CLUSTAL format seed alignment for MF_01659

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

MEND_ECOLI      ---------------------------------MSVSAFNRRWAAVILEALTRHGVRHIC
MEND_ECOHS      ---------------------------------MSVSAFNRRWAAVILEALTRHGVRHIC
MEND_ECOLC      ---------------------------------MSVSAFNRRWAAVILEALTRHGVRHIC
MEND_SHIF8      ---------------------------------MSVSAFNRRWAAVILEALTRHGVRHIC
MEND_SHIFL      ---------------------------------MSVSAFNRRWAAVILEALTRHGVRHIC
MEND_ECO24      ---------------------------------MSVSAFNRRWAAVILEALTRHGVRHIC
MEND_SHIBS      ---------------------------------MSVSAFNRRWAAVILEALTRHGVRHIC
MEND_ECO57      ---------------------------------MSVSAFNRRWAAVILEALTRHGVRHIC
MEND_SHISS      ---------------------------------MSVSAFNRRWAAVILEALTRHGVRHIC
MEND_ECOK1      ---------------------------------MSVSAFNRRWAAVILEALTRHGVRHIC
MEND_ECOL6      ---------------------------------MSVSAFNRRWAAVILEALTRHGVRHIC
MEND_ECOL5      ---------------------------------MSVSAFNRRWAAVILEALTRHGVRHIC
MEND_ECOUT      ---------------------------------MSVSAFNRRWAAVILEALTRHGVRHIC
MEND_ECOSM      ---------------------------------MSVSAFNRRWAAVILEALTRQGVRHIC
MEND_SHIDS      ---------------------------------MSVSAFNRRWAAVILEALTRHGVRHIC
MEND_SALCH      ---------------------------------MSVSAFNRRWAAVILEALTRHGVRHVC
MEND_SALTY      ---------------------------------MSVSAFNRRWAAVILEALTRHGVRHVC
MEND_SALPA      ---------------------------------MSVSAFNRRWAAVILEALTRHGVRHVC
MEND_SALPB      ---------------------------------MSVSAFNRRWAAVILEALTRHGVRHVC
MEND_SALTI      ---------------------------------MSVSAFNRRWAAVILEALTRHGVRHVC
MEND_SALAR      ---------------------------------MSVSAFNRRWAAVILEALTRHGVRHVC
MEND_CITK8      ---------------------------------MSVSAFNRRWAAVILEALTRHGVRHVC
MEND_KLEP7      ---------------------------------MSVSAFNRRWAAVILEALTRHGVQHIC
MEND_ENT38      ---------------------------------MSVSSFNRRWAAVILEALTRHGVRHVC
MEND_YERPA      ---------------------------------MSTSVFNRRWAALLLEALTRHGVRHIC
MEND_YERPE      ---------------------------------MSTSVFNRRWAALLLEALTRHGVRHIC
MEND_YERPN      ---------------------------------MSTSVFNRRWAALLLEALTRHGVRHIC
MEND_YERPP      ---------------------------------MSTSVFNRRWAALLLEALTRHGVRHIC
MEND_YERPS      ---------------------------------MSTSVFNRRWAALLLEALTRHGVRHIC
MEND_YERE8      ---------------------------------MSTSVFNRRWAALLLEALSRHGVQHIC
MEND_SERP5      ---------------------------------MSTSVFNRRWAALLLEALARHGVRHVC
MEND_PECAS      ---------------------------------MSTSVFNRRWATLLLESLTRHGVRHIC
MEND_PHOLL      ---------------------------------MSNSAFNRRWAELLLEALTRHGLRHVC
MEND_CROS8      ---------------------------------MSTSTFNRRWAGVILEALSRHGVRHLC
MEND_HAEI8      ---------------------------------MSVSVFNRCWSKVILETLVRQGVSHVC
MEND_HAEIG      ---------------------------------MSVSVFNRCWSKVILETLVRQGVSHVC
MEND_HAEIN      ---------------------------------MSVSVFNRCWSKVILETLVRQGVSHLC
MEND_HAEIE      ---------------------------------MSVSVFNRCWSKVILETLVRQGVSHVC
MEND_PASMU      ---------------------------------MSISVFNRCWSKVILETLVRQGVAHFC
MEND_MANSM      ---------------------------------MSVSTFNRCWSKVILETLTRHGVKHFC
MEND_ACTSZ      ---------------------------------MSISTFNRCWSKVILETLVRHNVKHVC
MEND_HAES1      ---------------------------------MSASVFNRCWSKVILETLSRQGVSHFC
MEND_HISS2      ---------------------------------MSASVFNRCWSKVILETLSRQGVSHFC
MEND_ACTP2      ---------------------------------MTVSTFNRTWAKVIVNALLRYGVKHFC
MEND_ACTPJ      ---------------------------------MTVSTFNRTWAKVIVNALLRYGVKHFC
MEND_HAEDU      --------------------------------MSTNSSFNRSWAKVILNALLRYGVKHFC
MEND_PHOPR      -----------------------MTIGTITSQVNYRAALNTLWASLMLEELVRMGVKQIC
MEND_ALIF1      ------------------------------MQPEQQVMLNQVWAELIIEELVRNGVKHIC
MEND_VIBC3      -------------------------------MNRDQALLNRLWSRVLLEELSRLGVTQVC
MEND_VIBCH      -------------------------------MNRDQALLNRLWSRVLLEELSRLGVTQVC
MEND_VIBCB      -------------------------------MSVDQAVLNRIWSETILTELNRFGVNHVC
MEND_VIBPA      -------------------------------MSYDQAVLNRIWSETILTELHRFGVKHVC
MEND_VIBVU      -------------------------------MNHDQAVLNRIWCETLFEELYRFGVRDVC
MEND_VIBVY      -------------------------------MNHDQAVLNRIWCETLFEELYRFGVRDVC
MEND_AERHH      -------------------------MSARQEFASHHATFNHVWSSLLLEELFRLGVRDIA
MEND_AERS4      ------------------------------MFASQHATFNHVWSSLLLEELHRLGVRDIA
MEND_PSYIN      --------------------MITTLYKEPASFAHEFSNINLLWASLFIEELVRNGISDFC
MEND_SHEB5      ------------------------------MRTENTATLNLIWGALILEELARLGVQHVC
MEND_SHEB9      ------------------------------MRTENTATLNLIWGALILEELARLGVQHVC
MEND_SHEB8      ------------------------------MRTENTATLNLIWGALILEELARLGVQHVC
MEND_SHEPC      ------------------------------MRTENTATLNLIWGALILEELARIGVQHVC
MEND_SHESW      ------------------------------MRTENTATLNLIWGALILEELARIGVQHVC
MEND_SHESA      ------------------------------MRTENTATLNLMWGALILEELARLGVQHVC
MEND_SHESM      ------------------------------MRTENTATLNLMWGALILEELARLGVQHVC
MEND_SHESR      ------------------------------MRTENTATLNLMWGALILEELARLGVQHVC
MEND_SHEON      ------------------------------MRTENTATLNLMWGALILEELARLGVQHVC
MEND_SHEHH      ------------------------------MQTEHTAELNLLWGTLILEELARLGVKHVC
MEND_SHEPA      ------------------------------MQTEHTAELNLLWGTLILEELARLGVKHVC
MEND_SHESH      ------------------------------MQIDKTAELNLLWGTLILEELSRLGVQHVC
MEND_SHEWM      ------------------------------MQIEKTAELNLLWGTLILEELSRLGVQHIC
MEND_SHELP      ------------------------------MQIEKTAELNLLWGSLILEELARLEVQHVC
MEND_SHEAM      ----------------------------MDHLHSSTAELNLLWGSLILEELTRHGVMHLC
MEND_SHEFN      ------------------------------MQQQTSADMNLLWGQLILEELARLGVKHVC
MEND_HALHL      ---------------------------------MRTEDLNATWAGSLLDRLRGHGVHDVC
MEND_PELLD      ---------------------------------MNNRQATTIWSAVLVEELIRQNASMFC
MEND_CHLPM      ---------------------------------MNNPQLTTVWSSVMVEELIRQGASFFC
MEND_CHLCH      ---------------------------------MNNRQITTLWSTLLVEALIRQGVDFFC
MEND_CHLPD      ---------------------------------MNNREITSLWSRLIVEELIRQGCGFFC
MEND_CHLTE      ---------------------------------MNSKQITTLWCAVIVEELIRQEAGFFC
MEND_RUBXD      -------------------------------MRDGTPRANRLWGRLLVEELLRCGVGLFC
MEND_SALRD      -------------------------MAHQSWSVLDAPNPTYLWTQLLVEELVRNGVHTFF
MEND_SYNAS      --------------------------------MPLSDNLNLLWSSLIVAELVKNGLDTFF
MEND_DECAR      --------------------------------MTDIGTLNFTWSQAIIGGFVAAGITDAV
MEND_PAEAT      MTSQ-------------------------------DSLTSIGAARIAVTALLDGGVRHVV
MEND_ARTS2      MTSENPLDPNNAYAAADDAPLSEGDPTGAPADSGSDTLTAIQAARVAVKTLLDGGVRYVV
MEND_RENSM      MVNAS-----------------------------VTGIGSMESARRVVEALIRGGVQHVV
MEND_CLAM3      ------------------MTTTGSLPAQPSSTSPRTGNPSTDRALAMLLALVREGVTDVV
MEND_CLAMS      -------------MAAADALPTSSASASASADGPRTGNPSTDRAIAMLLALVREGVTDVV
MEND_LEIXX      -------------------MPDARAADEPAQRLPRTGNPATDYALALLAHLIGAGVRDIV
MEND_KINRD      ------------------------------------MNPSTALATVLVDTLVRLGLRHLV
MEND_NOCSJ      -----------------------------MTAPEPAPESATATARRILAALVEAGVTEIV
MEND_CUTAK      ------------------------------------MNPSTAVARRLVNALVEAGVEHVV
MEND_COREF      -----------------------------------MSVTPAQELAREVIEALSPHITDVV
MEND_CORGB      -----------------------------------MSSTPAQDLARAVIDSLAPHVTDVV
MEND_CORDI      -------------------------------------MTSSPELARAVAATLARHVTDVV
MEND_CORJK      ----------------------------------------MRAGLVLVDQLIRSGVREAV
MEND_MYCA1      ------------------------------------MNPSTTQARVVVDELIRGGVRDVV
MEND_MYCPA      ------------------------------------MNPSTTQARVVVDELIRGGVRDVV
MEND_MYCBO      ------------------------------------MNPSTTQARVVVDELIRGGVRDVV
MEND_MYCBP      ------------------------------------MNPSTTQARVVVDELIRGGVRDVV
MEND_MYCTA      ------------------------------------MNPSTTQARVVVDELIRGGVRDVV
MEND_MYCTU      ------------------------------------MNPSTTQARVVVDELIRGGVRDVV
MEND_MYCUA      ------------------------------------MNPSTTQARVVVDELIRGGVRDVV
MEND_MYCLE      ------------------------------------MNPSTTQARVVVDELIRGGVRDVV
MEND_MYCGI      ------------------------------------MNPSTAQARVVVDELVRGGVRDVV
MEND_MYCVP      ------------------------------------MNPSTAQARVVVDELIRGGVRDVV
MEND_MYCSK      ------------------------------------MNPSTAQARVVVDELVRGGVHDVV
MEND_MYCSS      ------------------------------------MNPSTAQARVVVDELVRGGVHDVV
MEND_MYCSJ      ------------------------------------MNPSTAQARVVVDELVRGGVHDVV
MEND_MYCS2      ------------------------------------MNPSTTQARIVVDELIRGGVRDVV
MEND_NOCFA      ------------------------------------MNPSTAQARVVVDELVRGGVRDVV
MEND_RHOJR      ------------------------------------MNPSTAQATAVVDELVRGGVREVV
MEND_SACEN      ------------------------------------MNPSTAQAEVLVDELVRNGVRQVV
MEND_THEFY      ------------------------------------MNPSTALARVLVDELARLGLTEAV
MEND_HALMA      ---------------------------------MTAPNVNTLWAETLVGELVAGGVDAVC
MEND_NATPD      ---------------------------------MATPNVNTLWGQTVADELATVGIETAV
MEND_HALS3      ---------------------------------MTAPNRNTLWARAIADELAAAGVHAVC
MEND_HALSA      ---------------------------------MTAPNRNTLWARAIADELAAAGVHAVC
MEND_HALWD      ---------------------------------MSAPNQNTLWARTFVSELAASGVDTVC
MEND_ROSCS      -----------------------------------MPNRNILYATTLVDELARAGLRHVC
MEND_ROSS1      -----------------------------------MTNRNIFYATTLVDELARAGLRFVC
MEND_CHLAA      ------------------------------MNVTAHIEALTHWVAAIAQSLAANGVKDVV
MEND_MYXXD      --------------------------------MSSDANLNVLWARALLEELVRGGVRHAV
MEND_SORC5      ---------------------------------MGGSNLHSAWAQLFVRALAQAGVRDLV
MEND_BACSU      ----------------------------------MTVNPITHYIGSFIDEFALSGITDAV
MEND_BACVZ      -----------------------------------MTNPITHYIGSFIDEFALSGVTDAV
MEND_BACLD      ----------------------------------MTENPITKYIGNFIDELSLAGVTEAV
MEND_BACP2      ----------------------------------MNNQIMTTYIGRLMDEFVQGGVQEAV
MEND_BACAH      --------------------------------MNNHIEALSYYLGAFVDELTRLNVCDVV
MEND_BACHK      --------------------------------MNNHIEALSYYLGAFVDELTRLNVCDVV
MEND_BACAN      --------------------------------MNNHIEALSYYLGAFVDELTLLNVCDVV
MEND_BACCZ      --------------------------------MNNHIEALSYYLGAFVDELTRLNVCDVV
MEND_BACC1      --------------------------------MNNHIEALSYYLGAFVDELTRLNVCDVV
MEND_BACCR      --------------------------------MNNHIEALSYYLGAFVDELTRLDVCDVV
MEND_BACCN      --------------------------------MNNHIEALSYYLGAFVDELARLNVCDVV
MEND_GEOKA      -----------------------------------MADALSVYAAALVDGLAQAGVTEAV
MEND_GEOTN      -----------------------------------MTNALSWYVAAFVDGLVQAGVTEAV
MEND_OCEIH      ---------------------------------MDYTEKLTRYVANFVDELAKSGVTDVV
MEND_LISMF      --------------------------------MTNHEQVLTDYLAAFIEELVQAGVKEAI
MEND_LISMO      --------------------------------MTNHEQVLTDYLAAFIEELVQAGVKEAI
MEND_LISIN      --------------------------------MTNHEQVLTDYLAAFIEELVQAGVKEAI
MEND_LISW6      --------------------------------MTNHEQVLTDYLAAFIEELVQAGVKEAI
MEND_ENTFA      ---------------------------------MNHQETMTDYLMAFIEGLKNSGVEQAV
MEND_LACLM      --------------------------------------MTNEYLAPFVDELFNLGVREAV
MEND_LACLS      --------------------------------------MTNEYLAPFVDELFNLGVREAV
MEND_LACLA      --------------------------------------MTNEYLAPFVDELFNLGVREAV
MEND_DESHY      ---------------------------------------MTNYIAALVDELYQLGVREAV
MEND_LEUCK      ----------------------------------MVNDTLTINTKHLLYALYASGVKHFV
MEND_LEUMM      -----------------------------------MTDTLTFNTKHLLEALFESGIRHFI
MEND_STAA1      --------------------------------MGNHKAALTKQVFTFASELYAYGVREVV
MEND_STAA9      --------------------------------MGNHKAALTKQVFTFASELYAYGVREVV
MEND_STAAN      --------------------------------MGNHKAALTKQVFTFASELYAYGVREVV
MEND_STAA2      --------------------------------MGNHKAALTKQVFTFASELYAYGVREVV
MEND_STAAM      --------------------------------MGNHKAALTKQVFTFASELYAYGVREVV
MEND_STAAS      --------------------------------MGNHKAALTKQVFTFASELYAYGVREVV
MEND_STAAW      --------------------------------MGNHKAALTKQVFTFASELYAYGVREVV
MEND_STAA3      --------------------------------MGNHKAALTKQVFTFASELYAYGVREVV
MEND_STAAE      --------------------------------MGNHKAALTKQVFTFASELYAYGVREVV
MEND_STAA8      --------------------------------MGNHKAALTKQVFTFASELYAYGVREVV
MEND_STAAC      --------------------------------MGNHKAALTKQVFTFASELYAYGVREVV
MEND_STAAT      --------------------------------MGNHKAALTKQVFTFASELYAYGVREVV
MEND_STAAB      --------------------------------MGNHKAALTKQVFTFASELYAYGVREVV
MEND_STAAR      --------------------------------MGNHKAALTKQVFTFASELYAYGVREVV
MEND_STAEQ      ---------------------------------MNHSEALTEQVFSFASELYAYGVREVV
MEND_STAES      ---------------------------------MNHSEALTEQVFSFASELYAYGVREVV
MEND_STAHJ      ---------------------------------MNHNEALTKQVYTFASELYAYGVREVV
MEND_STAS1      --------------------------------MNNHTDALTKQVFTIVSELYAYGIREVV
MEND_BACFN      ------------------------------------MYSDKKNILQLVALLRAHGVTKVV
MEND_BACFR      ------------------------------------MYSDKKNILQLVALLRAHGVTKVV
MEND_BACTN      ------------------------------------MYSDKKNILQLVALLEAHGITKVV
MEND_BACV8      ------------------------------------MYSDKKNILQLVALLKAHGVRKIV
MEND_PARD8      ------------------------------------MYSDKKNILQLVALLIEHGVSNIV
MEND_FLAJ1      -----------------------------------MIYPKIALAQSIIEICSAKGIYNII
