VMTATAHHI
COQ7_ACISJ            VMTTTAHHI
COQ7_DELAS            VMTTTAHRI
COQ7_VEREI            LMTSTAHYV
COQ7_POLNA            VMTTVAHRI
COQ7_POLSJ            LMTTTAHYL
COQ7_RHOFT            VMTTVAHRI
COQ7_VARPS            VMTTVAHRI
COQ7_METPP            LMTSTAHRI
COQ7_BURCJ            VMTSTAYYL
COQ7_BURPS            VMTSTAYYL
COQ7_PARXL            VMTRTAYYI
COQ7_CUPNH            VMTTAAYRI
COQ7_CUPMC            VMTTTAYRI
COQ7_RALPJ            VMTTAAYRI
COQ7_RALSO            IMTTAAYRI
COQ7_POLNS            VMTTTAYKI
COQ7_POLAQ            VMTTAAYRI
COQ7_HERAR            IMTTTAYYI
COQ7_AZOSB            VMTTAAYRV
COQ7_AROAE            VMTATAYRI
COQ7_DECAR            VMTGVAYRF
COQ7_CHRVO            VMTGSSYRV
COQ7_LARHH            LMKKTSYHI
COQ7_NITEU            IMTRTAYWV
COQ7_NITMU            VMTRTAYWV
COQ7_THIDA            VMRQTASRI
COQ7_BORPE            VMTSTAYWL
COQ7_BORPD            LMTSTAYWI
COQ7_BORA1            VMTGTAYRL
COQ7_XANCP            LMKTIAYRF
COQ7_XYLFA            LMKVVAYRI
COQ7_AZOVD            VMTKSTYRI
COQ7_PSEU5            VMTKATYRI
COQ7_PSEAE            VMTKSTYRI
COQ7_PSEMY            VMTKSTYRI
COQ7_PSEF5            VMTKSTYRI
COQ7_PSEFS            VMTKSTYRI
COQ7_PSEPK            VMTKSTYRI
COQ7_PSESM            VMTKSTYRI
COQ7_MARMS            VMTITTYRI
COQ7_SACD2            VMTETSFHI
COQ7_CHRSD            VMTKSVYTL
COQ7_ACIAD            LMTKTSYYI
COQ7_ALCBS            VMTFTTYRI
COQ7_LEGPH            LMTQSSYYI
COQ7_NITOC            VMTRTAYWI
COQ7_COXBU            VMTTLAYWI
COQ7_FRATT            VMTTLAYRF
COQ7_PSYA2            RMKATAYHL
COQ7_PSYWF            RMKNLAYHL
                              .