MEND_FLAPJ      -----------------------------------MIYPKIPLAQSIIEICNTKGLHHIV
MEND_GRAFK      -----------------------------------MKYSKIPVARSVVALCVAKDIKHVV
MEND_PORGI      ---------------------------------MDSDYSDKKGVSVLMDLFEMKGIRKLV
MEND_CYTH3      ----------------------------------------MQAIYDIPEILFQHGVTDVV
MEND_DESPS      -------------------------------------MRAKQHISDLAHHCIAHGMRHLV
MEND_NOSS1      -------------------------------MPIAYKNINQLWAYIFTETLKRLGLAYAV
MEND_TRIV2      -------------------------------MPIAYKNINQLWAYVFTETLKRLGLAYAV
MEND_TRIEI      -------------------------------MSIDFRSLNTVWSSILVETLHHLGLTTAI
MEND_MICAN      -------------------------------MSIDFRNLNTLWGSILVETLARLGLKIGV
MEND_ACAM1      -------------------------------MTLDFRNVNMLWSSIIAETLSRLGLTTAI
MEND_SYNJA      ----------------------MTGANSL--QRLDWRNLNTLWGSILAETLSRLGCRVAV
MEND_SYNJB      ----------------------MTGENFVLPRRLDWRNLNTLWGSLLAETLSRLGCRLAV
MEND_SYNP6      -----------------------MGQAAAITMPIDPRNLNTLWSSVLAESFVRLGLQTVV
MEND_SYNE7      -----------------------MGQAAAITMPIDPRNLNTLWSSVLAESFVRLGLQTVV
MEND_THEEB      --------------------------------MILTENLNVLWASVLFETLYRLGLRTVV
MEND_SYNY3      --------------------------------MVDFTNPNTLAASVLVETLFRLGLQQAV
MEND_BDEBA      -------------------------------------MTNMELAAKVIQELVHTGVREFI
MEND_PARUW      --------------------------------------MNHELALHVIEQALQYGIKEFC
MEND_PROM0      -------------------------------MTSSIECQNFLRSLQLLNLLIKIGVQNLI
MEND_PROM2      -------------------------------MTSSIECKNFLRSLQLLNLLIKIGVQNLI
MEND_PROM9      -------------------------------MTSSIECKNFLRSLQLLNLLIKIGVQNLI
MEND_PROMS      -------------------------------MTSSIECKNFLRSLQLLNLLIKIGVKNLI
MEND_PROM5      -------------------------------MTSSIECQNIFRSLQLLDLFIKIGVKNLI
MEND_PROMP      -------------------------------MTSHIECQNFFRSLQLLDLFTKIGVKNLI
MEND_PROM1      -------------------------------MTISLARYNFFISLELLKTLVAKGVKYFV
MEND_PROMT      -------------------------------MTISLARYNFFISLELLKTLVAKGVKYFV
MEND_PROMA      -----------------------------------------------MRAFQRYGLEHIV
MEND_PROM3      -----------------------------------------------------MGLRHLV
MEND_PROMM      -----------------------------------------------------MGLRHLV
MEND_SYNPW      --------------------------------------------MSLLAHLQHQGLRQIV
MEND_SYNS3      ----------------------------------------------MLQTLQQQGLRHVV
MEND_SYNPX      -------------------------------------------------------MTRLV
MEND_SYNSC      ----------------------------------------MQAALTLLEALCLQGLKQLV
MEND_SYNS9      -----------------------------------------------MQGLIELGLRRLV
MEND_SYNR3      --------------------------------MSIEAAENLRAAEALLSALMGLGLQRVV
                                                                            

MEND_ECOLI      IAPGSRSTPLTLAAAENSA----FIHHTHFDERGLGHLALGLAKVSKQPVAVIVTSGTAV
MEND_ECOHS      IAPGSRSTPLTLAAAENSA----FIHHTHFDERGLGHLALGLAKVSKQPVAVIVTSGTAV
MEND_ECOLC      IAPGSRSTPLTLAAAENSA----FIHHTHFDERGLGHLALGLAKVSKQPVAMIVTSGTAV
MEND_SHIF8      IAPGSRSTPLTLAAAENSA----FIHHTHFDERGLGHLALGLAKVSKQPVAVIVTSGTAV
MEND_SHIFL      IAPGSRSTPLTLAAAENSA----FIHHTHFDERGLGHLALGLAKVSKQPVAVIVTSGTAV
MEND_ECO24      IAPGSRSTPLTLAAAENSA----FIHHTHFDERGLGHLALGLAKVSKQPVAVIVTSGTAV
MEND_SHIBS      IAPGSRSTPLTLAAAENSA----FIHHTHFDERGLGHLALGLAKVSKQPVAVIVTSGTAV
MEND_ECO57      IAPGSRSTPLTLAAAENSA----FIHHTHFDERGLGHLALGLAKVSKQPVAVIVTSGTAV
MEND_SHISS      IAPGSRSTPLTLAAAENSA----FIHHTHFDERGLGHLALGLAKVSKQPVAVIVTSGTAV
MEND_ECOK1      IAPGSRSTPLTLAAAENSA----FIHHTHFDERGLGHLALGLAKVSKQPVAVIVTSGTAV
MEND_ECOL6      IAPGSRSTPLTLAAAENSA----FIHHTHFDERGLGHLALGLAKVSKQPVAVIVTSGTAV
MEND_ECOL5      IAPGSRSTPLTLAAAENSA----FIHHTHFDERGLGHLALGLAKVSKQPVAVIVTSGTAV
MEND_ECOUT      IAPGSRSTPLTLAAAENSA----FIHHTHFDERGLGHLALGLAKVSKQPVAVIVTSGTAV
MEND_ECOSM      IAPGSRSTPLTLAAAENSA----FIHHTHFDERGLGHLALGLAKVSKQPVAVIVTSGTAV
MEND_SHIDS      IAPGSRSTPLTLAAAENSA----FIHHTHFDERGLGHLALGLAKVSKQPVAVIVTSGTAV
MEND_SALCH      IAPGSRSTPLTLAAAENPA----FIHHTHFDERGLGHLALGLAKVSQQPVAVIVTSGTAV
MEND_SALTY      IAPGSRSTPLTLAAAENPA----FIHHTHFDERGLGHLALGLAKVSQQPVAVIVTSGTAV
MEND_SALPA      IAPGSRSTPLTLAAAENPA----FIHHTHFDERGLGHLALGLAKVSQQPVAVIVTSGTAV
MEND_SALPB      IAPGSRSTPLTLAAAENPA----FIHHTHFDERGLGHLALGLAKVSQQPVAVIVTSGTAV
MEND_SALTI      IAPGSRSTPLTLAAAENPA----FIHHTHFDERGLGHLALGLAKVSQQPVAVIVTSGTAV
MEND_SALAR      IAPGSRSTPLTLAAAENPA----FIHHTHFDERGLGHLALGLAKASKQPVAVIVTSGTAV
MEND_CITK8      IAPGSRSTPLTLAAAENSA----FIHHTHFDERGLGHLALGLAKVSKQPVAVIVTSGTAV
MEND_KLEP7      IAPGSRSTPLTLAAAENRA----FIHHTHFDERGLGHLALGLAKASRQPVAVIVTSGTAT
MEND_ENT38      IAPGSRSTPLTLAAAENRA----FIHHTHFDERGLGHLALGLAKVSKAPVAVIVTSGTAV
MEND_YERPA      IAPGSRSTPLTLAAAANPS----LVCHTHFDERGLGHLALGLAKASTEPVAVIVTSGTAV
MEND_YERPE      IAPGSRSTPLTLAAAANPS----LVCHTHFDERGLGHLALGLAKASTEPVAVIVTSGTAV
MEND_YERPN      IAPGSRSTPLTLAAAANPS----LVCHTHFDERGLGHLALGLAKASTEPVAVIVTSGTAV
MEND_YERPP      IAPGSRSTPLTLAAAANPS----LVCHTHFDERGLGHLALGLAKASTEPVAVIVTSGTAV
MEND_YERPS      IAPGSRSTPLTLAAAANPS----LVCHTHFDERGLGHLALGLAKASTEPVAVIVTSGTAV
MEND_YERE8      IAPGSRSTPLTLAAAANPS----LVCHTHFDERGLGHLALGLAKASTEPVAVIVTSGTAA
MEND_SERP5      IAPGSRSTPLTLAAAANKS----FICHTHFDERGLGHLALGLAKASREPVAVIVTSGTAA
MEND_PECAS      IAPGSRSTPLTLSAADNHA----LICHTHFDERGLGHLALGLAKASREPVAIIVTSGTAA
MEND_PHOLL      IAPGSRSTPLTIAAAANNK----LICHTHFDERGLGHLALGLSKASREPVAVIVTSGTAV
MEND_CROS8      IAPGSRSTPLTLAAAQHPA----FTPHTHFDERGLGHLALGLAKASGEPVAVIVTSGTAV
MEND_HAEI8      IAPGSRSTPLTLEAVRLQNAGS-VTCHTHFDERGLGFFALGIAKATQSPVAIIVTSGTAT
MEND_HAEIG      IAPGSRSTPLTLEAVRLQNAGS-VTCHTHFDERGLGFFALGIAKATQSPVAIIVTSGTAT
MEND_HAEIN      IAPGSRSTPLTLEAVRLQNAGA-VTCHTHFDERGLGFFALGIAKATQSPVAIIVTSGTAT
MEND_HAEIE      IAPGSRSTPLTLEAVRLQNAGS-VTCYTHFDERGLGFFALGIAKATQSPVAIIVTSGTAT
MEND_PASMU      IAPGSRSTPLTLEAIRLQDSHR-VTCHTHFDERGLGFFALGLAKVSKKPVAVIVTSGTAA
MEND_MANSM      IAPGSRSTPLTLEANRLQEQRR-ALCHTHFDERGLGFFALGLAKSSQTPVAIIVTSGTAA
MEND_ACTSZ      IAPGSRSTPLTLEAVRLQERGE-VRCHTHFDERGLGFLALGMAKSTNSPVAVIVTSGTAA
MEND_HAES1      IAPGSRSTPLTLEAIRLQENGR-GTCHAHFDERSLGFFALGIAKASKKPVAVIVTSGTAT
MEND_HISS2      IAPGSRSTPLTLEAIRLQENGR-GTCHTHFDERGLGFFALGIAKASKKPVAVIVTSGTAT
MEND_ACTP2      IAPGSRSTPLTLEALQLQQNQQ-AQCHSHFDERGLGFFALGIAKVTNDPVAIIVTSGTAV
MEND_ACTPJ      IAPGSRSTPLTLEALQLQQNQQ-AQCHSHFDERGLGFFALGIAKVTNDPVAIIVTSGTAV
MEND_HAEDU      IAPGSRSTPLTLEALQLQHTQQ-AECHSHFDERGLAFFALGMAKATNDPVAIIVTSGTAV
MEND_PHOPR      IAPGSRSTSLTLAAVANNK----LTIHTHFDERGLGFLALGIAKASQEPVAVVVTSGTAV
MEND_ALIF1      IAPGSRSTPLTLAASEHAL----LSIHTHFDERGLGFLALGIAKASNDPVAVIVTSGTAV
MEND_VIBC3      VAPGSRSTPLTLEANANTA----FTLHTHYDERGLGFMALGLAKASQQPVAVIVTSGTAV
MEND_VIBCH      VAPGSRSTPLTLEANANTA----FTLHTHYDERGLGFMALGLAKASQQPVAVIVTSGTAV
MEND_VIBCB      IAPGSRSTPLTVEAADNPN----FTIHTHFDERGLGFMALGLAKASKEPVALIVTSGTAV
MEND_VIBPA      IAPGSRSTPLTLEAAEQPN----FSIHTHFDERGLGFMALGLAKASQEPVAVIVTSGTAV
MEND_VIBVU      VAPGSRSTPLALEANAHTR----LKLHTHFDERGLGFLALGLAKASQRPVAVVVTSGTAV
MEND_VIBVY      VAPGSRSTPLALEANAHTS----LKLHTHFDERGLGFLALGLAKASQRPVAVVVTSGTAV
MEND_AERHH      LASGSRSAPLTMAAAAHPG----FRRHLHFDERGLGFMALGLAKGSGRPVAVIMTSGTAV
MEND_AERS4      LASGSRSAPLTMAAAAHAG----FRRHLHFDERGLGFMALGLAKGSGRPVAVIMTSGTAV
MEND_PSYIN      IAPGSRSTPLTLAADQHTE----AHTHVHFDERGLGFLALGLSLFSHKPVVIITTSGTAV
MEND_SHEB5      MAPGSRSTPLTLAAAQQTK----LQRHLHFDERGLGFMALGLAKASRAPVAIITTSGTAV
MEND_SHEB9      MAPGSRSTPLTLAAAQQTK----LQRHLHFDERGLGFMALGLAKASRAPVAIITTSGTAV
MEND_SHEB8      MAPGSRSTPLTLAAAQQTK----LQRHLHFDERGLGFMALGLAKASRAPVAIITTSGTAV
MEND_SHEPC      MAPGSRSTPLTLAAAQQTK----LKRHLHFDERGLGFMALGLAKASRAPVAIITTSGTAV
MEND_SHESW      MAPGSRSTPLTLAAAQQTK----LKRHLHFDERGLGFMALGLAKASRAPVAIITTSGTAV
MEND_SHESA      MAPGSRSTPLTLAAAQQTK----LKRHLHFDERGLGFMALGLAKASCAPVAIITTSGTAV
MEND_SHESM      MAPGSRSTPLTLAAAQQTK----LKRHLHFDERGLGFMALGLAKASCAPVAIITTSGTAV
MEND_SHESR      MAPGSRSTPLTLAAAQQTK----LKRHLHFDERGLGFMALGLAKASGAPVAIITTSGTAV
MEND_SHEON      MAPGSRSTPLTLAAAKQTK----LKRHLHFDERGLGFMALGLAKASSAPVAIITTSGTAV
MEND_SHEHH      MAPGSRSTPLTLAAAKQSK----LSQHIHFDERGLGFMALGLAKASQAPVAIITTSGTAV
MEND_SHEPA      MAPGSRSTPLTLAAAKQTK----LSQHIHFDERGLGFMALGLAKASQAPVAIITTSGTAV
MEND_SHESH      MAPGSRSTPLTLAAAKQSK----LKQHLHFDERGLGFMALGLAKTSHAPVAIITTSGTAV
MEND_SHEWM      MAPGSRSTPLTLAAAKQSK----LKQHLHFDERGLGFMALGLAKASQAPVAVVTTSGTAV
MEND_SHELP      MAPGSRSTPLTLAAAKQTK----LKQHLHFDERGLGFLALGLAKASRAPVAIITTSGTAV
MEND_SHEAM      MAPGSRSTPLTLAAAAQDK----LTRHLHFDERGLGFLALGLAKASQAPVAIITTSGTAV
MEND_SHEFN      MAPGSRSTPLTLAAASQTQ----LTRHIHFDERGLGFMALGLAKASNAPVAIITTSGTAV
MEND_HALHL      IAPGSRSAPLALAAARRADRGDDLTLHTHFDERGLAFYALGLIRASRRPVAVITTSGTAA
MEND_PELLD      ISPGSRSTPLTAAVARNPR----ASWKMFPDERSAGFFALGHARATGRPAVLVCTSGTAV
MEND_CHLPM      ISPGSRSTPLTAAIARNPE----ASWKMFPDERSAGFFALGHARATGFPAVLVCTSGTAV
MEND_CHLCH      ISPGSRSTPLTIAAARNPR----ARTKLFADERSAAFFALGYARATEMVAPLICTSGTAV
MEND_CHLPD      LSPGSRSTPLTVAVARNPM----AKWKTFPDERSAGFFALGHARATGKPAILICTSGTAV
MEND_CHLTE      ISPGSRSTPLTLAVASNPK----ARFRMFPDERSAGFYALGYARATGMPAVLVCTSGTAV
MEND_RUBXD      VAPGSRSTPLVAAIAEHPR----ARALVHYDERGTAFAALGYARATGRPAAWVTTSGTAV
MEND_SALRD      VAPGSRSTPLTVAIARHPE----AESVLHVDERGAAFAALGVGRAARGPAAWVTTSGTAV
MEND_SYNAS      ISPGNRNAPLISALIHEER----SVKKICVDERAAGYRALGHAKAAGRPGVLVCTSGTAP
MEND_DECAR      ISPGSRSTPLALAMLRQAG----LRCHIAIDERSAAFFGLGLAKSSHCPVLLLATSGTAP
MEND_PAEAT      VAPGSRSAPMAYALAEAEAAGR-VRLHVRIDERDAGFTALGLALSTEAPVAVVTTSGTAV
MEND_ARTS2      VSPGSRSAPMAYALAEADAAGR-VELLVRIDERSAGFTALGLALSTGAPVAVLTTSGTAV
MEND_RENSM      VSPGSRNAPLVYALAEAQQA---IHVVVRIDERSAGFTALGLAIGSSSPVAVLTTSGTAV
MEND_CLAM3      LCPGSRSQALALVAAELERVDG-VRLHVRIDERAAGFLALGLGVESGRPAPVITTSGTAV
MEND_CLAMS      LCPGSRSQALALVAAELERVDG-VRLHVRIDERAAGFLALGLGVESGRPAPVITTSGTAV
MEND_LEIXX      VSPGSRSQALALAAAELERAGA-VRLHVRLDERVGGFLALGIGRETGAPAAVVTTSGTAT
MEND_KINRD      LSPGSRSAPLAYAAARAADEGR-LTLHVRVDERSAGFLALGLAR-AGELVAVVTTSGTAV
MEND_NOCSJ      VAPGSRNAPLSFAAYDAAAAGL-VRLHTRLDERTAGFLALGLTR-SGRRAAVVCTSGTAV
MEND_CUTAK      YCPGSRDAPIGYALADAETAGW-LRVYVRLDERSAGFVALGLGR-AGCPAALVTTSGTAV
MEND_COREF      LCPGSRNSPLSLEVLSRED----LRVHVRIDERSAAFLALGLARVQRRPVPVIMTSGTAV
MEND_CORGB      LCPGSRNSPLSLELLARQD----LRVHVRIDERSASFLALSLARTQARPVAVVMTSGTAV
MEND_CORDI      ICPGSRNSPLSLELIARDD----IRVHTRIDERSAAFLALGLARSSKRHVAVVTTSGTAV
MEND_CORJK      LCPGSRNSPLNLAFVEAERVGR-VRLHVRTDERSAAFLALGLAKVSRRPVPVVMTSGTAV
MEND_MYCA1      LCPGSRNAPLAFALADADRAGR-IRLHVRIDERTAGYLAIGLAIAAGAPVCVAMTSGTAV
MEND_MYCPA      LCPGSRNAPLAFALADADRAGR-IRLHVRIDERTAGYLAIGLAIAAGAPVCVAMTSGTAV
MEND_MYCBO      LCPGSRNAPLAFALQDADRSGR-IRLHVRIDERTAGYLAIGLAIGAGAPVCVAMTSGTAV
MEND_MYCBP      LCPGSRNAPLAFALQDADRSGR-IRLHVRIDERTAGYLAIGLAIGAGAPVCVAMTSGTAV
MEND_MYCTA      LCPGSRNAPLAFALQDADRSGR-IRLHVRIDERTAGYLAIGLAIGAGAPVCVAMTSGTAV
MEND_MYCTU      LCPGSRNAPLAFALQDADRSGR-IRLHVRIDERTAGYLAIGLAIGAGAPVCVAMTSGTAV
MEND_MYCUA      LCPGSRNAPLAFALQDADRSGR-IRLHVRIDERTAGFLAIGLAVGAGAPACVAMTSGTAV
MEND_MYCLE      LCPGSRNAPLAFALQDADHAGR-IRLHVRIDERTAGYLAIGLAVAAGAPVCVAMTSGTAV
MEND_MYCGI      LCPGSRNAPLAFALHDADRAGR-LRLHVRIDERTAGFLAIGLAVAERAPVCVAMTSGTAV
MEND_MYCVP      LCPGSRNAPLAFALHDADRAGR-LRLHVRIDERTAGFLAIGLAVAERAPVCVAMTSGTAV
MEND_MYCSK      LCPGSRNAPLAFALADADRAGR-LRLHVRIDERTAGFLAIGLAVADRAPVCVAMTSGTAV
MEND_MYCSS      LCPGSRNAPLAFALADADRAGR-LRLHVRIDERTAGFLAIGLAVADRAPVCVAMTSGTAV
MEND_MYCSJ      LCPGSRNAPLAFALADADRAGR-LRLHVRIDERTAGFLAIGLAVADRAPVCVAMTSGTAV
MEND_MYCS2      LCPGSRNAPLAFALSDADRAGR-IRLHVRIDERTAGYLAIGLAVAERAPVCIAMTSGTAV
MEND_NOCFA      LCPGSRNAPLAFALQAADAAGR-LRLHMRIDERTAGFLAIGLAISAGAPVPVVMTSGTAV
MEND_RHOJR      LCPGSRNAPLAFALQAADLEGR-LRLHMRIDERTAGFLALGLAVAGKRPVPIVMTSGTAV
MEND_SACEN      LAPGSRNAPLSFALHDAAEAGR-LDLHVRIDERSAGFLALGIATRTRRPVVVVCTSGTAA
MEND_THEFY      IAPGSRSTPLALALV---ADTR-IRTHVRIDERSASFLAVGLARASRRPVALVCTSGTAA
MEND_HALMA      LSPGSRSTPLTVAFAEHPD----IEVFSHLDERSAAFFALGRARRTGEPTPLVCTSGTAA
MEND_NATPD      LAPGSRSTPLAVAFAQHDD----IEAVSLLDERSAAFFALGYAKRTGQPAPLVCTSGTAL
MEND_HALS3      VCPGSRSTPLTVAVDAHDD----LTVYSHLDERSAAFFALGRGKRTGAPTAVLTTSGTAT
MEND_HALSA      VCPGSRSTPLTVAVDAHDD----LTVYSHLDERSAAFFALGRGKRTGAPTAVLTTSGTAT
MEND_HALWD      ISPGSRSTPLTVAFDRHDS----IETFSHLDERSAAYFALGRARRTGSVTPVVCTSGTAA
MEND_ROSCS      LAPGSRNTPLVLAFARHPA----IRVFSHLDERSAAFFALGLALATDTPAAVVCTSGSAA
MEND_ROSS1      LAPGSRNTPLVLACARHPA----IKVFSHLDERSAAFFALGLALATDTPAAVVCTSGSAA
MEND_CHLAA      VCPGSRSTPLALAVARHPS----LRVWMHLDERSAGFFALGMARARGMPAAVLCTSGTAV
MEND_MYXXD      VCPGSRSSPLALACAGTEG----LRTWSVIDERSAGFFALGLAKQSRAPAVVVATSGTAG
MEND_SORC5      LCPGSRSTPLAIAAMESEE----VRCHSVVDERAAAFFALGQARVTGRPSVFVCTSGTAG
MEND_BACSU      VCPGSRSTPLAVLCAAHPD----ISVHVQIDERSAGFFALGLAKAKQRPVLLICTSGTAA
MEND_BACVZ      VCPGSRSTPLAVLAAAHPD----IQVHIQIDERSAGFFALGLAKARQRPVMLICTSGTAA
MEND_BACLD      ICPGSRSTPLAILAASHPD----INVHIHVDERSAAFFAMGMAKAMRKPVALICTSGTAA
MEND_BACP2      VCPGSRSTPLAMLALAHQD----INVHVLVDERSAAFYALGLAKASQTPVLLICTSGTAA
MEND_BACAH      ISPGSRSTPIALLMEQHEG----MNTYLHVDERSAGFFALGIAKAKKRPVALLCTSGTAA
MEND_BACHK      ISPGSRSTPIALLMEQHEG----MNTYLHVDERSAGFFALGIAKAKKRPVALLCTSGTAA
MEND_BACAN      ISPGSRSTPIALLMEQHEG----MNTYLHVDERSAGFFALGIAKAKKRPVALLCTSGTAA
MEND_BACCZ      ISPGSRSTPIALLMEQHEG----MNTYLHVDERSAGFFALGIAKAKKRPVALLCTSGTAA
MEND_BACC1      ISPGSRSTPIALLMEQHEG----MNTYLHVDERSAGFFALGIAKAKKRPVALLCTSGTAA
MEND_BACCR      ISPGSRSTPIALLMEQHEG----MNTYLHVDERSAGFFALGIAKAKKRPVALLCTSGTAA
MEND_BACCN      ISPGSRSTPLALLMEQHEQ----IKTYLHVDERSAAFFALGMAKAKKQPVAILCTSGTAA
MEND_GEOKA      ISPGSRSTPLAMAMAAHPG----LRLYMNIDERSAAFFALGLAKAKQRPVALVCTSGTAA
MEND_GEOTN      ISPGSRSTPLAMAMAAHSG----LHFSMHIDERSAAFFALGMVKAKQRPVALVCTSGTAA
MEND_OCEIH      VSPGSRSTPLALVFTEHPS----IKEWIIVDERSAAFFALGLAKKSNRAVAIVCTSGTAA
MEND_LISMF      ISPGSRSTPLALMMAEHPI----LKIYVDVDERSAGFFALGLAKASKRPVVLLCTSGTAA
MEND_LISMO      ISPGSRSTPLALMMAEHPI----LKIYVDVDERSAGFFALGLAKASKRPVVLLCTSGTAA
MEND_LISIN      ISPGSRSTPLALMMAEHPT----LKIYVDVDERSAGFFALGLAKASKRPVVLLCTSGTAA
MEND_LISW6      ISPGSRSTPLALMMAEHPI----LKIYVDVDERSAGFFALGLAKASKRPVVLLSTSGTAA
MEND_ENTFA      ISPGSRSTPLALLLHRETA----IQTFVDVDERSAAFFALGLSKASQKPVVLLCTSGTAA
MEND_LACLM      FSPGSRSTALAMLFEEYKK----YDTYVNIDERSAAFFALGIAKANRRPVVLVCTSGSAA
MEND_LACLS      FSPGSRSTALAMLFEEYKK----YDTYVNIDERSAAFFALGIAKANRRPVVLVCTSGSAA
MEND_LACLA      FSPGSRSTALAMLFEEYKK----YDTYVNIDERSAAFFALGIAKAKKRPVVLVCTSGSAA
MEND_DESHY      ISPGSRSTPLSVLFCEYG-----FQVYVGIDERSAGFFALGIAKEKERPVVLVCSSGSAV
MEND_LEUCK      VSPGSRTTPIALMLAEYERQNSEIVVYIDVDERSAGFFALGIAKTRQEPVVVLGTSGTAI
MEND_LEUMM      VSPGSRSTPIALLLAEYAEQNNEIKLFVDVDERSAGFFALGIAKTLLEPVVLLGTSGTAI
MEND_STAA1      ISPGSRSTPLALAFEAHP----NIKTWIHPDERSAAFFAVGLIKGSERPVAILCTSGTAA
MEND_STAA9      ISPGSRSTPLALAFEAHP----NIKTWIHPDERSAAFFAVGLIKGSERPVAILCTSGTAA
MEND_STAAN      ISPGSRSTPLALAFEAHP----NIKTWIHPDERSAAFFAVGLIKGSERPVAILCTSGTAA
MEND_STAA2      ISPGSRSTPLALAFEAHP----NIKTWIHPDERSAAFFAVGLIKGSERPVAILCTSGTAA
MEND_STAAM      ISPGSRSTPLALAFEAHP----NIKTWIHPDERSAAFFAVGLIKGSERPVAILCTSGTAA
MEND_STAAS      ISPGSRSTPLALAFEAHP----NIKTWIHPDERSAAFFAVGLIKGSERPVAILCTSGTAA
MEND_STAAW      ISPGSRSTPLALAFEAHP----NIKTWIHPDERSAAFFAVGLIKGSERPVAILCTSGTAA
MEND_STAA3      ISPGSRSTPLALAFEAHP----NIKTWIHPDERSAAFFAVGLIKGSERPVAILCTSGTAA
MEND_STAAE      ISPGSRSTPLALAFEAHP----NIKTWIHPDERSAAFFAVGLIKGSERPVAILCTSGTAA
MEND_STAA8      ISPGSRSTPLALAFEAHP----NIKTWIHPDERSAAFFAVGLIKGSERPVAILCTSGTAA
MEND_STAAC      ISPGSRSTPLALAFEAHP----NIKTWIHPDERSAAFFAVGLIKGSERPVAILCTSGTAA
MEND_STAAT      ISPGSRSTPLALAFEAHP----NIKTWIHPDERSAAFFAVGLIKGSERPVAILCTSGTAA
MEND_STAAB      ISPGSRSTPLALAFEAHP----NIKTWIHPDERSAAFFAVGLIKGSERPVAILCTSGTAT
MEND_STAAR      ISPGSRSTPLALAFEAHP----NIKTWIHPDERSAAFFAVGLIKGSERPVAILCTSGTAA
MEND_STAEQ      ISPGSRSTPLALVFEAHP----NIKTWIHPDERSAAFFALGLIKGSEKPVAILCTSGTAA
MEND_STAES      ISPGSRSTPLALAFEAHP----NIKTWIHPDERSAAFFALGLIKGSEKPVAILCTSGTAA
MEND_STAHJ      ISPGSRSTPLAIAFEAHP----NIKTWIHPDERSAAFFALGLIKGSERPVAILCTSGTAA
MEND_STAS1      ISPGSRSTPLAIAIEAHP----KLKSWIHPDERSAAFFAMGLMKGSEKPVAILCTSGSAA
MEND_BACFN      LCPGSRNAPIVHTLAGHPD----FTCYSVTDERSAGFFAIGLALQGGTPAAVCCTSGTAL
MEND_BACFR      LCPGSRNAPIVHTLAGHPD----FTCYSVTDERSAGFFAIGLALQGGTPAAVCCTSGTAL
MEND_BACTN      LCPGSRNAPIVHTLSTHPG----FTCYAMTDERSAGYFAIGLALNGGHPAAVCCTSGTAL
MEND_BACV8      LCPGSRNAAIVHTLANIED----FTCYSVTDERSAGFFAIGLSLQGGGPAAVCCTSGSAL
MEND_PARD8      LCPGSRNSPIVHTLANHSF----FNCHSVTDERSAGFFAVGLALHGGKPAAVCCTSGTAL
MEND_FLAJ1      ISPGSRNAPLTIGFAQNPN----FKCYSIADERCAAFFALGIAQQTQKPAAVVCTSGSAL
MEND_FLAPJ      ISPGSRNAPLTIGFTNNPV----FTCYSIADERCAAFFALGIAQQLKKPVALVCTSGSAL
MEND_GRAFK      ISPGSRNAPLTIGFTHHDE----ITPYSIVDERCAAFFALGLAQELKKPVALVCTSGSAL
MEND_PORGI      MSPGSRNAPLLFSFSRNPA----FEKYVIADERSAGFFALGLALASGEAVGLVCTSGTAM
MEND_CYTH3      LSPGSRCAPLSIAFSRHKK----LQIKVVPDERSAAFIALGMSLQTQKPTVLICTSGSAL
MEND_DESPS      ISPGSRNAPLIRAFAASSQ----IECLSIVDERSAAFVALGLATELQAPVGVLCTSGTAL
MEND_NOSS1      ICPGSRSTPLAVAFAQQA---PNIEAISILDERSAAFFALGIAKATNRPVAIVCTSGTAG
MEND_TRIV2      ICPGSRSTPLAVAFAQQA---PDIEGISILDERSAAFFALGLAKATNRPVAIVCTSGTAG
MEND_TRIEI      ISPGYRSTPLTFAFATH----PKIETIPILDERSAAFFALGIAKKNYQPIVIVCTSGTAA
MEND_MICAN      VSPGSRSTPLTIALARH----PQIEAIPILDERSAAFFALGLAKQLYQPVVLVCTSGTAT
MEND_ACAM1      ICPGSRSGPLAVAFAQH----PDIEAIPVLDERSAAFFGLGIARRKGLPVVLVCTSGTAG
MEND_SYNJA      VCPGSRSAPLTYALAQH----PEIEAIPAVDERSAAFFALGLAQQTRQPIPLVCTSGSAG
MEND_SYNJB      VSPGSRSAPLTYALAQH----PNIEAIPVLDERSAAFFALGLAQQTRQPIPLVCTSGSAG
MEND_SYNP6      ICPGSRSAPLAIAFAEH----PEIDAIPILDERSAGFFALGRAKASHRPVALICSSGTAG
MEND_SYNE7      ICPGSRSAPLAIAFAEH----PEIDAIPILDERSAGFFALGRAKASHRPVALICSSGTAG
MEND_THEEB      LSPGSRSGPLAIAAAAH----PHLEALPILDERSAAFFALGLVQQQGRPVALLCTSGTAA
MEND_SYNY3      ICPGSRSSPLTVALARH----GGIDCVVSLDERSASFFALGHGKRTGQPVALVCTSGTAA
MEND_BDEBA      LCAGARN---SPMVHILDEC-KNLKVYSFFEERAAGFFALGRIASTRRPVAVITTSGTAV
MEND_PARUW      VAPGARN---AAFVYLLAQI-PTIKVYYWSEERSAAFFAVGRIKATHQPIAVVTTSGTAV
MEND_PROM0      LCPGSRSAPLAIAAGELNKL-GMVNIFNSIDERSAGFHSLGISAASGNLSLVITTSGTAV
MEND_PROM2      VCPGSRSAPLAIAAGELNKL-GLVNIFNSIDERSAGFHSLGISAASGNLSLVITTSGTAV
MEND_PROM9      VCPGSRSAPLAIAAGELNKL-GLVNIFNSIDERSAGFHSLGISAASGNLSLVITTSGTAV
MEND_PROMS      LCPGSRSAPLAIAAGELNKL-GLVNIFNSIDERSAGFHSLGISAASGHLSLVITTSGTAV
MEND_PROM5      LCPGSRSAPLAIAAGELYKY-GILNVFNSIDERSAGFHSLGISTASGDISLVVTTSGSAV
MEND_PROMP      LCPGSRSGPLAIAAGELNKR-RVLNVFNSIDERSAGFHSLGISTASGDVSLVVTTSGTAV
MEND_PROM1      LCPGSRSGPLALAAASLSKR-KELTLITSIDERSAAFLALGISAASGQVSCVITTSGSAV
MEND_PROMT      LCPGSRSGPLALAAASLSKR-KELTLITSIDERSAAFLALGISAASGQVSCVITTSGSAV
MEND_PROMA      LCPGSRSAPLALAVGALIEE-SGINAYTAIDERSAAFMAIGISAASGKATIVITTSGTAV
MEND_PROM3      LCPGSRSGPLALAAGGMART-NLLRLSTAIDERSAAFLALGFSTATGTAAAVVTTSGTAV
MEND_PROMM      LCPGSRSGPLALAAGGMART-NRLRLSTAIDERSAAFLALGFSTATGTAAAVVTTSGTAV
MEND_SYNPW      LCPGSRSAPLALAAGGLARQ-GELTLVTAIDERSAAFHALGLAQASGRATAVITTSGTAV
MEND_SYNS3      LCPGSRSGPLALAAAGLMRA-GLITLSTAIDERSAGFYALGRSSASGVATAVITTSGTAV
MEND_SYNPX      LCPGSRSGPLAAAAGLLAAR-GDLALTTAIDERSAAFLALGMATAGGRAVAVVTTSGTAV
MEND_SYNSC      LCPGSRSGPLATAAGVLASQ-AKLQLVTAIDERSAAFLALGMATAHGRVVAVVTTSGTAV
MEND_SYNS9      LCPGSRSGSLATAAGLLASS-GQLQLNTAIDERSAAFLALGLATAGGSAVAVVTTSGTAV
MEND_SYNR3      LCPGSRSGPLALAASRLESH-G-LALTTGIDERSAGFFALGQTRADGQPTAVITTSGTAV
                 ..* *                        :**  .. .:.             :**:* 

MEND_ECOLI      ANLYPALIEAGLTGEKLILLTADRPPELIDCGANQAIR-QPGMFASHPTHSISLPRPTQD
MEND_ECOHS      ANLYPALIEAGLTGEKLILLTADRPPELIDCGANQAIR-QPGMFASHPTHSISLPRPTQD
MEND_ECOLC      ANLYPALIEAGLTGEKLILLTADRPPELIDCGANQAIR-QPGMFASHPTHSISLPRPTQD
MEND_SHIF8      ANLYPALIEAGLTGEKLILLTADRPPELIDCGANQAIR-QPGMFASHPTHSISLPRPTQD
MEND_SHIFL      ANLYPALIEAGLTGEKLILLTADRPPELIDCGANQAIR-QPGMFASHPTHSISLPRPTQD
MEND_ECO24      ANLYPALIEAGLTGEKLILLTADRPPELIDCGANQAIR-QPGMFASHPTHSISLPRPTQD
MEND_SHIBS      ANLYPALIEAGLTGEKLILLTADRPPELIDCGANQAIR-QPGMFASHPTHSISLPRPTQD
MEND_ECO57      ANLYPALIEAGLTGEKLILLTADRPPELIDCGANQAIR-QPGMFASHPTHSISLPRPTQD
MEND_SHISS      ANLYPALIEAGLTGEKLILLTADRPPELIDCGANQAIR-QPGMFASHPTHSISLPRPTQD
MEND_ECOK1      ANLYPALIEAGLTGEKLILLTADRPPELIDCGANQAIR-QPGMFASHPTHSISLPRPTQD
MEND_ECOL6      ANLYPALIEAGLTGEKLILLTADRPPELIDCGANQAIR-QPGMFASHPTHSISLPRPTQD
MEND_ECOL5      ANLYPALIEAGLTGEKLILLTADRPPELIDCGSNQAIR-QPGMFASHPTHSISLPRPTQD
MEND_ECOUT      ANLYPALIEAGLTGEKLILLTADRPPELIDCGANQAIR-QPGMFASHPTHSISLPRPTQD
MEND_ECOSM      ANLYPALIEAGLTGEKLILLTADRPPELIDCGANQAIR-QPGMFASHPTHSISLPRPTQD
MEND_SHIDS      ANLYPALIEAGLTGEKLILLTADRPPELIDCGVNQAIR-QPGMFASHPTHSISLPRPTQD
MEND_SALCH      ANLYPALIEAGLTGEKLILLTADRPPELIDCGANQAIR-QAGMFASHPSQTLSLPRPTQD
MEND_SALTY      ANLYPALIEAGLTGEKLILLTADRPPELIDCGANQAIR-QAGMFASHPSQTLSLPRPTQD
MEND_SALPA      ANLYPALIEAGLTGEKLILLTADRPPELIDCGANQAIR-QAGMFASHPSQTLSLPRPTQD
MEND_SALPB      ANLYPALIEAGLTGEKLILLTADRPPELIDCGANQAIR-QAGMFASHPSQTLSLPRPTQD
MEND_SALTI      ANLYPALIEAGLTGEKLILLTADRPPELIDCGANQAIR-QAGMFASHPSQTLSLPRPTQD
MEND_SALAR      ANLYPALIEAGLTGEKLILLTADRPPELIDCGANQAIR-QAGIFASHPSQTLSLPRPTQD
MEND_CITK8      ANLYPALIEAGLTGEKLILLTADRPPELIDCGANQAIR-QAGMFASHPSQTLSLPRPTQD
MEND_KLEP7      ANLYPALIEAGLTGEKLILLTADRPPELIDCGANQAIR-QPGMFASHPAQTISLPRPSQD
MEND_ENT38      ANLYPALIEAGLTGEKLVLLTADRPPELIDCGANQAIR-QPGIFASHPAEALSLPRPTQD
MEND_YERPA      ANLYPALIEAGLTGERLILLTADRPPELIDCGANQAIR-QQGLFASHPTLSVNLPRPTPD
MEND_YERPE      ANLYPALIEAGLTGERLILLTADRPPELIDCGANQAIR-QQGLFASHPTLSVNLPRPTPD
MEND_YERPN      ANLYPALIEAGLTGERLILLTADRPPELIDCGANQAIR-QQGLFASHPTLSVNLPRPTPD
MEND_YERPP      ANLYPALIEAGLTGERLILLTADRPPELIDCGANQAIR-QQGLFASHPTLSVNLPRPTPD
MEND_YERPS      ANLYPALIEAGLTGERLILLTADRPPELIDCGANQAIR-QQGLFASHPTLSVNLPRPTPD
MEND_YERE8      ANLYPALIEAGLTGERLILLTADRPPELIDCGANQAIR-QPGMFASHPTVSLNLPRPTPD
MEND_SERP5      ANLYPSLIEAGLTGERLVFLTADRPPELINCGANQAIR-QNGLYASHPALSIDLPRPTTD
MEND_PECAS      ANLYPAIIEAGLTGERLVVLTADRPPELIDCGANQAIR-QHALYASHPTLALDLPRPTPD
MEND_PHOLL      ANLYPSLIEASLTGERMVFLTADRPPELMDCGANQAIR-QNGIFASHPCQTISLPRPTVD
MEND_CROS8      ANLYPAVIEAGLTGEKLVVITADRPPELIDCGANQAIR-QHSIFGSHPAATLDLPRPTPS
MEND_HAEI8      ANLYPAIIEARQTGVNLFVLTADRPPELWECGANQAIL-QQNMFGQYPVANVNLPKPNAD
MEND_HAEIG      ANLYPAIIEARQTGVNLFVLTADRPPELWECGANQAIL-QQNMFGQYPVANVNLPKPNAD
MEND_HAEIN      ANLYPAIIEARQTGVNLFVLTADRPPELWECGANQAIL-QQNMFGQYPVANVNLPKPNAD
MEND_HAEIE      ANLYPAIIEARQTGVNLFVLTADRPPELWECGANQAIL-QQNMFGQYPVANVNLPKPKAD
MEND_PASMU      ANLYPAIIEARQTGVNLIVLTADRPPELIECGANQAIV-QPHMYADYPVASVNLPRPSQD
MEND_MANSM      ANLYPAIIEARQTGDNLIVLTADRPDELIECGANQAIL-QQNMFAGYPVASVNLPRPSQD
MEND_ACTSZ      ANLYPAIIEARQSGEKLIVLTADRPAELLECGANQAIL-QENMFASYPVATVNLPKPGQN
MEND_HAES1      ANLYPAIIEARQTDVPLIILTADRPPELLECGANQAIL-QQNMFAQYPIASINLPRPSQN
MEND_HISS2      ANLYPAIIEARQTDVPLIILTADRPPELLECGANQAIL-QQNMFAQYPIASINLPRPSQN
MEND_ACTP2      ANLYPAIIEASLTHHKLIVLSADRPPELIGCGANQAIP-QQGIFADYPIAGVNLPKPAEH
MEND_ACTPJ      ANLYPAIIEASLTHHKLIVLSADRPPELIGCGANQAIP-QQGIFADYPIAGVNLPKPAEH
MEND_HAEDU      ANLYPALIEASLTQHKLIVLSADRPPELIGCGVNQAIT-QPGIFADYPIANIHLPKASTD
MEND_PHOPR      ANLLPAVAEAGLTGEKLVLLTSDRPVELIQCGANQAIV-QHDIFSQHVTAFHDIPSPTLD
MEND_ALIF1      ANLLPSVAESGLTKEKLVLLTADRPVELINCGANQAIN-QQGIFSSHVCHSLQLPSPSQN
MEND_VIBC3      ANLLPAIAESKLTGERLVVLTADRPLELVGCGANQAIV-QSGIFSSHVTASLELPSPAIH
MEND_VIBCH      ANLLPAIAESKLTGERLVVLTADRPLELVGCGANQAIV-QSGIFSSHVTASLELPSPAIH
MEND_VIBCB      ANLLPAIAEAKLTGEKLVVLTADRPVELVGCGANQAIN-QLGIFAEHVSDSLNLPSPTLS
MEND_VIBPA      ANLLPAVAEAKLTGEKLVLLTADRPVELVGCGANQAIN-QLGIFSQHVSANLNLPSPSLN
MEND_VIBVU      ANLLPAVAEAGLTGEKLVLLTADRPIELVGCGANQAIA-QQGIFSNHVCASLNLPSPNTQ
MEND_VIBVY      ANLLPAVAEAGLTGEKLVLLTADRPIELVGCGANQAIA-QQGIFSNHVCASLNLPSPNTQ
MEND_AERHH      ANLWPAVAEAQLTGVPLIILSADRPPELIDNGANQAID-QQGIFGRYPVYQQNLPSPTAT
MEND_AERS4      ANLWPAVAEAQLTGVPLIILSADRPPELIDNGANQAID-QQGIFGRYPVYQQNLPSPTPT
MEND_PSYIN      ANLYPAVIEAKLSAIPLIILSADRPVELIDCGANQAID-QYRIFSHYPVFFAQIPSATTH
MEND_SHEB5      ANLYPAIVEAWLTHVPLIVLSGDRPPELLGCGANQAIV-QPGIFANYAT-QVNLPTPDAH
MEND_SHEB9      ANLYPAIVEAWLTHVPLIVLSGDRPPELLGCGANQAIV-QPGIFANYAT-QVNLPTPDAH
MEND_SHEB8      ANLYPAIVEAWLTHVPLIVLSGDRPPELLGCGANQAIV-QPGIFANYAT-QVNLPTPDMH
MEND_SHEPC      ANLYPAIVEAWLTHVPLIVLSGDRPPELLDCGANQAIV-QPGIFAHYAK-QINLPTPDAH
MEND_SHESW      ANLYPAIVEAWLTHVPLIVLSGDRPPELLDCGANQAIV-QPGIFAHYAK-QINLPTPDAH
MEND_SHESA      ANLYPAIVEAWLTHVPLIVLSGDRPPELLGCGANQAIV-QPAIFANYAQ-QVNLPTPDAH
MEND_SHESM      ANLYPAIVEAWLTHVPLIVLSGDRPPELLGCGANQAIV-QPAIFANYAQ-QVNLPTPDAH
MEND_SHESR      ANLYPAIVEAWLTHVPLIVLSGDRPPELLGCGANQAIV-QPAIFANYAQ-QVNLPTPDAH
MEND_SHEON      ANLYPAIVEAWLTHVPLIVLSGDRPPELLGCGANQAIV-QPAIFANYAQ-QVNLPTPDAH
MEND_SHEHH      ANLYPAIIEAWLTHVPLIVLSGDRPPELIDCGANQAII-QPAIFAQYAK-QLNLPTPDLN
MEND_SHEPA      ANLYPAVIEAWLTHVPLIVLSGDRPPELIDCGANQAII-QPAIFAQYAK-QINLPTPDLN
MEND_SHESH      ANLYPAIIEAWLTQVPLVVLSGDRPPELIDCGANQAII-QPALFAQYAK-QINLPTPDIA
MEND_SHEWM      ANLYPAVIEAWLTHVPLIVLSGDRPPELIDCGANQAII-QPAIFAQYAK-QINLSTPDLA
MEND_SHELP      ANLYPAIVEAWLTQVPLIVLSGDRPPELLGCGANQAIV-QPAIFADYAK-QVNLPTPDMA
MEND_SHEAM      ANLYPAIVEASLTHVPLIILSGDRPWELIGCGANQAIE-QLGIFGGYAR-QLNLPTPDLR
MEND_SHEFN      ANLYPAIVEAWLTHVPLIILSGDRPPELIDCGANQAII-QPAIFAQYAK-QVNLPTPDLG
MEND_HALHL      PNLHPAVAEARQSSLPLVVITADRPPELHHCGANQAMP-QEDLFAPLVRAALALPPPEAT
MEND_PELLD      ANYFPAVVEASADFVPMIVISADRPFDLQECGANQTIR-QDGIFGRYARWHMQLPQPSTE
MEND_CHLPM      ANYLPAVVEASNDRIPMLILSADRPFELRECGANQTIR-QNGIFGTFTRWQMELPEPSTS
MEND_CHLCH      ANYFPAVVEASMDFQPMLIISADRPFELLECGANQTIR-QEHIFGSYTRWSMQLPTPSVE
MEND_CHLPD      ANYFPSVVEASMDCQPMIILSADRPFELLETGANQTIR-QSGMFGSYSRWNFRLPEPSAE
MEND_CHLTE      ANYFPAVVEASADAQPMLVLSADRPFELLECGANQAIR-QQNIFGSYTRWSFELPEPGIA
MEND_RUBXD      ANGLPAVAEAATDCVPMLLLTADRPPELRHTGANQTIE-QPGIFGGYARWSFDVPPPGPD
MEND_SALRD      ANGLPAAVEASVDGVPMLLLTADRPPELRDTGANQTID-QVKIFGDYVRWQADVPPPSDE
MEND_SYNAS      ANYYPAVIEAFRDEIPLVILSADRPPELIGSDANQTIV-QPDLYGRYCRDSLLIPCPSAD
MEND_DECAR      ANWLPAVIEASQSGIPLILISADRPPELQDCGANQTVS-QPGLFGSHTRASYTLGTPEPG
MEND_PAEAT      GNLLPAVMEANHSAVPVVVISADRPEELHGTGANQTTI-QLDLFGDHVRFAVDVPAGDHP
MEND_ARTS2      GNLLPAVMEANHAAVPLVVLSADRPDELRGTGANQTTD-QLDLFGEHVRFAVDVPAGTNP
MEND_RENSM      GNLLPAVMEADHAGVPLLVLSADRPEELRGTGANQTTD-QIDLFGSHVRFAADVAAGDLP
MEND_CLAM3      ANLHPAVLEGWHSGVPMLLLTGDRPAELRGIASNQTTR-QPGMFGDRV-VVVDVPAPEET
MEND_CLAMS      ANLHPAVLEGWHSGVPMLLLTGDRPAELRGIASNQTTR-QPGMFGDRV-ACIDVPAPEET
MEND_LEIXX      ANLHPAVLEAHESGVPLIVITADRPPELRGIRSSQTTH-QDGLYGVAVRLAKDVPAPSGE
MEND_KINRD      ANLHPAVLEAHHAGVPLVVLSADRPHELRGSGASQTADAQARMFLPSVRYSADVPAPVDP
MEND_NOCSJ      ANLHPAVLEAAHAGVDLVVVSADRPARLRGTGANQTTD------------QVGIFGPLVP
MEND_CUTAK      ANIHPAVLEADAAGVPLIVLSADRPAEMWHTGANQTTV-QTGIFGSAPRLSTDVPAGFPA
MEND_COREF      SNCLPAVTEAAHAHIPLLVVSADRPAHLIGTGSSQTID-QTDIFGA--------------
MEND_CORGB      ANCLPAVAEAAHAHIPLIVLSADRPAHLVGTGASQTIN-QTGIFGD--------------
MEND_CORDI      ANCAPAMIEAAYSHTPLIMVSADRPERLHGTGANQTIE-QRGIF----------------
MEND_CORJK      ANCLPAMVEATLSGVPLVVLSANRPLSMLGSGANQTID-QAEIFGTHSVCTLNTGELALE
MEND_MYCA1      ANLGPAVVEANYARVPLIVLSANRPYELLGTGANQTME-QLGYFGTQVRAAISLGLAEDA
MEND_MYCPA      ANLGPAVVEANYARVPLIVLSANRPYELLGTGANQTME-QLGYFGTQVRAAISLGLAEDA
MEND_MYCBO      ANLGPAVVEANYARVPLIVLSANRPYELLGTGANQTME-QLGYFGTQVRASISLGLAEDA
MEND_MYCBP      ANLGPAVVEANYARVPLIVLSANRPYELLGTGANQTME-QLGYFGTQVRASISLGLAEDA
MEND_MYCTA      ANLGPAVVEANYARVPLIVLSANRPYELLGTGANQTME-QLGYFGTQVRASISLGLAEDA
MEND_MYCTU      ANLGPAVVEANYARVPLIVLSANRPYELLGTGANQTME-QLGYFGTQVRASISLGLAEDA
MEND_MYCUA      ANLGPAVVETNYARVPLIVLSANRPYELLGTGANQTME-QLGYFGTQVRATISLGLAEDA
MEND_MYCLE      ANLGPAVVEANYARVPLIVLSANRPYELLGTGANQTME-QLGYFGTQVRAAISLGLAEDA
MEND_MYCGI      ANLGPAVVEANYARVPLIVLTANRPYELLGTGANQTFE-QLGYFGTQVRESISLGLAGDH
MEND_MYCVP      ANLGPAVVEANYARVPLIVLSANRPYELLGTGANQTFE-QLGYFGTQVRANISLGLAPES
MEND_MYCSK      ANLGPAVVEANYARVPLIVLSANRPYELLGTGANQTFE-QLGYFGNQVRANISLGLAPEL
MEND_MYCSS      ANLGPAVVEANYARVPLIVLSANRPYELLGTGANQTFE-QLGYFGNQVRANISLGLAPEL
MEND_MYCSJ      ANLGPAVVEANYARVPLIVLSANRPYELLGTGANQTFE-QLGYFGNQVRANISLGLAPEL
MEND_MYCS2      ANLGPAVVEANYARVPLIVLSANRPYEMLGTGANQTFE-QLGYFGTQVRAAISLGLAPDL
MEND_NOCFA      ANLGPAVLEANYARVPLIVLSANRPYEMLGTGANQTVE-QLGLFGSQVRATISLGLAEAD
MEND_RHOJR      ANLGPAVLEANYARVPLVVLSANRPYEMLGTGANQTIE-QLGLFGSQVRATISLGLAEDD
MEND_SACEN      TNLHPAVSEACHAGIPLIVLTADRPPELRAAGANQTID-QYRLYGTEVRLFDELAVAENR
MEND_THEFY      ANFHPAVLEADQSGVSLIVLTADRPPELRGTGANQTVN-QIGLYGSAVRFFAEVGVPERE
MEND_HALMA      ANYHPAVIEANQSGVPLLLLTADRPPELIDSGANQTVD-QEKLYGDAVRWYRDMPEPEAE
MEND_NATPD      ANFHPAVIEADTARVPMVLLTADRPPELADSGANQTID-QADLYGDAVRSYRTLPEPEAA
MEND_HALS3      ANLHPAVMEAAQARIPLVVLTADRPPELRGSGANQTVD-QEQLYGSAVRYYEDLPEPEVT
MEND_HALSA      ANLHPAVMEAAQARIPLVVLTADRPPELRGSGANQTVD-QEQLYGSAVRYYEDLPEPEVT
MEND_HALWD      ANYHPAVIEASQARVPLLVLTADRPPELHDSGANQTVD-QTKLYGDAVRWFHDIGEPEPT
MEND_ROSCS      ANFFPAIVEAHQAGVPLLALTADRPHELRDSGANQTID-QVKMFGSFARWSVDVALPEAM
MEND_ROSS1      ANFFPAIVEAHQAGVPLLALTADRPHELRDSGANQTID-QVKMFGGFVRWSVDLALPEAT
MEND_CHLAA      ANLLPAVVEANLARVPLVILTADRPPELRDNGAPQTID-QIGIFGRNVRWFVDLPTPDMA
MEND_MYXXD      AHFYPAVIEAALSHVPLVVLTADRPLELQGWGAPQTVP-QARFFGEHARFYADLGQPEAH
MEND_SORC5      AHALPAIIEAHQSFTPLIAITADRPWELADAAAAQTID-QTKLFGDHVRHFAELGLPDPS
MEND_BACSU      ANFYPAVVEAHYSRVPIIVLTADRPHELREVGAPQAIN-QHFLFGNFVKFFTDSALP---
MEND_BACVZ      ANFYPAVIEAHYSRVPLIVLTADRPHELREVGAPQAIN-QHFLFGNFVKFFTDSALP---
MEND_BACLD      ANFYPAVIEAHYSRIPLMILTADRPHELREVGAPQAID-QQFLFGNFVKFFTDSALP---
MEND_BACP2      ANFYPAIVEAHYSRVPLIVLTADRPHELREVGAPQAID-QQFLFGKFVKWFTDLALP---
MEND_BACAH      ANYYPAVCEAFHSRVPLIVLTADRPHELRDVGAPQAMN-QINLYGTFVKQFTEMALP---
MEND_BACHK      ANYYPAVCEAFHSRVPLIVLTADRPHELRDVGAPQAMN-QINLYGTFVKQFTEMALP---
MEND_BACAN      ANYYPAVCEAFHSRVPLIVLTADRPHELRDVGAPQAMN-QINLYGTFVKQFTEMALP---
MEND_BACCZ      ANYYPAVCEAFHSRVPLIVLTADRPHELRDVGAPQAMN-QFNLYGTFVKQFTEMALP---
MEND_BACC1      ANYYPAVCEAFHSRVPLIVLTADRPHELRDVGAPQAMN-QINLYGTFVKQFTEMAIP---
MEND_BACCR      ANYYPAVCEAFHSRVPLIVLTADRPHELRDVGAPQAMN-QFNLYGTFVKQFTEMALP---
MEND_BACCN      ANYYPAVCEAYHARVPLLVLTADRPHELRDVGAPQAMN-QFNLYGSFVKQFMEMALP---
MEND_GEOKA      ANYGPAVVEAYYSRVPLVVLTADRPHELRDVGAPQAID-QLHLYGRYAKWFVDLALP---
MEND_GEOTN      ANYLPAIVEAYYSRVPLVVLTADRPHELRDVGAPQAID-QLHLYGRYAKWFVDLALP---
MEND_OCEIH      ANYYPAIVEAHYSRVPLLVLTADRPHELRHIGAPQTIE-QIKMYGDYTKWFHEMAMP---
MEND_LISMF      ANYFPAVAEANLSQIPLIVLTADRPHELRNVGAPQAMD-QLHLYGSHVKDFTDMALP---
MEND_LISMO      ANYFPAVAEANLSQIPLIVLTADRPHELRNVGAPQAMD-QLHLYGSHVKDFTDMALP---
MEND_LISIN      ANYFPAVVEANLSQIPLIVLTADRPHELRNVGAPQAMD-QLHLYGSHVKDFTDMALP---
MEND_LISW6      ANYFPAIAEANLSQIPLIILTADRPHELRNVGAPQAMD-QLHLYGSHVKDFTDMALP---
MEND_ENTFA      ANYYPAICEANISHVPLVVLTTDRPHELRQVGAPQAMD-QLQMYQNHVKLFVEMALP---
MEND_LACLM      AHHFPAITEAKTSRIPLIILTADRPAELQFVGAPQTLD-QTRFFGNFVNHFENLEAP---
MEND_LACLS      AHHFPAITEAKMSRIPLIILTADRPAELQFVGAPQTLD-QTRFFGNFVNHFENLEAP---
MEND_LACLA      AHHFPAVLEAKMSRVPLIILTADRPAELQFVGAPQTVD-QTRFFGNFVNHFENLEAPHIQ
MEND_DESHY      AHYFPAIVEAKHSHVPLIVLTADRPPELRQVGAPQTID-QIKFYHDYAKYFEELALP---
MEND_LEUCK      TEYMPAVAEAKVSHIPLIVLSTDRPAELQNNGAPQTLP-QHRLFGELTPYFVSFTLQD--
MEND_LEUMM      AEYMPAVAEAYAANIPLVVLSTDRPQELQFNGAPQTIP-QSNLFGQLTKQAVLIRLQD--
MEND_STAA1      ANYTPAIAESQISRIPLIVLTSDRPHELRSVGAPQAIN-QVNMFNNYVSYEFDMPIAD--
MEND_STAA9      ANYTPAIAESQISRIPLIVLTSDRPHELRSVGAPQAIN-QVNMFNNYVSYEFDMPIAD--
MEND_STAAN      ANYTPAIAESQISRIPLIVLTSDRPHELRSVGAPQAIN-QVNMFNNYVSYEFDMPIAD--
MEND_STAA2      ANYTPAIAESQISRIPLIVLTSDRPHELRSVGAPQAIN-QVNMFNNYVSYEFDMPIAD--
MEND_STAAM      ANYTPAIAESQISRIPLIVLTSDRPHELRSVGAPQAIN-QVNMFNNYVSYEFDMPIAD--
MEND_STAAS      ANYTPAIAESQISRIPLIVLTSDRPHELRSVGAPQAIN-QVNMFNNYVSYEFDMPIAD--
MEND_STAAW      ANYTPAIAESQISRIPLIVLTSDRPHELRSVGAPQAIN-QVNMFNNYVSYEFDMPIAD--
MEND_STAA3      ANYTPAIAESQISRIPLIVLTSDRPHELRSVGAPQAIN-QVNMFNNYVSYEFDMPIAD--
MEND_STAAE      ANYTPAIAESQISRIPLIVLTSDRPHELRSVGAPQAIN-QVNMFNNYVSYEFDMPIAD--
MEND_STAA8      ANYTPAIAESQISRIPLIVLTSDRPHELRSVGAPQAIN-QVNMFNNYVSYEFDMPIAD--
MEND_STAAC      ANYTPAIAESQISRIPLIVLTSDRPHELRSVGAPQAIN-QVNMFNNYVSYEFDMPIAD--
MEND_STAAT      ANYTPAIAESQISRIPLIVLTSDRPHELRSVGAPQAIN-QVNMFNNYVSYEFDMPIAD--
MEND_STAAB      ANYTPAIAESQISRIPLIVLTSDRPHELRSVGAPQAIN-QVNMFNNYVSYEFDMPIAD--
MEND_STAAR      ANYTPAIAESQISRIPLIVLTSDRPHELRSVGAPQAIN-QVNMFNNYVSYEFDMPIAD--
MEND_STAEQ      ANYTPAIAESQISRLPLVVLTSDRPHELRSVGAPQAIN-QVNMFSNYVNFQFDLPIAD--
MEND_STAES      ANYTPAIAESQISRLPLVVLTSDRPHELRSVGAPQAIN-QVNMFSNYVNFQFDLPIAD--
MEND_STAHJ      ANYTPAIAESQISRIPLIVLTSDRPHELRSVGAPQAIN-QVNMFANYVNFQFDMPVAD--
MEND_STAS1      ANYTPAISESSLSHLPLVVLTSDRPHELRGIGAPQAIN-QTNMFANYVQYQFDFPIAE--
MEND_BACFN      LNLHPAIAEAYYQKVSLVVISADRPAAWINQMDGQTLP-QPGVFRSLVKKSVDLPEIH--
MEND_BACFR      LNLHPAIAEAYYQKVSLVVISADRPAAWINQMDGQTLP-QPGVFRSLVKKSVDLPEIH--
MEND_BACTN      LNLHPAVAEAYYQNIPLVVISADRPAAWIGQMAGQTLP-QPGVFQTLVKKSVNLPEIQ--
MEND_BACV8      LNLHPAVAEAFYQQVPLIVISADRPAAWIGQMDGQTLP-QPHVFGTLVKMSVNLPEVH--
MEND_PARD8      LNIHPAVAEAFYQKVPLVVISADRPAAWIGQMDGQTLP-QPGVFGSLVKKSVQLPEIH--
MEND_FLAJ1      LNYYPAVAEAFYSQIPLIVISADRPQSKIDIGDGQTIR-QENVFLNHSVFNANLTEDA--
MEND_FLAPJ      LNYYPAFAEAFYSQIPLVVISADRPQSKIDIGDGQTIR-QENVFANHSLYNANLVENV--
MEND_GRAFK      LNYYPAIAEAYYSDIPLVIISADRPIERIDIGDGQTIR-QKNVFENHILYSANLYSEL--
MEND_PORGI      LNYAPAVAEAFYRGIPLVAVTADRPAEWIDQDEGQTIR-QEGAMAGFVKSYCSLRAEF--
MEND_CYTH3      YNYAPAIVEAYYQRVPLIVLSADRPPEWIDQNDGQTIR-QQEIYGKHSKAFFQLSAEH--
MEND_DESPS      LNYGPAIAEAYYLRAPLIVLSADRPARLVGQQDSQTIC-QDNLFANIVKGSYSLPEEP--
MEND_NOSS1      ANFYPAVIEAQESRVPLLLLTADRPPELRDCHSGQTID-QMKLYGSYPNWQAELALPVSD
MEND_TRIV2      ANFYPAVIEAQESRVPLLLLTADRPPELRDCHSGQTID-QVKLFGSYPNWQTELALPVSD
MEND_TRIEI      ANFYPAIIEAKESRIPLLVLTADRPPELRNCHAGQTID-QVKLYGNYPNWQIELTLPSVE
MEND_MICAN      ANFYPAVIEAKESHVPLLILTADRPPELRHAHAGQTID-QVKLYGNYPNWQAEISCPSAN
MEND_ACAM1      ANFYPAVIEAEASGVPLLLLTADRPPELRHCQAGQAID-QVKLYGHYPRWQVELALPSTH
MEND_SYNJA      AHFFPALIEAAESGWPLLVLTADRPPELRHCRAGQTID-QVKLYGHYPNWQAELALPSAD
MEND_SYNJB      AHFFPALIEAAESGWPLLVLTADRPPELRHCRAGQAID-QVKLYGHYPNWQAELALPSAD
MEND_SYNP6      ANFYPAVIEAKESGVPLLVITADRPPELRQCHAGQAID-QLRLFGSYALWEAELALPVLD
MEND_SYNE7      ANFYPAVIEAKESGVPLLVITADRPPELRQCHAGQAID-QLRLFGSYALWEAELALPVLD
MEND_THEEB      ANFYPAIIEASLSHLPLIVLSADRPPELRFCQAGQAID-QVHLYGHAVRHYRELSLP--E
MEND_SYNY3      ANFLPAIIEAHYSQVPLLVLTGDRPPRLRHCRAGQTID-QTKLYGHYPQWQTELALPEPN
MEND_BDEBA      AELLPAAVEGTYSSLPLIMVTADRPKHYRGSGAPQTIE-QVGIFSYYNEVALDLD-----
MEND_PARUW      AELLPATIEAYYTSLPLLLITADRPRRFRLSGAPQSIE-QVGIFSCYTILEKDL------
MEND_PROM0      SNLLPAAVEADRSCKGVIFLTADRPLRLKDCGANQTVN-QEDFLSSVCRSVLSTNLNGLH
MEND_PROM2      SNLLPAAVEADRSCKGIIFLTADRPLRLKDCGSNQTVN-QEDFLSSVCRRVLSTNLNGLH
MEND_PROM9      SNLLPAAVEADRSCKGIIFLTADRPLRLKDCGANQTVN-QEDFLSSVCRRVLSTNLNGLH
MEND_PROMS      SNLLPAAVEADRSCKGIIFLTADRPLRLKDCGANQTVN-QEDFLSSVCRKVLSTNLNGIH
MEND_PROM5      GNLLPAAVEADRSCKSIVFITADRPLRLKNCGSNQTVN-QEAFLNSVCRSTLSTNLNGIH
MEND_PROMP      GNLLPAAIEADKSCKSIVFITADRPLRLKNCGSNQTVN-QEEFLNSVCRSNLSTNLNGIH
MEND_PROM1      ANLLPAAVEADRSCHPLLFLTADRPLRLKECGANQAVN-QQDFLKSVCRHFDESPKEGIH
MEND_PROMT      ANLLPAAVEADRSCHPLLFLTADRPLRLKECGANQAVN-QQDFLKSVCRHFDESPKEGIH
MEND_PROMA      SNLLPAAVEADRSCLPIIFITADRPLRLKGCGSNQTVN-QEDFLVPVCREVFNCPSIGLH
MEND_PROM3      ANLLPAAVEADRSCQPLLLLTADRPYRLKDCGANQTVN-QETFLSPACRWIGQGPREGLH
MEND_PROMM      ANLLPAAVEADRSCQPLLLLTADRPYRLKDCGANQTVN-QETFLSPACRWIGQGPREGLH
MEND_SYNPW      ANLLPAAVEADRSCIPLLLLTADRPTRLKDCGANQTVN-QEQFLAPVCRAFLSSPGEGLH
MEND_SYNS3      ANLLPAAVEADRSSQPLLLISADRPLRLKNKGANQTVN-QEAFLTPVCRWCGSGPLDGLS
MEND_SYNPX      ANLLPAAVEADRSTQPLLLLTADRPARLKNCGANQTVN-QEQFLQPVCRWLGHGAPEGLA
MEND_SYNSC      SNLLPAAVEADRSCQPLLLLTADRPVRLKNCGANQTVN-QESFLLAACRWFGSGAADGIH
MEND_SYNS9      ANLLPAVIEADRSCQPLLVITADRPIRLKACGANQTVN-QEDFLRPACRWCGNGAPEGLH
MEND_SYNR3      ANLLPAAVEADFSALPLLLLTADRPERLKACGANQTVN-QEAYLQPACRALLQGPAAGLH
                 .  *:  *       :. :: :**         *:                        

MEND_ECOLI      -----------------IPARWLVSTIDHALGTL----HAGGVHINCPFAEPLYGEMD--
MEND_ECOHS      -----------------IPARWLVSTIDHALGTL----HAGGVHINCPFAEPLYGEMD--
MEND_ECOLC      -----------------IPARWLVSTIDHALGTL----HAGGVHINCPFAEPLYGEMD--
MEND_SHIF8      -----------------IPARWLVSTIDHALGTL----HAGGVHINCPFAEPLYGEMD--
MEND_SHIFL      -----------------IPARWLVSTIDHALGTL----HAGGVHINCPFAEPLYGEMD--
MEND_ECO24      -----------------IPACWLVSTIDHALGTL----HAGGVHINCPFAEPLYGEMD--
MEND_SHIBS      -----------------IPARWLVSTIDHALGTL----HAGGVHINCPFAEPLYGEMD--
MEND_ECO57      -----------------IPARWLVSTIDHALGTL----HAGGVHINCPFAEPLYGEMD--
MEND_SHISS      -----------------IPARWLVSTIDHALGTL----HSGGVHINCPFAEPLYGEMD--
MEND_ECOK1      -----------------IPARWLVSTIDHALGTL----HAGGVHINCPFAEPLYGEMD--
MEND_ECOL6      -----------------IPARWLVSTIDHALGTL----HAGGVHINCPFAEPLYGEMD--
MEND_ECOL5      -----------------IPARWLVSTIDHALGTL----HAGGVHINCPFAEPLYGEMD--
MEND_ECOUT      -----------------IPARWLVSTIDHALGTL----HAGGVHINCPFAEPLYGEMD--
MEND_ECOSM      -----------------IPARWLVSTIDHALGTL----HAGGVHINCPFAEPLYGEMD--
MEND_SHIDS      -----------------IPARWLVSTIDHALGTL----HAGGVHINCPFAEPLYGEMD--
MEND_SALCH      -----------------IPARWLVSTIDNALAML----HAGALHINCPFAEPLYGDMN--
MEND_SALTY      -----------------IPARWLVSTIDNALAML----HAGALHINCPFAEPLYGDMN--
MEND_SALPA      -----------------IPARWLVSTIDNALAML----HAGALHINCPFAEPLYGDMN--
MEND_SALPB      -----------------IPARWLVSTIDNALAML----HAGALHINCPFAEPLYGDMN--
MEND_SALTI      -----------------IPARWLVSTIDNALAML----HAGALHINCPFAEPLYGDMN--
MEND_SALAR      -----------------IPARWLVSTIDNALAML----HAGALHINCPFAEPLYGDMN--
MEND_CITK8      -----------------ISARWLVSTLDNVLATL----HAGAVHINCPFAEPLYGDMD--
MEND_KLEP7      -----------------IPARWLVSTIDQALGAL----HAGGVHINCPFAEPLYGDMD--
MEND_ENT38      -----------------IPASWLVSTLDHAMGTL----RHGALHINCPFAEPLYGELN--
MEND_YERPA      -----------------ISARWLVSTLDSAMAQL----QHGALHINCPFAEPLYGGDE--
MEND_YERPE      -----------------ISARWLVSTLDSAMAQL----QHGALHINCPFAEPLYGGDE--
MEND_YERPN      -----------------ISARWLVSTLDSAMAQL----QHGALHINCPFAEPLYGGDE--
MEND_YERPP      -----------------ISARWLVSTLDSAMAQL----QHGALHINCPFAEPLYGGDE--
MEND_YERPS      -----------------ISARWLVSTLDSAMAQL----QHGALHINCPFAEPLYGGDE--
MEND_YERE8      -----------------IPASWLVSTIDSAMAQL----HHGGLHVNCPFAEPLYGGDE--
MEND_SERP5      -----------------IPARWLVSTVDSAMARL----QHGALHINCPFAEPLYGGDE--
MEND_PECAS      -----------------IPATWLVSSVDSAMARL----THGALHINCPFAEPLYGADDG-
MEND_PHOLL      -----------------IPASWLASVIDHSMANL----QHGAVHINCPFAEPLYGNEE--
MEND_CROS8      -----------------IPAAWLISAIDETMGAL----AAGALHINTPFAEPLYGELD--
MEND_HAEI8      -----------------YSAQWLISLLEQAAFQQKQ--QGGVVHINVPFTEPLYDATDEE
MEND_HAEIG      -----------------YSAQWLISLLEQAAFQQKQ--QGGVVHINVPFAEPLYDATDEE
MEND_HAEIN      -----------------YSAQWLISLLEQAVFQQKQ--QGGVVHINVPFAEPLYDATDEE
MEND_HAEIE      -----------------YSAQWLISLLEQAAFQQKQ--QGGVVHINVPFSEPLYDATDEA
MEND_PASMU      -----------------YSADWLISRLEQACYQQAR--QPGVVHVNVPFAEPLYEASETD
MEND_MANSM      -----------------YIVSWLISTLDQACHQQAQ--QAGVIHINVPFAEPLYDADEDE
MEND_ACTSZ      -----------------YAAKWLISTLDQACHSQLV--EKGVVHINVPFAEPLYEANVTE
MEND_HAES1      -----------------YSAQWLISVLDQACFRQ-K--QGGVIHINVPFAEPLYNANNDE
MEND_HISS2      -----------------YSAQWLISVLDQACFRQ-K--QGGVIHINVPFAEPLYNANNDE
MEND_ACTP2      -----------------YNAGWLVATIEQACVTQSQ--QGGVVHINAPFAEPLYEADENA
MEND_ACTPJ      -----------------YNAGWLVATIEQACITQSQ--QGGVVHINAPFAEPLYEADENA
MEND_HAEDU      -----------------YNASWLAATIEQACVNQQQ--QGGVIHINAPFAEPLYETDENE
MEND_PHOPR      -----------------ISPAWLLSTIDEAMQLQQR--QGRAIHFNCHYPEPLYG--DD-
MEND_ALIF1      -----------------VPAQWLLSRLDQACFVQQE--QGGAIHINCPFPEPFYGKKDD-
MEND_VIBC3      -----------------HPLSWLLTSIDEVMARQAL--LGGSVHINCPFPEPLYSAGDE-
MEND_VIBCH      -----------------HPLSWLLTSIDEVMARQAL--LGGSVHINCPFPEPLYSAGDE-
MEND_VIBCB      -----------------TPLNWLLTSVDEVMFTQRL--RGSAVHINCAFPEPLYSNTDK-
MEND_VIBPA      -----------------TPLNWLLTSVDEVMFNQQL--HGSAVHINCAFPEPLYSDGEK-
MEND_VIBVU      -----------------TSLNWLLTSVDQVLHQQAV--SGHAVHINCPFPEPLYSNAPK-
MEND_VIBVY      -----------------TSLNWLLTSVDQVLHQQAV--SGHAVHINCPFPEPLYSNAPK-
MEND_AERHH      -----------------IPAAFVLSSVDQALAQQAR--TPGPVHFNCMYPEPLYPGDA--
MEND_AERS4      -----------------IPAAFVLSSVDQVLAQQAL--TPGPVHFNCMYPEPLYPGDE--
MEND_PSYIN      -----------------IKPNYLLTTINQGLQQQRQ--TPAAIHFNIAFSEPLYPQTA--
MEND_SHEB5      -----------------IAPQALLTTVDEAVANQT-----RPVHINCMYREPLYPSEL--
MEND_SHEB9      -----------------IAPQALLTTVDEAVANQT-----RPVHINCMYREPLYPSEL--
MEND_SHEB8      -----------------IAPQALLTTVDEAVANQT-----RPVHINCMYREPLYPSEL--
MEND_SHEPC      -----------------IAPQALLTTIDEAVANQT-----RPVHINCMYREPLYPSEL--
MEND_SHESW      -----------------IAPQALLTTIDEAVANQT-----RPVHINCMYREPLYPSEL--
MEND_SHESA      -----------------IAPQMLLTTLDEAVANQT-----RPVHINCMYREPLYPSEM--
MEND_SHESM      -----------------IAPQMLLTTLDEAVANQT-----RPVHINCMYREPLYPSEM--
MEND_SHESR      -----------------IAPQMLLTTLDEAVANQT-----RPVHINCMYREPLYPSEM--
MEND_SHEON      -----------------IAPQMLLTTLDEAVANQT-----RPVHINCMYREPLYPSEL--
MEND_SHEHH      -----------------IAPQALLSLLDDAVCNQS-----QPVHINCMYREPLYPNEP--
MEND_SHEPA      -----------------IAPQALLSLLDEAICNQS-----QPVHINCMYREPLYPNEP--
MEND_SHESH      -----------------IRPEALLTMLDEAISNQS-----LPVHINCMFREPLYPSTM--
MEND_SHEWM      -----------------IRPEALLTLLDEAISNQS-----QPLHINCMYREPLYPSTM--
MEND_SHELP      -----------------IPPQALLTLLDESVANAK-----GPIHVNCMYREPLYPGSM--
MEND_SHEAM      -----------------IGPEVLLSALDEQLANLD-----RPLHINCMYPEPLYPSEH--
MEND_SHEFN      -----------------YPANALLSTIDHALANQH-----QPVHINCMYREPLYPTELVT
MEND_HALHL      -----------------LCGHWLNRRLDATLAEATGAGATGPIHLNVPLREPLYGGTE--
MEND_PELLD      -----------------IPLQSLLSTVEHAVAKSLGA-PRGPVHLNQPFREPFDPEPLEG
MEND_CHLPM      -----------------IPLQSLLSTIAHGVEKSLNS-PRGPVHLNQPFREPFEPESCST
MEND_CHLCH      -----------------VPLTSLLSTVEYAVAKALNT-PAGVVHLNQPFREPFEPESVAA
MEND_CHLPD      -----------------IPLQSVLSAIDHAVEKATGN-PPGPVHLNVPFREPFEPELSDL
MEND_CHLTE      -----------------TPLASLLSTVDHAVRKSLSL-PAGPVHLNLPFREPLEPEAPDP
MEND_RUBXD      -----------------QDPATVLTTVDQAVYRSQRP-PAGPVHLNLMFREPFLPQPAQ-
MEND_SALRD      -----------------VDPAYVLTTADQALHQTLRA-PAGPVHVNCMFRKPLEPVETEA
MEND_SYNAS      -----------------YPLEALLARIDSLIAR-----PVGPVHINCAFRDPLVPGIPDS
MEND_DECAR      -----------------FNPGYLHRVARQACEQASWP-HPGPVHINQPFREPMLPSEP--
MEND_PAEAT      --------------QKAVATALYAATGALEDTP------PGPVQVNLAFRDPLVPADGDA
MEND_ARTS2      --------------QRAVETALSAATGVFEDTP------PGPVQLNLAFRDPLVPPPADH
MEND_RENSM      --------------EPAVRTGLDAALGRLDGVA------TGPVQLNFAFRDPLTPALDGS
MEND_CLAM3      --------------DEDLSRDARLARDAYRRARDERT----PVHVNVAFRDPLSVAVPDL
MEND_CLAMS      --------------DDDLARDALLARDAYRRARDERT----PVHVNVAFRDPLSVAVPDL
MEND_LEIXX      --------------EEDVATAARLAVESVRAAVGAETADPGPVHLNLAFREPLSVAVPPL
MEND_KINRD      --------------DRQAPAWRSLLSRAVAFARGLRGDGPGPVHLNVGFADPLTPSPGDV
MEND_NOCSJ      --------------TQDASGPVELLT-------------AGPVHLNVPLEEPLVPDDRWL
MEND_CUTAK      --------------DERLDALVLRAVTAATGALSAD---PGPVHLNVSFRDSLVPDGPWQ
MEND_COREF      --------------LAPTVTVAAPEHVGRISQALGNGASQSPRHINVALDMPLVAPDLPE
MEND_CORGB      --------------LAPTVGITELDQVAQIAESLAQRASQIPRHFNLALDVPLVAPELPE
MEND_CORDI      -------------------NVVDTDHVVDITDLNSISFARNVIHINVALDVPLVDV-LPE
MEND_CORJK      G-------------AAAGAAGELRDLVRKLINAATDPIDGGGAHLDVPLREPLVPPTLDE
MEND_MYCA1      ----------PERLDALNATWRSATCRVLAAATGSRTANAGPVQFDIPLREPLVPDP-EP
MEND_MYCPA      ----------PERLDALNATWRSATCRVLAAATGSRTANAGPVQFDIPLREPLVPDP-EP
MEND_MYCBO      ----------PERTSALNATWRSATCRVLAAATGARTANAGPVHFDIPLREPLVPDP-EP
MEND_MYCBP      ----------PERTSALNATWRSATCRVLAAATGARTANAGPVHFDIPLREPLVPDP-EP
MEND_MYCTA      ----------PERTSALNATWRSATCRVLAAATGARTANAGPVHFDIPLREPLVPDP-EP
MEND_MYCTU      ----------PERTSALNATWRSATCRVLAAATGARTANAGPVHFDIPLREPLVPDP-EP
MEND_MYCUA      ----------HERLDSLNASWRSATCRMLAAAMGSRTANAGPVHFDIPLREPLVPDP-DP
MEND_MYCLE      ----------PERLDSLNATWRSATCRVLVAATGSRTANAGPVQFDIPLREPLIPDP-EP
MEND_MYCGI      -----------ADMGSLNAQWRSATCRVLVAAKGSRSANAGPVQFDIPLREPLVPDADDG
MEND_MYCVP      G------A-SALNFSALNGQWRSATCRVVVAATGARSANAGPVQFDIPLREPLVPDAQEP
MEND_MYCSK      S------SGSPGDMTSLNAQWRSATCRVVVAATGSRSANAGPVQFDIPLREPLVPTFDDD
MEND_MYCSS      S------SGSPGDMTSLNAQWRSATCRVVVAATGSRSANAGPVQFDIPLREPLVPTFDDD
MEND_MYCSJ      S------AGSPGDMTSLNAQWRSATCRVVVAATGSRSANAGPVQFDIPLREPLVPTFDDD
MEND_MYCS2      T------GPNAADLDTLNAQWRSATCRVLVAATGARSANAGPVQFDIPLREPLVPDPAEP
MEND_NOCFA      G------AG-AGSYDQQNSVWRSAVCRVLAAARGTRSGNAGPVHFDIPLREPLVPDL--A
MEND_RHOJR      A------G--------QNSQWRSAVCRVLAAARGTRSGNAGPVHFDIPLREPLVPDV--H
MEND_SACEN      --------------PGQNAYWRTQVCRAASMAAGTTWG--GPVHLNLPFREPLVPSG-DR
MEND_THEFY      --------------AGMVAYWRSLVCRAWAAAQANK---PGPVHLNLAFREPLVPEPGGQ
MEND_HALMA      ---------------PRK--VRMLRTTAARALAESTGSDPGPVHLNCRFRKPLEPTPMPE
MEND_NATPD      ---------------ARK--LRSLRTTLCRAVGTATGTEPGPVHLNVPFRKPLEPLAAAE
MEND_HALS3      ---------------ARK--LRSLRTSVCRAVGHTTGPKPGPVHLNVPFRKPLEPVSVP-
MEND_HALSA      ---------------ARK--LRSLRTSVCRAVGHTTGPKPGPVHLNVPFRKPLEPVSVP-
MEND_HALWD      ---------------ARK--LRSLRTTAARSIMTATDTPAGPVHLNFPFRKPLEPTPVP-
MEND_ROSCS      ---------------PPPVALRNLRTLAARAMAIAGGEPRGVVHLNLPFRPPLEPTPMP-
MEND_ROSS1      ---------------PPPVVVRSLRTLAARAMAIAGGEPPGVVHLNLPFRPPLEPTPVA-
MEND_CHLAA      ---------------LLP----FLRATLGRAVGLARSAPAGPVHLNLPFREPLVPDRAR-
MEND_MYXXD      ---------------DAA--LIHMRATVARAVVSAWRAPRGAVQLNVPFREPLAPIAEPF
MEND_SORC5      ---------------PLA--LRAVTRIAAQAVTRALSPTPGAVHINARFRKPLEPVDATG
MEND_BACSU      --EESPQ------------MLRYIRTLASRAAGEAQKRPMGPVHVNVPLREPLMPDLSDE
MEND_BACVZ      --EENPQ------------MLSYIRTLAGRAVSEAGKRPMGPVHINVPLREPLMPDLSAA
MEND_BACLD      --DSHPD------------MLAYIRSLAARAAGEAKKAPRGPVHINFPLREPLMPNLEDE
MEND_BACP2      --EESQM------------MLRYVQTAAARANHMSMQEPKGPVQINVPLREPLLPDLSIH
MEND_BACAH      --EASEA------------MYHYARMTTQRMIASACLAPQGPVHLNFPVREPLIPDFSLE
MEND_BACHK      --EASEA------------MYHYARMTTQRMIASACLAPQGPVHLNFPVREPLIPDFSLE
MEND_BACAN      --EASEA------------MYHYARLTTQRMIASACLAPQGPVHLNFPVREPLIPDFSLE
MEND_BACCZ      --EASEA------------MYHYARMTTQRMIASACLAPQGPVHLNFPVREPLIPDFSLE
MEND_BACC1      --EANEA------------MYHYARMTTQRMIASALLAPQGPVHLNFPVREPLIPDFSLE
MEND_BACCR      --EASEA------------MYHYARMTTQRIVANACLAPQGPVHLNFPVREPLIPDFSLE
MEND_BACCN      --EAREP------------MYQYVRMAAGRAVASASFAPMGPVHMNFPLREPLIPDFSLD
MEND_GEOKA      --EEADD------------MLRYARTMAARAVQTAAGAPCGPVHVNAPFREPLVPHID-E
MEND_GEOTN      --EETDP------------MLSYARTMAARAAAIAAGAPAGPVHVNVPLREPLVPTID-E
MEND_OCEIH      --EASDK------------MLHYVRNKASHAKHVAEEGNPGVVHLNFPLREPLTPNFSLD
MEND_LISMF      --ENSEE------------MLRYAKWHGSRAVDIAMKTPRGPVHLNFPLREPLVPILEPS
MEND_LISMO      --ENSEE------------MLRYAKWHGSRAVDIAMKTPRGPVHLNFPLREPLVPILEPS
MEND_LISIN      --ENSDE------------MLRYAKWHSSRAVDIAMKTPRGPVHLNFPLREPLVPILEPS
MEND_LISW6      --ENSDE------------MLRYAKWHGSRAVDIAMKTPRGPVHLNFPLREPLVPILEPS
MEND_ENTFA      --EATEE------------MLNYAYWQGAKGAAFAQQTPAAPVHLNFPLREPLLPDLERK
MEND_LACLM      -QPQAKN------------FWTYPRKVAQRAFLSALDQMAGPVQINIPLRDPLVPELKSE
MEND_LACLS      -QPQAKN------------FWTYPRKVAQRAFLSALDQMAGPVQINVPLRDPLVPKLKSE
MEND_LACLA      KQSQTEN------------FWTYPRKVAQRAVLSAISPLSGPVQINVPLRDLLVPELKSE
MEND_DESHY      --EEREG------------MYRYVRGVMRKAYVSSLDQGYGVAHINIPLREPLSPDLDGV
MEND_LEUCK      --EHED-------------NTAYIDYMTQKLVHSAMDTGQ-PLQINLPLRKPLMPKLHD-
MEND_LEUMM      --MHSD-------------VTEYIDFIVQKVVNLSITAPRGPIQINLPLRKPLMPVLDR-
MEND_STAA1      --DSKE-------------TINAIYYQMQIASQYLYGPHKGPIHFNLPFRDPLTPDLNAT
MEND_STAA9      --DSKE-------------TINAIYYQMQIASQYLYGPHKGPIHFNLPFRDPLTPDLNAT
MEND_STAAN      --DSKE-------------TINAIYYQMQIASQYLYGPHKGPIHFNLPFRDPLTPDLNAT
MEND_STAA2      --DSKE-------------TINAIYYQMQIASQYLYGPHKGPIHFNLPFRDPLTPDLNAT
MEND_STAAM      --DSKE-------------TINAIYYQMQIASQYLYGPHKGPIHFNLPFRDPLTPDLNAT
MEND_STAAS      --DSKE-------------TINAIYYQMQIASQYLYGPHKGPIHFNLPFRDPLTPDLNAT
MEND_STAAW      --DSKE-------------TINAIYYQMQIASQYLYGPHKGPIHFNLPFRDPLTPDLNAT
MEND_STAA3      --DSKE-------------TIDAIYYQMQIASQYLYGPHKGPIHFNLPFRDPLTPDLNAT
MEND_STAAE      --DSKE-------------TIDAIYYQMQIASQYLYGPHKGPIHFNLPFRDPLTPDLNAT
MEND_STAA8      --DSKE-------------TIDAIYYQMQIASQYLYGPHKGPIHFNLPFRDPLTPDLNAT
MEND_STAAC      --DSKE-------------TIDAIYYQMQIASQYLYGPHKGPIHFNLPFRDPLTPDLNAT
MEND_STAAT      --DSKE-------------TIDAIYYQMQIASQYLYGPHKGPIHFNLPFRDPLTPDLNAT
MEND_STAAB      --DSKE-------------TIDAIYYQMQIASQYLYGPHKGPIHFNLPFRDPLTPDLNAT
MEND_STAAR      --DSKE-------------TIDAIYYQMQIASQYLYGPHKGPIHFNLPFRDPLTPDLNAT
MEND_STAEQ      --GSEH-------------TIDTINYQMQIASQYLYGPHRGPIHFNLPFREPLTPDLDRV
MEND_STAES      --GSEH-------------TIDTINYQMQIASQYLYGPHRGPIHFNLPFREPLTPDLDRV
MEND_STAHJ      --GTDY-------------MLDAIYYQMQIASQYLYGPHRGPIHFNLPFREPLTPNLERQ
MEND_STAS1      --KNDNEDI----------MANTIKFQLQKASQFLYGPHRGPIHLNLPFREPLTPNTEKV
MEND_BACFN      --TDEDE--------------WYCNRLLNEALLELNHHGKGPVHINVPVSEPLFQFTAES
MEND_BACFR      --TDEDE--------------WYCNRLLNEALLELNHHGKGPVHINVPVSEPLFQFTAES
MEND_BACTN      --TEEDE--------------WYCNRLVNEALLETNHHGKGPVHINIPISEPLFQFTVES
MEND_BACV8      --TEEDE--------------WFCNRLINEAILETTHHGKGPVHINVPISEPIYRFTAKT
MEND_PARD8      --TDQDE--------------WYCNRLINEALLELNHHGKGPVHINVPISEPLFQFTTPE
MEND_FLAJ1      --SVEN------------------DLKINKAIETAIL-QKGPVHINAPFEEPLYQTVSEL
MEND_FLAPJ      --SEEN------------------DAKIQEAIHLATT-KKGPVHINVPFEEPLYETVDTI
MEND_GRAFK      --VLENQSQDPKLQQKQFEAQKHNEREVNLALNKAIE-EKGPVHINVPFYEPLYDTVENI
MEND_PORGI      --DTSASAW-------------YANRRLNEVLNHALMPRRGPVHINMSFCEPLYGTSSGY
MEND_CYTH3      --ELPDTQ-------------WETYRKVNEAVSISEAYPKGPVHINIPFREPFYPKGEIM
MEND_DESPS      --ETVAELE-------------LSARVIAQAFSTALSPCFGPVHINIPLDEPLYGGELMA
MEND_NOSS1      M--------------GMLAYLRQTLVHSWYRMQAP---TPGPVHLNIPFRDPLAPIPDG-
MEND_TRIV2      M--------------GMLGYLRQTVIHSWYRMQAP---TPGPVHLNIPFRDPLAPIPDG-
MEND_TRIEI      L--------------KRLEYLRQTVIHGWEKTMFP---TPGPVHFNIPFRDPLAPINQ--
MEND_MICAN      I--------------ERLRYLRQTIIHAWWRCLDP---VPGVVHLNLPFRDPLAPTPD--
MEND_ACAM1      P--------------EMLAYLRQTCVYAWEQSQRP---VPGPVHLNIPFRDPLAPISD--
MEND_SYNJA      L--------------EALAYLRQMIIHAWERALYP---FPGPVHLNVPLRDPLAPVADG-
MEND_SYNJB      P--------------EALAYLRQTLVHAWERTLYP---FPGPVHLNVPFRDPLAPIADG-
MEND_SYNP6      L--------------GLLRYLRQTAQQAWQQALR-----GGPVHLNQPLREPLAPIADP-
MEND_SYNE7      L--------------GLLRYLRQTAQQAWQQALR-----GGPVHLNQPLREPLAPIADP-
MEND_THEEB      L--------------PLLPYLRQTLCHSWQTALWP---DPGPVHLNIPLRDPLDLRSQA-
MEND_SYNY3      M--------------DYCHYLRQTALHSWQKCFWP---GLGVVHLNCPFDEPLVPLEHAR
MEND_BDEBA      ----------------SENSHLSFKSLSWK----------KPIHVNVSFEEPLIDGPVPQ
MEND_PARUW      ----------------AENEFFQLDQWSGR----------GPCHLNVCFEEPSKNDN--Q
MEND_PROM0      E--------------TQENEILNLVRITEKQISTF----PGPIHLNIPIDKPLDISFLNK
MEND_PROM2      E--------------TQENEILNLVRIIEKQISTF----PGPIHLNIPIDKPLGISFLNK
MEND_PROM9      E--------------TQENEILNLVQITEKQISTF----PGPIHLNIPIDKPLGISFLNK
MEND_PROMS      E--------------TEENEIFNLVRISEKQMSTF----PGPIHLNVPIDKPLDISFLNK
MEND_PROM5      K--------------NNDDDILKIVKMIKKQLLQS----PGPIHLNIPFEKPLDISLKNK
MEND_PROMP      E--------------NNDDDILKIVETVKKQILQS----PGPIHLNIAFEKPLDISLKNK
MEND_PROM1      L--------------ISKERLTSLVGKSFEMASNI----PGPVHINLAYEEPLHPCEIDQ
MEND_PROMT      L--------------ISKERLTSLVGKSFEMASNI----PGPVHINLAYEEPLHPCELDQ
MEND_PROMA      E--------------ISGRSFFTLVKKTWEKAHAY----PGPVHLNIPIEEPLHASFLEQ
MEND_PROM3      L--------------FSTETLESFAEEAWQRAHHP----AGAVHLNLPFEEPLHLSEEEQ
MEND_PROMM      L--------------FSKETLESFAEKAWQRAHHP----AGAVHLNLPFEEPLHLSEEEQ
MEND_SYNPW      H--------------ENDVQLQSLASSLWERALGS----AGPVHLNLPFEEPLHPSEAEQ
MEND_SYNS3      A--------------GLDQELQALAQNAWRHLHQQ----PGPVHLNLPFEEPLHPDLDQQ
MEND_SYNPX      S--------------QPPQALFDLAHEAWRHCHGR---PPGPVQLNLPFEEPLHGAPEDQ
MEND_SYNSC      T--------------QANDALNALAVKAWQQAQGAGTGPPGAVHLNLPFEEPLHTTLEQQ
MEND_SYNS9      A--------------MASHAVLELAALAWSQAHGADQAAAGPVHLNLPVEEPIHAPLQEH
MEND_SYNR3      D--------------ASDERLLRLAQSAMRHALGA---PAGPVHLNLAFDEPLHADLSGL
                                                           :.:              

MEND_ECOLI      ----------DTGLSWQQRLGDWWQD-DKPWLRE-----APRLESEKQRDWFFWRQKRGV
MEND_ECOHS      ----------DTGLSWQQRLGDWWQD-DKPWLRE-----APRLESEKQRDWFFWRQKRGV
MEND_ECOLC      ----------DTGLSWQQRLGDWWQD-DKPWLRE-----APRLESEKQRDWFFWRQKRGV
MEND_SHIF8      ----------DTGLSWQQRLGDWWQD-DKPWLRE-----APRLESEKQRDWFFWRQKRGV
MEND_SHIFL      ----------DTGLSWQQRLGDWWQD-DKPWLRE-----APRLESEKQRDWFFWRQKRGV
MEND_ECO24      ----------DTGLSWQQRLGDWWQD-DKPWLRE-----APRLESEKQRDWFFWRQKRGV
MEND_SHIBS      ----------DTGLSWQQRLGDWWQD-DKPWLRE-----APSLESEKQRDWFFWRQKRGV
MEND_ECO57      ----------DTGLSWQQRLGDWWQD-DKPWLRE-----APRLESEKQRDWFFWRQKRGV
MEND_SHISS      ----------DTGLSWQQRLGDWWQD-DKPWLRE-----APRLESEKQRDWFFWRQKRGV
MEND_ECOK1      ----------DTGISWQQRLGDWWQD-DKPWLRE-----APRRESEKQRDWFFWRQKRGV
MEND_ECOL6      ----------DTGISWQQRLGDWWQD-DKPWLRE-----APRRESEKQRDWFFWRQKRGV
MEND_ECOL5      ----------DTGISWQQRLGDWWQD-DKPWLRE-----APRRESEKQRDWFFWRQKRGV
MEND_ECOUT      ----------DTGISWQQRLGDWWQD-DKPWLRE-----APRRESEKQRDWFFWRQKRGV
MEND_ECOSM      ----------DTGLSWQQRLGDWWQD-DKPWLRE-----APRLESEKQRDWFFWRQKRGV
MEND_SHIDS      ----------DTGLSWQQRLGDWWQD-DKPWLRE-----APRLESEKQRDWFFWRQKRGV
MEND_SALCH      ----------DTGLVWQQRLGDWWQD-EKPWLRE-----ARRLESDKQRDWFFWRQKRGV
MEND_SALTY      ----------DTGLVWQQRLGDWWQD-EKPWLRE-----ARRLESDKQRDWFFWRQKRGV
MEND_SALPA      ----------DTGLVWQQRLGDWWQD-EKPWLRE-----ARRLASDKQRDWFFWRQKRGV
MEND_SALPB      ----------DTGLVWQQRLGDWWQD-EKPWLRE-----ARRLASDKQRDWFFWRQKRGV
MEND_SALTI      ----------DTGLVWQQRLGDWWQD-EKPWLRE-----ARRLASDKQRDWFFWRQKRGV
MEND_SALAR      ----------DTGLVWQQRLGDWWQD-EKPWLRE-----ARRRESDKQRDWFFWRQKRGV
MEND_CITK8      ----------DTGLAWQQSLGDWWQD-DKPWLRE-----ARRLESDKQRDWFFWRQKRGV
MEND_KLEP7      ----------ETGVEWQQQLGNWWQS-DKPWLRQ-----ALQLESEKQRDWFFWRQKRGV
MEND_ENT38      ----------DTGVEWQQTLGDWWQS-DKPWLRA-----QTHLQSGQQRDWFHWRQKRGV
MEND_YERPA      ----------QQYADWSASLGDWWQD-CHPWLRQTCYPPSLYQPPAQQADWFFWRQKRGV
MEND_YERPE      ----------QQYADWSASLGDWWQD-CHPWLRQTCYPPSLYQPPAQQADWFFWRQKRGV
MEND_YERPN      ----------QQYADWSASLGDWWQD-CHPWLRQTCYPPSLYQPPAQQADWFFWRQKRGV
MEND_YERPP      ----------QQYADWSASLGDWWQD-CHPWLRQTCYPPSLYQPPAQQADWFFWRQKRGV
MEND_YERPS      ----------QQYADWSASLGDWWQD-CHPWLRQTCYPPSLYQPLAQQADWFFWRQKRGV
MEND_YERE8      ----------QCYADWSATLGDWWQD-CHPWLRQ-----SRPLPQIEQADWLFWRQKRGV
MEND_SERP5      ----------QQYADWSATLGDWWQG-NHPWLRE-----VDPHQVLKQPDWFFWRQKRGV
MEND_PECAS      ----------TAYQDWLMTLGDWWNS-REPWLRE-----MRQSTLVVQPDWPQWRQKRGV
MEND_PHOLL      ----------PAYDEWQQQLGDWWKS-KTPWLSQ-----PVAKVVAEVPDWDCWQQKKGV
MEND_CROS8      ----------ETDLTWQQAPGEWWQT-TTPWLRY-----EKIQAVSAQADWPFWREQRGV
MEND_HAEI8      ----------VNSHSWLQPLQRWLIQ-NKSWINVE----VQQNEVLMHENWDHWRTKRGV
MEND_HAEIG      ----------VNSHSWLQPLQRWLIQ-KKSWINVE----VQQNEVLMHENWDHWRTKRGV
MEND_HAEIN      ----------VNSHSWLQPLQRWLIQ-NKSWINVE----AQQNEVLMHENWDHWRTKRGV
MEND_HAEIE      ----------VDSHSWLQPLQRWLIQ-TKPWMNVE----AQQNEVLMHENWDHWRTKRGV
MEND_PASMU      ----------IEAHSWLVPIQRWLNQ-HKPWIQQQ----TDQKEVLMHANWDHWRTMRGV
MEND_MANSM      ----------IDVHPWLAPVQRWLNH-NKPWADHQ----ALQEEVVMHEHWDNWRTKRGV
MEND_ACTSZ      ----------IDEHVWLGPVRRWLGQ-HKKWTEYQ----EPQLEVLMHEHWDDWRTKRGV
MEND_HAES1      ----------IDLHPWLSNIQSWLTQ-NKNWIQHQ----EQHTEVITHKYWDQWRTKKGI
MEND_HISS2      ----------IDLHPWLSNIQSWLTQ-NKNWIQHQ----EQHTEVITHKYWDQWRTKKGI
MEND_ACTP2      ----------INTHPWLKPIQSWLINPQTKWINSQ----TIQSEVSMHENWDYWRTKRGV
MEND_ACTPJ      ----------INTHPWLKPIQSWLINPQTKWINSQ----TIQSEVSMHENWDYWRTKRGV
MEND_HAEDU      ----------INNTPWLKPLQSWLIKPTAKWLNSQ----SIQSEVSMHENWDYWRTKRGV
MEND_PHOPR      ----------VDFSEYLAPVSEWKGD-ELPYVSH--QQALAPHIAIDKRQWQSLTQRKGV
MEND_ALIF1      ----------SLLVDYLAPIQNWKAD-TSSYI-Q--QTPYFSHVTLSP-NWMQTARKKGV
MEND_VIBC3      ----------AIYQPYLQPVQRWREQ-ARPYTQV--HQGLVQSVPAAI----DGLLTKGV
MEND_VIBCH      ----------AIYQPYLQPVQRWREQ-ARPYTQV--HQGLVQSVPAAI----DGLLTKGV
MEND_VIBCB      ----------STYQGYLDTVAGWRDS-KVTYC----QRFNPKTSSAIP----SCGDNKGL
MEND_VIBPA      ----------SAYQSYLSSVEAWRKG-GQTYT----QRFVSPSFRDIP----FCADRKGV
MEND_VIBVU      ----------SIYQSYIDTVDVWRAE-GGIYSN---KQMPLPMPPSLA----EIEQRKGV
MEND_VIBVY      ----------SIYQSYIDTVAVWRAE-GGIYSN---KQMPLPMPTSIA----EIEQRKAV
MEND_AERHH      -----YLDFSA----YLAPLGDWLRS-SEPWSPWQL----TQAPCPCQPDWDELQGKRGL
MEND_AERS4      -----YLDFSG----YLAPLGDWLHS-SEPWSPWQQ----NEQICPRQPDWAALQGKRGI
MEND_PSYIN      -----TLNYQG----YLQSLKQWLID-KQPFSQYFQ----NKDSFQAASN-TQLRDKKVL
MEND_SHEB5      -----SGVILDAESPYLKPLQTWLQL-ARPYTQYGKS---KQLSSPSDDAIMRFVHGKGV
MEND_SHEB9      -----SGVILDTESPYLKPLQTWLQL-ARPYTQYGKC---KQLSSPSDDAIMRFVHGKGV
MEND_SHEB8      -----GGAILDAESPYLKPLQTWLQL-ARPYTQYGKS---KQLSSPSDDAIMRFVHGKGV
MEND_SHEPC      -----GVPILDTESPYLKPLQTWLQL-SRPYTQYGKY---KQVSNPSDDAIMRFVHGKGV
MEND_SHESW      -----GTPILDTESPYLKPLQTWLQL-SRPYTQYGKY---KQVSNPSDDAIMRFVHGKGV
MEND_SHESA      -----SGTILDSESPYLRPLQTWLQH-AKPYTQYGKS---EQLSSPSDDAIMRFVHGKGV
MEND_SHESM      -----SGTILDSESPYLRPLQTWLQH-ARPYTQYGKS---EQLSSPSDDAIMRFVHGKGV
MEND_SHESR      -----SGTILDSESPYLRPLQTWLQH-ARPYTQYGKS---EQLSSPSDDAIMRFVHGKGV
MEND_SHEON      -----TATILDSESPYLKPLQTWLQQ-ARPYTIYGKR---EQLSHPSEDAIMRFVHGKGV
MEND_SHEHH      -----SVDFSR----YLAPIAKWQQQ-TKPYSQFATM---NSGQMPTSDALARFVHGKGV
MEND_SHEPA      -----KVDFEH----YLAPVKQWQQH-TAPYSQFANL---TSGLMPTADALARFVHGKGV
MEND_SHESH      -----SADFTQ----YLSTLGNWQHT-TSPFNQYGKT---SQHSLPTQDSLARFVHGKGV
MEND_SHEWM      -----SANFTQ----YLSTLGNWQHT-NHAYNQYGKP---NLSSLPSSDAMARFVHGKGV
MEND_SHELP      -----SADFTH----YLSPLGNWQHS-ALPYNQFADA---QLVSAPTSDALARFVHGKGV
MEND_SHEAM      -----RFDQFDS---YLSRLGQWQDT-QVPYLSVANA---SLSAFPPRDAMMRFVHGKGV
MEND_SHEFN      LAHV-KKTASVTTSTYLAPLNQWFEN-TKPLTRYASL---TSAELPTTDTLMRFVHGKGV
MEND_HALHL      ----------------HPPVAPPLPP---------------RRAPRAAAPPLGPAEPPQL
MEND_PELLD      QD------------PWLEPLQAWKLD-GRPRTSSAQPERRPDARAMATIRELLATARRPL
MEND_CHLPM      PE------------PWLEPLQAWQTG-RRPSTVAAQPEKHPDMDSMRTLRELTGNARQPL
MEND_CHLCH      NNH-----------AWWQSAQQWLAS-KAAHTTTTVEKKHPNNASITLLRQHLTTAKQPL
MEND_CHLPD      KD------------PWLAPVAHWIDS-AEPLRRCSHAENVPHPAVIEKTAELIKASRQPL
MEND_CHLTE      GH------------PWAAPLETWQAS-GEPWSRFARPLHEPSAESIVTLRELLAQAERPL
MEND_RUBXD      ----------------PDGLPDLWPG-DGPYTRYARAAPVPDEAEVRELASALGAAERGV
MEND_SALRD      SV------------AVPTAVDAWARG-TEPYTHYPTPAPSPPGPEVDALAETVRGTEHGL
MEND_SYNAS      RPI-----------PDELLATAGRLY-AREGAYTTYPSPGTLHTGLEDVEAILNRTARGL
MEND_DECAR      -----------------------VLSGEMPEKISISHPDLQPDLNALGDLARRISGRPGI
MEND_PAEAT      LPA----------------AAGHGVF----------HYDAGPQALNLPAASGELAERRTV
MEND_ARTS2      LPE----------------ATGRRTW----------QIGRGPEPLTLAPAPATLAERRTV
MEND_RENSM      --D----------------FRPLKSS----------QPVDAAIETIIPQHQESEHRYQTV
MEND_CLAM3      AEA----------------VAEAHAAADAE-----AAAAPAPAGPTAADVLDLPHGPRTL
MEND_CLAMS      TEA----------------VAEVRAA---------APATPAPAGPATADVLDLPHGPRTL
MEND_LEIXX      PVV----------------ERGALPA-------------LAGAQKLGRETVVPGIGPSTV
MEND_KINRD      PPG----------------PGLTQVH-----------------GPGAPAPVALERGPRTL
MEND_NOCSJ      PDV----------------VPGEPAH-----------------RVIPASLTVLARGPRTV
MEND_CUTAK      PQA----------------L-VPRRV-----------------SSFPTAPTPLVMPARTV
MEND_COREF      LH-------------------------------------GQRGPVDWEQRW-VDHGVVDV
MEND_CORGB      LH-------------------------------------GEAVGASWTHRW-INHGEVTV
MEND_CORDI      V--------------------------------------GDPVERVREVIE-VDHGEVVL
MEND_CORJK      LSL----------------WAGEIAAAEDAATTEGAHDSHAPSQPTRGPRK-LPYGQVEV
MEND_MYCA1      HG--------------------------------APTPAGRPGGRPWTYTP-----PVSF
MEND_MYCPA      HG--------------------------------APTPAGRPGGRPWTYTP-----PVSF
MEND_MYCBO      LG--------------------------------AVTPPGRPAGKPWTYTP-----PVTF
MEND_MYCBP      LG--------------------------------AVTPPGRPAGKPWTYTP-----PVTF
MEND_MYCTA      LG--------------------------------AVTPPGRPAGKPWTYTP-----PVTF
MEND_MYCTU      LG--------------------------------AVTPPGRPAGKPWTYTP-----PVTF
MEND_MYCUA      HG--------------------------------AVTPPGRPEGRPWTYTP-----PVTF
MEND_MYCLE      HG--------------------------------AITPQGRPGGKPWTYIP-----QVTF
MEND_MYCGI      S---------------------------------AYAPEGRPGGKEWTYTP-----AVTF
MEND_MYCVP      AV--------------------------------PYAPDGRPDGRPWTYTP-----PVTF
MEND_MYCSK      G----------------------------------SCPPGRPDGKPWTHTP-----PVTF
MEND_MYCSS      G----------------------------------SCPPGRPDGKPWTHTP-----PVTF
MEND_MYCSJ      G----------------------------------SCPPGRPDGKPWTHTP-----PVTF
MEND_MYCS2      AG--------------------------------GTIPPGRPGGRSWTHTP-----PVTF
MEND_NOCFA      EG--------------------------------EAEPAGRAGGAPWTATQ-----YATL
MEND_RHOJR      AQ--------------------------------GPVPQGRPGGAAWTTTQ-----HATL
MEND_SACEN      DW--------------------------------CEPLDGRADGQRWTEVSGNESAPSTL
MEND_THEFY      PWP----------------EPVTGRPD-------GKPWITVDLQRNEPEPVELPWVERGV
MEND_HALMA      DDP----AGVPADWAGGDNGAKIGRDG--PFVTTSEGVETPDEQTVRRVQDALEAAERGL
MEND_NATPD      PPAGVPDGAVPDGFATENPLAARGRDG--PFVEVHSGCTDPSATTVDELATAVEAAASGL
MEND_HALS3      -------GDVPPSFDDDHPLAAAGRGGDTPFVSVHDGTTEPAGETAAALAAAATTAARPL
MEND_HALSA      -------GDVPPSFDDDHPLAAAGRGGDTPFVSVHDGTTEPAGETAAALAAAATTAARPL
MEND_HALWD      -------GDIPDDLSEE---SITGRDG--AFVESTTGNRVLDENSVNRIAQSLSTS-RGL
MEND_ROSCS      -----------GDLTEPPAAAQPRDDGAPYTCFLRSAPPAPPEAVIEPIAAVLEQHERGL
MEND_ROSS1      -----------GDITAPPDAAQPRQAGAPYTYCLTATRSGVPEAVIEQIASLLQQHERGL
MEND_CHLAA      --------------------MAALFSETPSAVQVTPARRMIGGAELAMLATSLVEYRRGL
MEND_MYXXD      -------------PEASLSALAKSGRAGAPLTRIVPPEPVPDASTLDEVRRRIAATTRGV
MEND_SORC5      -------------PEPWQAEWEALMRRAG--TRVVSARAGVDGRAIEELAARCARAERGL
MEND_BACSU      PFG-------------------RMRTG--RHVSVKTGTQSVDRESLSDVAEMLAEAEKGM
MEND_BACVZ      PFE-------------------RMRKG--RHVSVTTGIQSADQDSLCHITERLAGTERGM
MEND_BACLD      PFQ-------------------RLRSG--SHVTVESGRFRADRHELVALSALIKETEKGV
MEND_BACP2      PFD-------------------REETD--RKKVLATGQAYPNDDALSEIVTVMNRSKKGL
MEND_BACAH      SLW-------------------DKGRG-EYTGVVQQGNAVMPSEYVDSLVGRLSHMEKGL
MEND_BACHK      SLW-------------------DKGRG-EYTGVVQQGNAVMPSEYVDSLVGRLSHMKKGL
MEND_BACAN      SLW-------------------DKGRG-EYTGVVQQGNAVMPSEYVDSLVGRLSHMEKGL
MEND_BACCZ      SLW-------------------DKGRG-EYTGVVQQGNVVMPSEYVDSLVGRLSHMEKGL
MEND_BACC1      SLW-------------------DKGRG-EYTGVVQRGNAVMPSEYVDSLVGRLSHMEKGL
MEND_BACCR      SLW-------------------DKGRS-EYTGVVQQGNAVMPSEYVDSLVGRLSHMEKGL
MEND_BACCN      GLW-------------------EQGCG-EYTNRVQQGSMTLTSEYIRSLIKRLSRLEKGL
MEND_GEOKA      AVW-------------------ERVRSVSRAPQVWRGRPALPQESVSALYEQLSAAERGL
MEND_GEOTN      AVW-------------------EKVRTVAETPQIMSGRATLPAENVAALYEQLAAAKRGL
MEND_OCEIH      AIW-------------------G-TKSYTRQNIMQEGTKQLAPNQLQILLEEVGPNKKGL
MEND_LISMF      PFT-------------------ATGKK-HHHVHIYYTHEVLDDSSIQKMVTECTG-KKGV
MEND_LISMO      PFT-------------------ATGKK-HHHVHIYYTHEVLDDSSIQKMVTECTG-KKGV
MEND_LISIN      PFT-------------------ATGKK-HHHVHIYYTHEVLDDSSIQKMVTECTG-KKGV
MEND_LISW6      PYT-------------------ATGKK-HHHVHIYYTHEVLDDSSIQKMVTDCTG-KKGV
MEND_ENTFA      TKS-------------------SQQTA------LFAGQSILSTEQVQQLADQWYQ-KNGV
MEND_LACLM      NYE-------------------KGRSK--LPFKFFKGQQS------ASFDEALLSSKT-L
MEND_LACLS      NYE-------------------KGRYK--LPFKFFKGQQS------AFFDEALLSSKT-L
MEND_LACLA      NYE-------------------KGRSK--HAFKFYEGQAQV----ILPFDEALLSGKT-L
MEND_DESHY      DFT-------------------AGRLD--YPFAWKTGEKG------LTMDSSVFQDKKGI
MEND_LEUCK      ----------------------SHDVS---------ITPLTFEKTHIHILPIVIKQTHVV
MEND_LEUMM      ----------------------QDEVH---------VQRVVFDKQSVQYRLPPITAKRLL
MEND_STAA1      ELL-------------------TSEMK---------ILPHYQKSIDASALRHILNKKKGL
MEND_STAA9      ELL-------------------TSEMK---------ILPHYQKSIDASALRHILNKKKGL
MEND_STAAN      ELL-------------------TSEMK---------ILPHYQKSIDASALRHILNKKKGL
MEND_STAA2      ELL-------------------TSEMK---------ILPHYQKSIDASALRHILNKKKGL
MEND_STAAM      ELL-------------------TSEMK---------ILPHYQKSIDASALRHILNKKKGL
MEND_STAAS      ELL-------------------TSEMK---------ILPHYQKSIDASALRHILNKKKGL
MEND_STAAW      ELL-------------------TSEMK---------ILPHYQKSIDASALRHILNKKKGL
MEND_STAA3      ELL-------------------TSEMK---------ILPHYQKSIDASALRHILNKKKGL
MEND_STAAE      ELL-------------------TSEMK---------ILPHYQKSIDASALRHILNKKKGL
MEND_STAA8      ELL-------------------TSEMK---------ILPHYQKSIDASALRHILNKKKGL
MEND_STAAC      ELL-------------------TSEMK---------ILPHYQKSIDASALRHILNKKKGL
MEND_STAAT      ELL-------------------TSEMK---------ILPHYQKSIDASALRHILNKKKGL
MEND_STAAB      ELL-------------------TSEMK---------ILPHYQKSIDASALRHILNKKKGL
MEND_STAAR      ELL-------------------TSEMK---------ILPHYQKSIDASALRHILNKKKGL
MEND_STAEQ      DLL-------------------TSVTK---------TLPHYQKSISVDDIKDILQEKNGL
MEND_STAES      DLL-------------------TSVTK---------TLPHYQKSISVDDIKDILQEKNGL
MEND_STAHJ      EWL-------------------TSYSK---------KLPHYQKNINVQDIRHILKEKKGL
MEND_STAS1      EWL-------------------TSDTK---------ILPHYQKTTSLNEISAMMKKRKGL
MEND_BACFN      LP--------------------EVRVIT-----RYQGLNVYDRD-YDGLIDRLNKYNRRM
MEND_BACFR      LP--------------------EVRVIT-----RYQGLNVYDRD-YDGLIDRLNKYNRRM
MEND_BACTN      LP--------------------EVRVIT-----RYQGLNVYDRD-YNDLIERLNRYQKRM
MEND_BACV8      LP--------------------EVRVIT-----RYQGLSVYDRD-YKELIERLNKYNKRM
MEND_PARD8      LP--------------------KVRVIT-----RYQGLNVYDRK-YDDLIERLNKYSKRM
MEND_FLAJ1      SV--------------------EPKITN-----LEEFLETKIIENEDEIVSIWNSSKRKL
MEND_FLAPJ      SV--------------------NTKIID-----FDT--ENKPLENLDVFVNRWNDAKKKL
MEND_GRAFK      NV--------------------NPLQIF-----PEIKERHYSEKQLQNYANEWNRAERKM
MEND_PORGI      SG--------------------KERAIT-----FVRERQELPEEVWDMLVKRFLEAPRVM
MEND_CYTH3      FSG-------------------SPTVIK-----REQPLHTLSDEQWKSIQHKLDSYKKIL
MEND_DESPS      ESL-------------------IALSPL-----QLAEPKGMSPALWQEVESAWRGAKRRM
MEND_NOSS1      TDLSYLLAKFHPEEF---FAGITDT------------TPLPH-HSPLSIPPEWLQSQRGI
MEND_TRIV2      ADLSYLLTKFHPEEF---FAGITDT------------TSLPD-HSQLSIPPEWLKSQRGI
MEND_TRIEI      PEAIALESKFSQNFFAS-LRPIIRT------------ELIPN-SDLIELLKNQFKSHSGI
MEND_MICAN      LEINNLEANFDQEAF---FSHISRQ------------NIAIN-HSILQINSLPSK---GI
MEND_ACAM1      LETESLAATFDIDQFFAAVHPLPSV------------QISLDLQTTNVYLDQWMSCDRGL
MEND_SYNJA      STAPLVHLQEDPEFEKTFFRGVISP-----SGLVTPAGGSAFAS-TASFWREWCGCERGV
MEND_SYNJB      STAPLLHLQEDPEFEKTFFRGVAPPC----TGSSLQAVRSPFQTETVSFWQEWRGCERGV
MEND_SYNP6      ATQTWLAQQWPGENF---FAELLTA--------------VPTPQIQQPLPPLPSQ---GL
MEND_SYNE7      ATQTWLAQQWPGENF---FAELLTA--------------VPTPQIQQPLPPLPSQ---GL
MEND_THEEB      NFHGELPKGF--------FDQVQPF--------------VPPRVVTSLPWQTWQQMQRGL
MEND_SYNY3      ESLQHLAEEFSKEHFYRGLTTFTTMN----RGE--AISLPVNFSIFSFPSPQLDFSPLGL
MEND_BDEBA      IHIPSVSERTKLPVQ-------------------------IPLGTLKEMETFVNTHKPLV
MEND_PARUW      ECARSFSMGIFTPKP-------------------------ILCDSHLLDEFIQKCQFPLV
MEND_PROM0      KNVLEVFKRIYLKKQYV--FQKVEI-------------KSDKNKFLE-ISKIFNLDESGI
MEND_PROM2      KNVLEVFKRIYLKKKYI--FQEFEI-------------KSDKKKFLE-ISKSLNLDESGI
MEND_PROM9      KNVLEVFERIYLKKKYV--FQEVEI-------------KSNKNKFLE-ILENLNLDESGI
MEND_PROMS      KNVLEVFERIYLKKKYV--FQEVDI-------------KSDKKKFLE-ISKNLNLDESGI
MEND_PROM5      RKTLKVFETLYLNKTCK--FLKQNE-------------QNKSIHFSKRIFESLDLSNSGI
MEND_PROMP      KKNFEVFERFYLNKTYK--FLKNDN-------------QNKNIQFSEKFFKRINLSNPGI
MEND_PROM1      NKVLDGWGIEGFLKE----KVTPNK-------------VEVFKSFQSLKLPKLDPFSLGI
MEND_PROMT      KKVLDGWVIEGFLKG----KITPTK-------------DEVVKSFQSLKLLKLDPFSLGI
MEND_PROMA      KEVCNGWKPLNFEEI----QLPIST-------------VSTNTRIKTKEVPELDPSQPGI
MEND_PROM3      RVIWKGWSPKIPRSAPITPTNLAMA-------------AEGTEGVTDRAPFALDPFRPGV
MEND_PROMM      RMIWKGWSPKIPRSSPIKPINLAMA-------------AEGTNGVTDQAPFALDPLRPGV
MEND_SYNPW      QAFWSAWQPLPA-------AGGEHH-------------PAEPR-STPWDGPVPDWSRPGV
MEND_SYNS3      STFWSQWNSSES-------VAITHN-------------PELCKPTSHSEAPSLDPDQPGV
MEND_SYNPX      LSLQVSGLQRSAPA--------------------------PSSDSPLGAAPQLDPNQAGV
MEND_SYNSC      QQLASAALPPTACP--------------------------EPSPG-IGPALRLDPERPGV
MEND_SYNS9      QPLLDAVLASDEASL--------FP-------------LQPSTIQSNRDVPRLDPSRPGV
MEND_SYNR3      PAAAPPAAQELPPLF---------------------------EPPGLGSLEPLDPDQPGV
                                                                           .

MEND_ECOLI      VVAGRMSAE---------EGKKVALWAQTLGWPLIGDVLS--QTGQ--------PLPCAD
MEND_ECOHS      VVAGRMSAE---------EGKKVALWAQTLGWPLIGDVLS--QTGQ--------PLPCAD
MEND_ECOLC      VVAGRMSAE---------EGKKVALWAQTLGWPLIGDVLS--QTGQ--------PLPCAD
MEND_SHIF8      VVAGRMSAE---------EGKKVALWAQTLGWPLIGDVLS--QTGQ--------PLPCAD
MEND_SHIFL      VVAGRMSAE---------EGKKVALWAQTLGWPLIGDVLS--QTGQ--------PLPCAD
MEND_ECO24      VVAGRMSAE---------EGKKVALWAQTLGWPLIGDVLS--QTGQ--------PLPCAD
MEND_SHIBS      VVAGRMSAE---------EGKKVALWAQTLGWPLIGDVLS--QTGQ--------PLPCAD
MEND_ECO57      VVAGRMSAE---------EGKKVALWAQTLGWPLIGDVLS--QTGQ--------PLPCAD
MEND_SHISS      VVAGRMSAE---------EGKKVALWAQTLGWPLIGDVLS--QTGQ--------PLPCAD
MEND_ECOK1      VVAGRMSAE---------EGKKVALWAQTLGWPLIGDVLS--QTGQ--------PLPCAD
MEND_ECOL6      VVAGRMSAE---------EGKKVALWAQTLGWPLIGDVLS--QTGQ--------PLPCAD
MEND_ECOL5      VVAGRMSAE---------EGKKVALWAQTLGWPLIGDVLS--QTGQ--------PLPCAD
MEND_ECOUT      VVAGRMSAE---------EGKKVALWAQTLGWPLIGDVLS--QTGQ--------PLPCAD
MEND_ECOSM      VVAGRMSAE---------EGKKVALWAQTLGWPLIGDVLS--QTGQ--------PLPCAD
MEND_SHIDS      VVAGRMSAE---------EGKKAALWAQTLGWPLIGDVLS--QTGQ--------PLPCAD
MEND_SALCH      VVAGRMSAE---------EGKKVAQWAQTLGWPLIGDVLS--QTGQ--------PLPCAD
MEND_SALTY      VVAGRMSAE---------EGKKVAQWAQTLGWPLIGDVLS--QTGQ--------PLPCAD
MEND_SALPA      VVAGRMSAE---------EGKKVAQWAQTLGWPLIGDVLS--QTGQ--------PLPCAD
MEND_SALPB      VVAGRMSAE---------EGKKVAQWAQTLGWPLIGDVLS--QTGQ--------PLPCAD
MEND_SALTI      VVAGRMSAE---------EGKKVAQWAQTLGWPLIGDVLS--QTGQ--------PLPCAD
MEND_SALAR      VVAGRMSAE---------EGKKVAQWAQTLGWPLIGDVLS--QTGQ--------PLPCAD
MEND_CITK8      VVAGRMSAE---------EGKKVALWAQTLGWPLIGDVLS--QTGQ--------PLPCAD
MEND_KLEP7      VVAGRMSAA---------EGKKVAEWAQTLGWPLIGDVLS--QTGQ--------PLPCAD
MEND_ENT38      ILAGRMTAA---------EGKQVAEWAKTLGWPLIGDVLS--QTGQ--------PLPCAD
MEND_YERPA      VIAGRMGAQ---------EGRQLTAWAAMLGWPLIGDVLS--QTGQ--------PLPCAD
MEND_YERPE      VIAGRMGAQ---------EGRQLTAWAAMLGWPLIGDVLS--QTGQ--------PLPCAD
MEND_YERPN      VIAGRMGAQ---------EGRQLTAWAAMLGWPLIGDVLS--QTGQ--------PLPCAD
MEND_YERPP      VIAGRMGAQ---------EGRQLTAWAAMLGWPLIGDVLS--QTGQ--------PLPCAD
MEND_YERPS      VIAGRMGAE---------EGRQLTAWAAMLGWPLIGDVLS--QTGQ--------PLPCAD
MEND_YERE8      VIAGRMTAE---------EGEQLAQWAELLGWPLIGDVLS--QTGQ--------PLPCAD
MEND_SERP5      IVAGRMSAD---------EGEHLAQWAEMLGWPLIGDVLS--QTGQ--------PLPCAD
MEND_PECAS      VLAGRVSAE---------QGARLAAWANELGWPLIGDVLS--QSGQ--------PLPCAD
MEND_PHOLL      VLAGRMSAE---------EGVNVAKWAKALSWPLIGNALS--QTGQ--------PLPCAD
MEND_CROS8      VLAGRLTAQ---------EGEAVAQWAARLGWPLIGDVLS--QTGQ--------PLPCAD
MEND_HAEI8      VVVGQLPAE---------QAMGINSWASAMGWVLLTDIQS--GVVP--------TTPYED
MEND_HAEIG      VVVGQLPAE---------QAMGINSWASAMGWVLLTDIQS--GVVP--------TTPYED
MEND_HAEIN      VVVGQLPAE---------QAMGINSWASAMGWVLLTDIQS--GVVP--------TTPYED
MEND_HAEIE      VVVGQLPAE---------QAMGINSWASAMGWVLLTDIQS--GVVP--------TTPYED
MEND_PASMU      IVVGRLPVE---------QTMGIMAWANTMGWIALTDVQS--SVEA--------SLPYAD
MEND_MANSM      IVAGRLTQE---------QSMGITAWANTMGWVVLTDIQS--GVEP--------SLPYAD
MEND_ACTSZ      IVAGKLPQG---------HGMGLKLWAETMGWVLLTDVQS--GVEP--------TLPYAD
MEND_HAES1      IIVGRLPSE---------QAMGIAEWADNMGWIMITDIQS--HVKP--------TLPYAD
MEND_HISS2      IIVGRLPSE---------QAMGIAEWAENMGWIMITDIQS--HVKP--------TLPYAD
MEND_ACTP2      IVVGKLPVE---------QGIGIKAWAETLGWCLITDVQS--CVDA--------NLPYAD
MEND_ACTPJ      IVVGKLPVE---------QGIGIKAWAETLGWCLITDVQS--CVDA--------NLPYAD
MEND_HAEDU      IIVGKLPVE---------QGVGIKAWAETLGWCLLTDIQS--CVDA--------SLPYAD
MEND_PHOPR      VIVGRLAPE---------ELGQVTLLAEKLGWPLLLDPQA--GGSS--------AWAGFD
MEND_ALIF1      VIIGKVSLE---------EANCAAQLAKELGWPVLADPQS--GYYS--------EWAHYD
MEND_VIBC3      VIVGSLSLQ---------EAQAAKRFAKAMGWPLLCDPQS--GISS--------QWAHFD
MEND_VIBCH      VIVGSLSLQ---------EAQAAKRFAKAMGWPLLCDPQS--GISS--------QWAHFD
MEND_VIBCB      VVIGSLPLI---------QAQAARTFAEQMGWPVLADPQS--GVSS--------DWAHFD
MEND_VIBPA      VVIGSLSAE---------HAQEAKAFAQQMGWPVLADPQS--GVSS--------DWSHYD
MEND_VIBVU      VVIGSVTLQ---------EAKQAHQFGAQMGWPVLCDPQS--GTTS--------DWSGFD
MEND_VIBVY      VVIGSVTLQ---------EAKQAHQFAAQMGWPVLCDPQS--GTTS--------DWSGFD
MEND_AERHH      IVAGRIQDPV--------QAKAVAALAERLGWPLLADLQS--QLRFDGR-----NLVHAD
MEND_AERS4      IVAGRIQDPA--------QAQVVAELAERLGWPLLADLQS--QIRFDAR-----NLIHMD
MEND_PSYIN      VIAGRVTGIN--------QAQAIAEFAALNNYPLLADLQS--ALTGNAN-----NLHYYD
MEND_SHEB5      IVVGTLTPEQ--------DPQQLIALSQKIGWPLLTDAQS--QLRQHPA-----AIGNID
MEND_SHEB9      IVVGTLTPEQ--------DPQQLIALSQKIGWPLLTDAQS--QLRQHPA-----AIGNID
MEND_SHEB8      IVVGTLTPEQ--------DPQQLIALSQKIGWPLLTDAQS--QLRQHPA-----AIGNID
MEND_SHEPC      IVAGTLTPEQ--------DPQQLIALSQKIGWPLLTDAQS--QLRQHPA-----AIGNID
MEND_SHESW      IVAGTLTPEQ--------DPQQLIALSQKIGWPLLTDAQS--QLRQHPA-----AIGNID
MEND_SHESA      IIAGTLTPEQ--------DPQQLIALSQKIGWPLLTDAQS--QLRQHPA-----AIGNID
MEND_SHESM      IIAGTLTPEQ--------DPQQLIALSQKIGWPLLTDAQS--QLRQHPA-----AIGNID
MEND_SHESR      IIAGTLTPEQ--------DPQQLIALAQKIGWPLLTDAQS--QLRQHPA-----AIGNID
MEND_SHEON      IIAGTLTPEQ--------DPQQLIALSQKIGWPLLTDAQS--QLRQHPA-----AIGNID
MEND_SHEHH      IVAATLAPEQ--------QSEELIVLAQKLGWPIVTDAQS--QLRQHGG-----AIGNID
MEND_SHEPA      IVAATLAPEQ--------KPEQLIELAQKLGWPIVTDAQS--QLRQHPA-----AIGNID
MEND_SHESH      IIAGTLSPQE--------SPEILVELSQKLGWPLLTDAQS--QLRQHSG-----VIGNVD
MEND_SHEWM      IIAGTLTPDC--------DPQALVALSQKLGWPLLTDAQS--QLRQHPG-----VIGNID
MEND_SHELP      IIAGTLAPEQ--------QPEQLIELAQKLGWPLLTDAQS--QLRQHGA-----AIGNID
MEND_SHEAM      IVAGTLTEAE--------TPTELITLSQKLGWPLLTDAQS--QLRQHPG-----AIGHID
MEND_SHEFN      IVVGTLAPED--------NPQQIVALAQKLGWPVLVDAQS--QLRQHPG-----VIGHVD
MEND_HALHL      FVAGGLNPE---------EAEAVLETAAAGNIPILADPSSQLRLRAHPC-----ILGGAE
MEND_PELLD      LIAGSIPSPD--------DARAVASLADDLRIPLYADLSSGLRLT---------EGTLAW
MEND_CHLPM      IIAGNSTDEN--------DSHAIAELADDLQVPLYADMTSGLRFS---------SSILPW
MEND_CHLCH      LIAGSMRCKD--------DAEAVAALANNLKIPLYADFSSGLRMK---------SNLPPL
MEND_CHLPD      FIAGKLDSRE--------DAIAVGLLAGSLGIPLYADLSSGLRYS---------THCKPW
MEND_CHLTE      FVAGSMSNAA--------DGEAVAALAESLGVPLFADLTSGIRLS---------SDCTPW
MEND_RUBXD      VVAGRLRSRK--------QGEAAARLAAALGWPLLPDICSQARLGARPE-----VSAPYH
MEND_SALRD      VVAGRLDSAA--------AADATRRLATHLGWPLIPDLTSRLRRGGREQP----EQVPYG
MEND_SYNAS      IVIGRLDGPR--------DAPALEELAKKLGWPVFCDIASSMKGRIPS------DRQIFS
MEND_DECAR      IVCGEMPSRDG-------QNEALVALATRLRSPIFAEPLSGLRFGPHDRS----HLCVRY
MEND_PAEAT      VLAGH------------DAGPVAEAFARAHGLPLLAEPSSNARFG-------RNAVGPYR
MEND_ARTS2      VLAGH------------DAGPVAEAFARAHGLPLLAEPSSNSRFG-------PNAVGPYR
MEND_RENSM      VLAGH------------GAGPQAELFARRHGLPLLAEPSSNARFG-------PNAVGPYR
MEND_CLAM3      VVAGH------------AAGEAAEELARAGGWPLAAEISSGSHFG-------PNLVVSFR
MEND_CLAMS      VVAGH------------AAGEAAEELARAGGWPLAAEISSGSHFG-------PNLVVSFR
MEND_LEIXX      VIAGA------------DAGPEAEEYARSAGFPLLAEVSSGSRFG-------PNLVVAYR
MEND_KINRD      VLAGDA--------PDPATGAAARELAESAGWPLLAEPSSGARGG-------ERAVGPYR
MEND_NOCSJ      VVAGD------------DAGPRVRVLAEQAGWPLLAEPSSGSRTG-------DNAIRTYR
MEND_CUTAK      VVAGD------------GAGSLARELAQQGGWPLLAEPTSGSRVG-------DNALTDYQ
MEND_COREF      DLSRN---TLVIAG---DEAWE---IEELAEVPTIAEPTAPVAY---------HPVHPLA
MEND_CORGB      DLGEH---TLVIAG---DEAWE---VEGLEDVPTIAEPTAPKPY---------NPVHPLA
MEND_CORDI      NLNER---ILVVAG---DEAWE---VPGLEDVPTIAEPSAPAPY---------HPVHPLA
MEND_CORJK      DLSRR---TLVIAGSVSDVAWARSIMDELADVPTVAEPVAPAPD---------FPVHSAA
MEND_MYCA1      DQPLD---IDLSPDTVVIAGHGAGTHPNLAQLPTVAEPTAPAP---------DNPLHPLA
MEND_MYCPA      DQPLD---IDLSPDTVVIAGHGAGTHPNLAQLPTVAEPTAPAP---------DNPLHPLA
MEND_MYCBO      DQPLD---IDLSVDTVVISGHGAGVHPNLAALPTVAEPTAPRSG--------DNPLHPLA
MEND_MYCBP      DQPLD---IDLSVDTVVISGHGAGVHPNLAALPTVAEPTAPRSG--------DNPLHPLA
MEND_MYCTA      DQPLD---IDLSVDTVVISGHGAGVHPNLAALPTVAEPTAPRSG--------DNPLHPLA
MEND_MYCTU      DQPLD---IDLSVDTVVISGHGAGVHPNLAALPTVAEPTAPRSG--------DNPLHPLA
MEND_MYCUA      DQPLE---IDLSADTVVIAGHGAGVHPNLVQLPTIAEPTAPAAPSG------GNPLHPLA
MEND_MYCLE      DQPLE---IDLSADTVVIAGHGAGVHPNLTELPIVAEPTAPFGPYR------PYPLHPLA
MEND_MYCGI      DQPLE---IDLTPDTVVIAGHGAGVHPNLAHLPTVAEPTAPYAQ---------TPLHPLA
MEND_MYCVP      DQPLD---IDLTPDTVVIAGHGAGVHPNLAHLPTVAEPTAPAAQ---------TPLHPLA
MEND_MYCSK      DQPLD---IDLTPDTVVIAGHGAGVHPNLADLPTVAEPTAPPAA---------NPLHPMA
MEND_MYCSS      DQPLD---IDLTPDTVVIAGHGAGVHPNLADLPTVAEPTAPPAA---------NPLHPMA
MEND_MYCSJ      DQPLD---IDLTPDTVVIAGHGAGVHPNLADLPTVAEPTAPPAA---------NPLHPMA
MEND_MYCS2      DQPLD---IDLTPDTVVIAGHGAGEHPNLAELPTVAEPTAPPPA---------NPLHPLA
MEND_NOCFA      DVPLE---IDLTPDTVVVSGHGAGLRPELAHLPTVAEPTAPMHG---------PALHPLA
MEND_RHOJR      DVPMD---LDLTPDTIVISGHGSALRPELAGLPTVAEPTAPLHG---------IPVHPMA
MEND_SACEN      SKVRSRRGLVLVADGGADSASAWGERYGWPVLSETGGVGLSGAAAI------STGMWLLK
MEND_THEFY      IVCGD----------GDYDPIPLLALSAQTGWPLLAEPTSNARRA--------EALSSYR
MEND_HALMA      IVAGP------ADQ--GLSADSLERLAAATGFPVLADPLSDLRFGPHVDRLDVPVCGGYD
MEND_NATPD      IVCGP------TDRP-APDAESLVALADATGFSVFADPLSGLRFGPHVD--DAPVCGGYD
MEND_HALS3      VVAGP------ADGGAGITPDAAAALADATGAPIFADPLSGLRFGPHVG--DAPVVGGYD
MEND_HALSA      VVAGP------ADGGAGITPDAAAALADATGAPIFADPLSGLRFGPHVG--DAPVVGGYD
MEND_HALWD      IVVGP------MTIP-GVDPEAVAAFAHASGFPVLADPLSGIRYGGLTR--TTPIIGGYD
MEND_ROSCS      IVCGP------RCPG-GAFGALVSELSQRTGYPALVDGVSGVRFG------YPGVIGGYE
MEND_ROSS1      IVCGP------RCPS-GEFGALVSELADRTGYPALVDGVSGIRFG------YPGVIGGYE
MEND_CHLAA      IIAGP------DCPP--DLGPLLTTLAHRLRYPILADPLSGVRYGPHVD---EYTLGTYD
MEND_MYXXD      IVCGP-------RDEMDGFAAAISALSQATGYPVLAESTSQARYGG-----GPLTLSYYD
MEND_SORC5      IVCGPA----ESREDDARARRAVLALSRATGFPVLAEGTSQICFGGLTE--GVVMPASFD
MEND_BACSU      IVCGELHSDA--------DKENIIALSKALQYPILADPLSNLRNGVHDK---STVIDAYD
MEND_BACVZ      IVCGEIHGEA--------EKQQIIALAEMLQFPILADPLSNLRNGKHDK---TLIIDAYD
MEND_BACLD      IVCGELQDDD--------AKEHIVALSQAAEYPILADPLSNLRNGTHSK---ETIIDAYD
MEND_BACP2      IVCGELHTQK--------EKEAVLRLSKDLHLPILADPLSHLRNGHEHA---ELIIDAYD
MEND_BACAH      IICGDDSHSE--------IATFATQLAEKTGYPILADPLSNIRSGHHDK---TMVIDCYD
MEND_BACHK      IICGDDSHSE--------IATFATQLAEKTGYPILADPLSNIRSGHHDK---TMVIDCYD
MEND_BACAN      IICGDDSHSE--------IAAFATQLAEKTGYPILADPLSNIRSGHHDK---TMVIDCYD
MEND_BACCZ      IICGDDSHSE--------IAAFATQLAEKTGYPILADPLSNIRSGHHDK---TMVIDCYD
MEND_BACC1      IICGDDSHSE--------IATFATQLAEKTGYPILADPLSNIRSGHHDK---TMVIDCYD
MEND_BACCR      IICGDDSHAE--------IAMFATQLAEKTGYPILADPLSNIRSGHHDK---TMVIDCYD
MEND_BACCN      IVCGDDSHLE--------LVEVIAEFAEKTGYPVLADPLSNLRTGSHNQ---TMIIDCYD
MEND_GEOKA      IVCGPLDRPG--------FAEAVTELARALDFPILADPLSQLRAGTHDK---TYVLDSYD
MEND_GEOTN      IVCGALDQPG--------FAEAVTELARTLDFPILADPLSQLRAGAHDK---TYVIDSYD
MEND_OCEIH      FVCGPQADAE--------FADAVTSLAGKWGIPVVADPLSQLRTGQHHK---DNVIDGYD
MEND_LISMF      FVVGPIDKKE--------LEQPMVDLAKKLGWPILADPLSGLRSYGALD---EVVIDQYD
MEND_LISMO      FVVGPIDKKE--------LEQPMVDLAKKLGWPILADPLSGLRSYGALD---EVVIDQYD
MEND_LISIN      FVVGPIDKKE--------LEQPMVDLAKKLGWPILADPLSGLRSYGAMD---EVVIDQYD
MEND_LISW6      FVVGPIDKKE--------IEQPMVDLAKKLGWPILADPLSGLRSYGAKD---DVVIDQYD
MEND_ENTFA      LVVGGSHTEE--------EATLFIQLAEALQWPLLADPLANIVTHGQNS---EVVIAHSD
MEND_LACLM      ILAGANSSEN--------YSESLLKLAEHLKAPILADPLSNLRN--HNS---PFVMDSYD
MEND_LACLS      ILAGANSAEN--------YSESLLKLAEQLKAPILADPLSNLRN--HNS---PFVMDSYD
MEND_LACLA      ILAGANFDKD--------YSEALLKLAEQLKAPILADPLSNLRN--HNH---PLVIDSYD
MEND_DESHY      IICGGDPYAD--------YHREVLELAERLKAPLLADPLANFRN--DDH---PLIMDCYD
MEND_LEUCK      ILAGPNEAAD--------YKDELLQFSRDHQVPVIADILSRART--------TDTIFGVD
MEND_LEUMM      ILAGPNVLNS--------YDDSLKKFAIKNNVPVIADVLSQSRH--------TYTIHGID
MEND_STAA1      IIVG-DMQHQ--------EVDQILTYSTIYDLPILADPLSHLRK--------FDHPNVIC
MEND_STAA9      IIVG-DMQHQ--------EVDQILTYSTIYDLPILADPLSHLRK--------FDHPNVIC
MEND_STAAN      IIVG-DMQHQ--------EVDQILTYSTIYDLPILADPLSHLRK--------FDHPNVIC
MEND_STAA2      IIVG-DMQHQ--------EVDQILTYSTIYDLPILADPLSHLRK--------FDHPNVIC
MEND_STAAM      IIVG-DMQHQ--------EVDQILTYSTIYDLPILADPLSHLRK--------FDHPNVIC
MEND_STAAS      IIVG-DMQHQ--------EVDQILTYSTIYDLPILADPLSHLRK--------FDHPNVIC
MEND_STAAW      IIVG-DMQHQ--------EVDQILTYSTIYDLPILADPLSHLRK--------FDHPNVIC
MEND_STAA3      IIVG-DMQHQ--------EVDQILTYSTIYDLPILADPLSHLRK--------FDHPNVIC
MEND_STAAE      IIVG-DMQHQ--------EVDQILTYSTIYDLPILADPLSHLRK--------FDHPNVIC
MEND_STAA8      IIVG-DMQHQ--------EVDQILTYSTIYDLPILADPLSHLRK--------FDHPNVIC
MEND_STAAC      IIVG-DMQHQ--------EVDQILTYSTIYDLPILADPLSHLRK--------FDHPNVIC
MEND_STAAT      IIVG-DMQHQ--------EVDQILTYSTIYDLPILADPLSHLRK--------FDHPNVIC
MEND_STAAB      IIVG-DMQHQ--------EVDQILTYSTIYDLPILADPLSHLRK--------FDHPNVIC
MEND_STAAR      IIVG-DMQHQ--------EVDQILTYSTIYDLPILADPLSHLRK--------FDHPNVIC
MEND_STAEQ      IIVG-DMQHQ--------AVDQILTYSTIYDLPILADPLSQLRK--------EKHPNVIT
MEND_STAES      IIVG-DMQHQ--------AVDQILTYSTIYDLPILADPLSQLRK--------EKHPNVIT
MEND_STAHJ      IIVG-DMQHQ--------AIDQILTYATVHDIPILADPLSQLRK--------YNHPNVIT
MEND_STAS1      IIVG-DMQHQ--------DVDQILTFSTIHDMPILADPLSQLRR--------EHHPNVVT
MEND_BACFN      MIVGQMNLIY--------LFEKKYSKMLYKQFAWFTEHLGNQTVPGIPI---RNFDAALY
MEND_BACFR      MIVGQMNLIY--------LFEKKYSKMLYKQFAWFTEHLGNQTVPGIPI---RNFDAALY
MEND_BACTN      IIVGQMNLIY--------LFEKRHTKLLYKHFVWLTEHIGNQTVPGIPV---KNFDAALY
MEND_BACV8      VVVGQMNLIY--------LFEKKYVKPLYKHFAWLTEHLGNQTIPGIPI---KNFDAAVY
MEND_PARD8      MIAGQMSLIY--------LFEKKICKLLYKHFTWLSEHIGNRIVPGLPI---KNFDAILY
MEND_FLAJ1      ILIGGINEAN--------SIDDAVLENFAKDPSIVVLTETTSNLHHPSF---INSIDSLI
MEND_FLAPJ      ILIGGC-DPN--------VIQQFIIDFLANDTSVVVMTEVTSNVHHANF---ITNIDAII
MEND_GRAFK      VIVGVA-QPN--------AVEQKFLEGLATDPSVIVLTETTSNLHQEQF---FTRIDTLI
MEND_PORGI      IVAGFY-PPD--------EDVSAALQDICKFPHTVLFAESLSNIRTDTG---ICTADRVL
MEND_CYTH3      FVGGQH------------LYDESLRLKIGNIKAPFIGEVVSNLHGVRNV---IHTHDTLL
MEND_DESPS      IVCGQGVADA--------ELQALLARFAPDKTVTIIAENTANIVGPWLV---DRPDAVLL
MEND_NOSS1      IIAGVAQ--PQQP---QEYCRAIARLSQTLQWPVLAEGLSPVRNYADFN---PYLISTYD
MEND_TRIV2      IIAGVAQ--PQQP---QEYCRAIARLSQTLQWPVLAEGLSPIRNYADLN---PYLISTYD
MEND_TRIEI      IIAGLAQ--PEKP---EVYCQAIAKISQTLNFPVLAEGLSPLRNYSQLN---PYLISTYD
MEND_MICAN      IIAGLAS--PQNP---ESYCQAIADLARSQQYPILAEALSPLRNYAGLN---PHLITTYD
MEND_ACAM1      IIAGPAQ--PDTP---EHYCLAIAQLAHILGWPVLAEGLSPLRNWADRN---SYLISTYD
MEND_SYNJA      ILAGPAQ--PADP---QRYAEAVARLALALGWPVLAEGLSPLRNYASLN---PYLITTYD
MEND_SYNJB      ILAGPAQ--PADP---QRYVEAVAHLATALGWPVLAEGLSPLRNYASLN---PYLITTYD
MEND_SYNP6      ITVGPIA--PEDP---AAFVQAIAQLSAHLGWPVLSDAVTPLRQFADHC---PRLISSYD
MEND_SYNE7      ITVGPIA--PEDP---AAFVQAIAQLSAHLGWPVLSDAVTPLRQFADHC---PRLISSYD
MEND_THEEB      IIAGPSH--GVDP---LAEAAAIDRLSRFLQWPVLADALSSARGL-------PHGISHYD
MEND_SYNY3      ILVGVMP--GGET---PSLLTDILAIARGLGYPVLCDALCSLRNYDDGQ---TALITNYD
MEND_BDEBA      MVGILPEKAYGTV---LDFLKQYKAPVYCEGISSLRGHPDLKDVEI------RSGEKMIH
MEND_PARUW      IVGALNQNETTPI---LSFLRHLKAPVYLEAQSGLRENSLLENLRI------ESVEDVWN
MEND_PROM0      ILVGPYQGSVNDL---SSFNKSLEQLQEITGWPVFADPVSGVYSDL------RGLVVNWE
MEND_PROM2      ILVGPYQGSVNDL---TSFNKSLERLQEITGWPVFADPVSGVYSDL------RGLVVNWE
MEND_PROM9      ILVGPYQGSINEL---SSFNKSLEKLQAITGWPVFADPVSCVYSDL------RGLVVNWE
MEND_PROMS      ILVGPYQGSINDL---PSFNKSLGQLQEITGWPVFADPVSGVYSDL------RGLIVNWE
MEND_PROM5      IIVGPYQGSIKDL---VSFNNSLEKIQSITGWPVFADPVSGVSADL------RGLVENWE
MEND_PROMP      IIVGPYQGSTKDL---FSFNSALKKLQEITGWPVFVDPVSGVSAEL------KGLVENWE
MEND_PROM1      IILGPWRGKVKQL---NSFRGALKQWQKLTGWPILADPLSGVENDQ------EGLINHWD
MEND_PROMT      IIVGPWRGKVKQL---NSFRGALKKWQKLTGWPILADPLSGVENDQ------EGLINHWD
MEND_PROMA      ILAGPWRGKPSQL---LGFRKAVKEFQSFTGWPLFADCLSAITIKQ------SGLISFWE
MEND_PROM3      VIAGAWRGLSKDL---FAFQQSLREWQALSGWPVLADPLSALPSDQ------PGLIRSWE
MEND_PROMM      VIAGAWRGLSKDL---FAFQQSLREWQALSGWPVLADPLSALPSDQ------PGLIRSWE
MEND_SYNPW      VVAGPWRGLEADR---PAYQRALQELALTTGWPVLLDPLAAAPQDL------PGVIRHWD
MEND_SYNS3      IVAGPWRGLSATL---EPYQAALIAWQQRSGWPVLADPLAAIPSNL------GGVIRSWD
MEND_SYNPX      VVAGPWRGLAPAL---PAYQQALLQWLARSGWPLLADPLAAIPADC------PGQLDGWE
MEND_SYNSC      VVAGPWRGLTLSL---EAHQQALHRWLNLSGWPLLADPLAALPPDC------PNRIEHWE
MEND_SYNS9      VIAGPWRGLAQDL---SAHQQAVRSWLVCSGWPLLADPLSALPVEL------PGRLHHWD
MEND_SYNR3      IVVGPWRRGHG-----GRFVAALQQLNRRTGWPILADASSGLRGLP------LPLVSGYD
                                                                            

MEND_ECOLI      LWLGNAKAT-----SELQQAQIVVQLGSSLTGKRLLQWQASCEP-------EEYWIVDDI
MEND_ECOHS      LWLGNAKAT-----SELQQAQIVVQLGSSLTGKRLLQWQASCEP-------EEYWIVDDI
MEND_ECOLC      LWLGNAKAT-----SELQQAQIVVQLGSSLTGKRLLQWQASCEP-------EEYWIVDDI
MEND_SHIF8      LWLGNAKAT-----SELQQAQIVVQLGSSLTGKRLLQWQASCEP-------EEYWIVDDI
MEND_SHIFL      LWLGNAKAT-----SELQQAQIVVQLGSSLTGKRLLQWQASCEP-------EEYWIVDDI
MEND_ECO24      LWLGNAKAT-----SELQQAQIVVQLGSSLTGKRLLQWQASCEP-------EEYWIVDDI
MEND_SHIBS      LWLGNAKAT-----SELQQAQIVVQLGSSLTGKRLLQWQASCEP-------EEYWIVDDI
MEND_ECO57      LWLGNAKAT-----SELQQAQIVVQLGSSLTGKRLLQWQASCEP-------EEYWIVDDI
MEND_SHISS      LWLGNAKAT-----SELQQAQIVVQLGSSLTGKRLLQWQASCEP-------EEYWIVDDI
MEND_ECOK1      LWLGNAKAT-----SELQQAQIVVQLGSSLTGKRLLQWQASCEP-------EEYWIVDDI
MEND_ECOL6      LWLGNAKAT-----SELQQAQIVVQLGSSLTGKRLLQWQASCEP-------EEYWIVDDI
MEND_ECOL5      LWLGNAKAT-----SELQQAQIVVQLGSSLTGKRLLQWQASCEP-------EEYWIVDDI
MEND_ECOUT      LWLGNAKAT-----SELQQAQIVVQLGSSLTGKRLLQWQASCEP-------EEYWIVDDI
MEND_ECOSM      LWLGNAKAT-----SELQQAQIVVQLGSSLTGKRLLQWQASCEP-------EEYWIVDDI
MEND_SHIDS      LWLGNAKAT-----SELQQAQIVVQLGSSLTGKRLQQWQASCEP-------VEYWIVDDI
MEND_SALCH      LWLGNAKAV-----TELQQAQIVVQLGSSLTGKRLLQWQATCEP-------EEYWVIDNI
MEND_SALTY      LWLGNAKAV-----TELQQAQIVVQLGSSLTGKRLLQWQATCEP-------EEYWVIDNI
MEND_SALPA      LWLGNAKAV-----TELQQAQIVVQLGSSLTGKRLLQWQATCEP-------EEYWVIDNI
MEND_SALPB      LWLGNAKAV-----TELQQAQIVVQLGSSLTGKRLLQWQATCEP-------EEYWVIDNI
MEND_SALTI      LWLGNAKAV-----TELQQAQIVVQLGSSLTGKRLLQWQATCVP-------EEYWVIDNI
MEND_SALAR      LWLGNAKAV-----TELQQAQIVVQLGSSLTGKRLLQWQATCEP-------EEYWVIDNI
MEND_CITK8      LWLGNAKAV-----TELQQAQIVVQLGSSLTGKRLLQWQAACEP-------EEYWIIDNI
MEND_KLEP7      LWLGNGKAV-----SELAQAQIVVQLGSSLTGKRVLQWQATCEP-------DEYWLVDNL
MEND_ENT38      LWLGNAKAV-----TELARAQIVIQLGSSLTGKRVLQWQSTCEP-------EEYWLVDSL
MEND_YERPA      LWLAHPRAQ-----ETLAQAQMVLQFGSSLTSKRLLQWQTACQP-------QEYWLVDSA
MEND_YERPE      LWLAHPRAQ-----ETLAQAQMVLQFGSSLTSKRLLQWQTACQP-------QEYWLVDSA
MEND_YERPN      LWLAHPRAQ-----ETLAQAQMVLQFGSSLTSKRLLQWQTACQP-------QEYWLVDSA
MEND_YERPP      LWLAHPRAQ-----ETLAQAQMVLQFGSSLTSKRLLQWQTACQP-------QEYWLVDSA
MEND_YERPS      LWLAHPRAQ-----ETLAQAQIVLQFGSSLTSKRLLQWQTACQP-------QEYWLVDSA
MEND_YERE8      LWLAHPGAQ-----RVLAQAQIVLQFGSSLTGKRLLQWQAQCQP-------QEYWLVDSI
MEND_SERP5      LWLAQPQAQ-----KRLAEAQLVVQFGSSLTGKRLLQWQEQCQP-------QEYWLIDDL
MEND_PECAS      IWLAHPEAA-----SLLRQAEIVLQFGGSLTGKRLLQWQEQCQP-------QEFWLIDDL
MEND_PHOLL      LWLDNPHVQ-----EILAQAQLVVQFGSSLIGKCLLQWQAKCQP-------QEFWIIDPI
MEND_CROS8      LWLAHPRAA-----ALLAQAPVVVQFGGSLTGKRVLQWQSECRP-------QEYWVVDPL
MEND_HAEI8      IWLANQTVR-----EKLLQADIVIQFGARFISKRINQFLQAFK--------GEFWLVEQS
MEND_HAEIG      IWLANQTVR-----EKLLQADIVIQFGARFISKRINQFLQAFK--------GEFWLVEQS
MEND_HAEIN      IWLANQTVR-----EKLLQADIVIQFGARFISKRINQFLQAFK--------GEFWLVEQS
MEND_HAEIE      IWLANQTVR-----EKLLQADIVIQFGARFISKRINQFLQAFK--------GEFWLVEQS
MEND_PASMU      IWLANQTVK-----QKLLQADIVIQFGSGFISKRVNQFLAAFK--------QEYWIVEQS
MEND_MANSM      IWLANKTVR-----EKLLQADLVIQLGYAFVSKRINQFLADFK--------GEYWIVDES
MEND_ACTSZ      IWLANKTVR-----EKLLQADLVVQLGAHFVSKRINQFLSDFK--------GEFWVVDES
MEND_HAES1      IWLANQTVR-----KKLLQAEIVIQFGSGFIGKRINQFLAEFK--------GEYWIIENN
MEND_HISS2      IWLANQTVR-----KKLLQAEIVIQFGSGFIGKRINQFLAEFK--------GEYWIIENN
MEND_ACTP2      IWLSNNTVH-----QRLLQADIVIQFGGQIVSKRVNKFLEAFK--------GEFWQVDEY
MEND_ACTPJ      IWLSNNTVH-----QRLLQADIVIQFGGQIVSKRVNKFLEAFK--------GEFWQVDEY
MEND_HAEDU      IWLSNNTVH-----ERLLNADIVIQFGSQIISKRVNKYLADFK--------GEFWQVDEY
MEND_PHOPR      VWLQNASCQ-----AFLQQADTVIQFGARIVSKRLLQFIATSSI-------EHYWLIDPR
MEND_ALIF1      LWLQNSACF-----ELLSEVECVLQFGARLVSKRLGAWLKNYQ--------QAYYLIDPH
MEND_VIBC3      LWLQHPKAR-----EQLNQAQCVVQFGSRIVSKRLLQWLEAWCATGL----GEYHYIAPH
MEND_VIBCH      LWLQHPKAR-----EQLNQAQCVVQFGSRIVSKRLLQWLEAWCATGL----GEYHYIAPH
MEND_VIBCB      LWLQNPRMA-----SQLDDCDLIVQFGSRIISKRFNHWLEKHVSRNQQGGDTQYWFVSPR
MEND_VIBPA      LWLQQPKLA-----SQLDECDLVLQFGSRIISKRLNQWINKQVSQSQQGRDVQYWFISPS
MEND_VIBVU      IWLQNPAAR-----AQLSQCDLIIQFGRRLVSKRLHQWLEQQVQAG-----CDYWYVSPD
MEND_VIBVY      IWLQNPAAR-----AQLSQCDLIIQFGRRLVSKRLHQWLEQQVQAG-----CDYWYVSPD
MEND_AERHH      LALQHSGFV-----AELARAEVLLQFGARLISKRLGQFIKQQP-------WQAYWLIDPQ
MEND_AERS4      LALQNSCFV-----AELARAEVLLQFGARLISKRLGQFIKQHP-------WQDYWLVDPQ
MEND_PSYIN      LLLVNKQFT-----ENLQQADIIVQFGGKLISKRLSQFIEGF--------AGEYLLVDPG
MEND_SHEB5      QLLQHPKAR-----NLLQEADRVLVFGGRLLSKRVIGYLAEQN-------WHSYWQVLPE
MEND_SHEB9      QLLQHPRAR-----NLLQEADRVLVFGGRLLSKRVIGYLAEQN-------WHSYWQVLPE
MEND_SHEB8      QLLQHPRAR-----NLLQEADRVLVFGGRLLSKRVISYLAEQN-------WHSYWQVLPE
MEND_SHEPC      QLLQHPKAR-----NLLQEADRVLVFGGRLLSKRLISYLAEQH-------WHSYWQVLPE
MEND_SHESW      QLLQHPKAR-----NLLQEADRVLVFGGRLLSKRLISYLAEQH-------WHSYWQVLPE
MEND_SHESA      QLLQHPKAR-----NLLQEADRVLVFGGRLLSKRLIAYLAEQN-------WHSYWQVLPQ
MEND_SHESM      QLLQHPKAR-----NLLQEADRVLVFGGRLLSKRLIAYLAEQN-------WHSYWQVLPQ
MEND_SHESR      QLLQHPKAR-----NLLQEADRVLVFGGRLLSKRLIAYLAEQN-------WHSYWQVLPQ
MEND_SHEON      QLLQHPKAR-----NLLQEADRVLVFGGRLLSKRLIAYLAEQN-------WHSYWQVLPQ
MEND_SHEHH      QLLQQPKSK-----ALLAQAEKVLVFGGRILSKRLISYLNDQD-------WKDYWQVLPQ
MEND_SHEPA      QLLHQPKSK-----ALLAQAERVIVFGGRILSKRLIGYLAEQN-------WKDYWQVLPQ
MEND_SHESH      QLLHQPKAR-----ALLAQAESVLVFGGRLLSKRLINFLSEQK-------WKRYWQVLPQ
MEND_SHEWM      QLLHQPKAK-----ALLMQAERVLVIGGRLLSKRLIDYLAQNK-------WKSYWQVLPR
MEND_SHELP      QLLLQPKAK-----ALLQEADTVLVFGGRLLSKRLISYLSEQK-------WKRYWQVLPQ
MEND_SHEAM      QLLLNPRAR-----ALLDQAERVLVFGGRLLSKRLISYLAEKD-------WHSYWQVLPH
MEND_SHEFN      QLLLNPKAN-----KQLEQAERILVFGGRFISKRLLQYIAQQS-------WHSYWHVVKH
MEND_HALHL      HLLATAAGR-----AALGQARQVVQFGGRLTGRRLPAWLTEHAP--------QRWLITGD
MEND_PELLD      QQAFATPAF-----LGRFRPDLVVHFGGRLIARHPSAALKAWKP-------AHYVVIREH
MEND_CHLPM      QQAFASPEF-----RNAFRPDLVIHFGGGLISRHPSDALKQWKP-------DHLAVIRNH
MEND_CHLCH      QLLMQSPAW-----RAAFHPDVVLHFGGNVVAKHLATALREWQP-------AHYMVVREE
MEND_CHLPD      QLAFQSPAF-----LEHYRPDMVVHFGGQLISRHPGAAIRVSHP-------GNYLVVKPS
MEND_CHLTE      QLAFQNEAF-----VERFQPDVVIHFGGHVIGKQPAMALRKQPP-------LHYVVVREH
MEND_RUBXD      DLLLAGGRF-----PGGRAPDAVVRVGGVPVSKRLQRYVTGRKP-------ATYAVVADH
MEND_SALRD      DLVLTSAAF-----REGHPPRAVLQVGGRFASKRLRLFLRDSAP-------EVWAVVRPD
MEND_SYNAS      LDHPEALRL-----VSAYAPETILQFGSGLVSKHYFASLLPHSE-------ATVIQISPR
MEND_DECAR      NDWLGKTDL-----VSQYRPEWVIRFGAYPVTRNLQKLVSEITE--------THALVDPW
MEND_PAEAT      VLLAHFG------PDSPTPIERVVLFGRATLSRPVASLLARESVVSAI--------YQPV
MEND_ARTS2      LLLEHFG------PDSAQPIERVVLFGRPTLSRPVSALLARADVPSAL--------YQPL
MEND_RENSM      LLLEHF----------EALIERVVIFGRPTLSRPVAALMNRADLPRAL--------YLPR
MEND_CLAM3      ELLA--------RPGFGDRVERVIVFGHPTLTREVPLLVGREDVEAIV--------VGST
MEND_CLAMS      ELLA--------REGFGDRVERVIVFGHPTLTREVPLLVGREDVEAIV--------VGST
MEND_LEIXX      ELLR--------EPEFGGRVRRAVVFGHPTLSREVPALLLRDDVETVV--------VAPR
MEND_KINRD      LLLDAVDA----EGPLGA-VERVVLFGHPTLSRPVTRLLARDDVELVV--------VSAA
MEND_NOCSJ      LLLD---------GDLGARVERVVVGGHPTLSRPVSRLLARPDVEVVD--------LGAW
MEND_CUTAK      TVLG---------SELVDDVEAVLVLGHPTLSRPVSRLLARPDVTVVT--------DRSR
MEND_COREF      AEFLLKDQVSAEGYVVTTRPDHIIVVGHPTLHRGVLKLMTDPTIELTV--------LSRT
MEND_CORGB      AEILLKEQVSAEGYVVNTRPDHVIVVGHPTLHRGVLKLMSDPEIKLTV--------LSRT
MEND_CORDI      AQIFAHKEI---------KPEHIVVVGHPTLHRAVLSLLAD--VPVTV--------LTKT
MEND_CORJK      VDMFSTQVVSDGEHSAVTIPEQIVVIGRPTLHRGVTKLLANKDINVIA--------LSDT
MEND_MYCA1      LRLL--------------RPKQVIMLGRPTLHRPVSALLADPQVPVYA--------LTTG
MEND_MYCPA      LRLL--------------RPKQVIMLGRPTLHRPVSALLADPQVPVYA--------LTTG
MEND_MYCBO      LPLL--------------RPQQVIMLGRPTLHRPVSVLLADAEVPVFA--------LTTG
MEND_MYCBP      LPLL--------------RPQQVIMLGRPTLHRPVSVLLADAEVPVFA--------LTTG
MEND_MYCTA      LPLL--------------RPQQVIMLGRPTLHRPVSVLLADAEVPVFA--------LTTG
MEND_MYCTU      LPLL--------------RPQQVIMLGRPTLHRPVSVLLADAEVPVFA--------LTTG
MEND_MYCUA      LPLL--------------RPRQVIMLGRPTLHRPVSALLADPEVPVFA--------LTTG
MEND_MYCLE      LPLL--------------HPKQVIMLGRPTLHRPVSALLADPQVPVYA--------LTTG
MEND_MYCGI      LSLI--------------RPRQVIMLGRPTLHRSVSTLLADPAVPVFA--------LTTG
MEND_MYCVP      LRMI--------------RPEQVIMLGRPTLHRPVSALLADPAVPVFA--------LTTG
MEND_MYCSK      LRLL--------------RPKQVIMLGRPTLHRPVSALLADPSVPVYA--------LTTG
MEND_MYCSS      LRLL--------------RPKQVIMLGRPTLHRPVSALLADPSVPVYA--------LTTG
MEND_MYCSJ      LRLL--------------RPKQVIMLGRPTLHRPVSALLADPSVPVYA--------LTTG
MEND_MYCS2      LRLA--------------HPKQVIMLGRPTLHRPVSTLLADPSVPVYA--------LTTG
MEND_NOCFA      LPLL--------------TPRQAIITGRPTLHRQVSRLLADPAVTVYA--------LTTG
MEND_RHOJR      LPQL--------------KPRQAVITGRPTLHRSVSKVLADPSVAVYA--------LTTG
MEND_SACEN      LPGFM----------RDHRPEQVLCVGRNTVFRQVQSLLADSEVEVLL--------AHGG
MEND_THEFY      QLLAVPE------FVAAHEPELVVSVGRPGLSRQLLAYLRRAPRHVVV--------GDPV
MEND_HALMA      GYLGSDSV------DQWDDPDVVVRFGASPTSKPLRHYLRDADCQQFL--------VDPA
MEND_NATPD      AYLPA----------LEQTPEVVIRFGASPTSKPLRQYLRDADARQFI--------VDPA
MEND_HALS3      GFLAA----------DVPHPEFVLRFGASPTSKPLRKWLAASDARQVV--------VDPA
MEND_HALSA      GFLAA----------DVPHPEFVLRFGASPTSKPLRKWLAASDARQVV--------VDPA
MEND_HALWD      GYLTSELW------DQWPDPDVVLRFGASPTSKPLRQYLESTSPTQYL--------VDPA
MEND_ROSCS      TFLFGE--------HAFPPPEVVLRFGAVLTSKWLNQYLDTAASPVVIH-------VRAS
MEND_ROSS1      TFLFGE--------HSFPPPDVVVRFGAVPTSKWLNQYLDTAAPSAVIH-------VRAG
MEND_CHLAA      AFLRDERF------VSSYAPEVVLRFGAMPTSKPLLLYLQHHPHARQIV-------IDGG
MEND_MYXXD      AMLRHAPF------AKAHRPELVLRFGGGLTPKVPQQWLDGSGADTVL--------FSDG
MEND_SORC5      SFLRAPEF------RAANAPDLILELGAPPTSAGYATYIAEHASARRV--------VVSS
MEND_BACSU      SFLKDDE------LKRKLRPDVVIRFGPMPVSKPVFLWLKD-------DPTIQQIVIDED
MEND_BACVZ      SFLKDEA------IKEALRPDAVIRFGPMPVSKPLFLWLRD-------DPAIEQFIVDED
MEND_BACLD      SLLKEEQ------LKRELMPELVIRFGAMPVSKPLFQLLKQ-------NPSIRQIVVDPD
MEND_BACP2      SLLKDEA------LQQHLLPDMVIRFGPMPVSKPLFKWLEK-------HAEVNQIVVDAA
MEND_BACAH      TFLRNEL------LKETWKPDVLIRFGGMPVSKALTQFIKK-------QTKAVHIVVDES
MEND_BACHK      TFLRNEL------LKETWKPDVLIRFGGMPVSKALTQFIKK-------QTKAVHIVVDES
MEND_BACAN      TFLRNEL------LKETWKPDVLIRFGGMPVSKALTQFIKK-------QTKAVHIVVDES
MEND_BACCZ      TFLRNEL------LKETWKPDVLIRFGGMPVSKALTQFIKK-------QTKAVHIVVDES
MEND_BACC1      TFLRNVL------LKETWKPEVIIRFGGMPVSKALTQFIKK-------QTKAVHIVVDES
MEND_BACCR      TFLRNEK------LKETWNGDVLIRFGGMPVSKSLTQFIKK-------QTKAVHIVVDES
MEND_BACCN      TFLRNEL------LKDTWKPDIIIRFGGMPVSKALTQYIKK-------QESAVHIIVDES
MEND_GEOKA      AILREET------AASKLVPDVVLRFGAMPVSKPLFLWLKR-------HRAIRQIVVDDG
MEND_GEOTN      AILKDEA------VASRLVPDVVLRFGAMPVSKPLFLWLKQ-------HRSIRQIVVDDG
MEND_OCEIH      AFLREAE------IRQELKPDYIIRFGAMPVSKSYLFYVME-------NVETQQYVIEPN
MEND_LISMF      AFLKEAE------IIDKLTPEVVIRFGSMPVSKPLKNWLEQ-------LSDIRFYVVDPG
MEND_LISMO      AFLKEAE------IMDKLTPEVVIRFGSMPVSKPLKNWLEQ-------LSDIRFYVVDPG
MEND_LISIN      AFLKEAD------ILDKLTPEVVIRFGSMPVSKPLKNWLEH-------LFGIRFYVVDPG
MEND_LISW6      AFLKEAA------IWDNLTPEVVIRFGSMPVSKPLKNWLEQ-------LSDIRFYVVDPG
MEND_ENTFA      LFLNVAT------LPQE--PEVVVRFGSLPISKNIMLWLKRLA-----TTETAFYFVDEN
MEND_LACLM      AFLANDD------LKTDLKAESILLFGQMPVSKRLQQFIAL-------NDDAEFIQVDPA
MEND_LACLS      AFLANDD------LKTDLKAESILLFGQMPVSKRLQQFIAL-------NDEAQFIQVDPA
MEND_LACLA      AFLANND------LKTQLKADAILLFGQMPVSKRLQQFVAF-------NNEAEFIQVDPA
MEND_DESHY      AFLKSDA------VKVELKPEFIIHFGQTPVSKRLQNFTAM-------HQDVLYFQVNDY
MEND_LEUCK      SLIKAHY------LTDEYRPDLVIRFGGTPVSARVLQWLQR--------ENIPVWHVDGH
MEND_LEUMM      VLLQAHK------INADLKPDLVVRFGKTPVSARVLQWLKE--------ENILTWHVDED
MEND_STAA1      TYDLLFR------SGLDLNVDFVIRVGKPVISKKLNQWLKK--------TDAFQILVQNN
MEND_STAA9      TYDLLFR------SGLDLNVDFVIRVGKPVISKKLNQWLKK--------TDAFQILVQNN
MEND_STAAN      TYDLLFR------SGLDLNVDFVIRVGKPVISKKLNQWLKK--------TDAFQILVQNN
MEND_STAA2      TYDLLFR------SGLDLNVDFVIRVGKPVISKKLNQWLKK--------TDAFQILVQNN
MEND_STAAM      TYDLLFR------SGLDLNVDFVIRVGKPVISKKLNQWLKK--------TDAFQILVQNN
MEND_STAAS      TYDLLFR------SGLDLNVDFVIRVGKPVISKKLNQWLKK--------TDAFQILVQNN
MEND_STAAW      TYDLLFR------SGLDLNVDFVIRVGKPVISKKLNQWLKK--------TDAFQILVQNN
MEND_STAA3      TYDLLFR------SGLDLNVDFVIRVGKPVISKKLNQWLKK--------TDAFQILVQNN
MEND_STAAE      TYDLLFR------SGLDLNVDFVIRVGKPVISKKLNQWLKK--------TDAFQILVQNN
MEND_STAA8      TYDLLFR------SGLDLNVDFVIRVGKPVISKKLNQWLKK--------TDAFQILVQNN
MEND_STAAC      TYDLLFR------SGLDLNVDFVIRVGKPVISKKLNQWLKK--------TDAFQILVQNN
MEND_STAAT      TYDLLFR------SGLDLNVDFVIRVGKPVISKKLNQWLKK--------TDAFQILVQNN
MEND_STAAB      TYDLLFR------SGLDLNVDFVIRVGKPVISKKLNQWLKK--------TDAFQILVQNN
MEND_STAAR      TYDLLFR------SGLDLKVDFVIRVGKPVISKKLNQWLKK--------TDAFQILVQNN
MEND_STAEQ      TYDLLYR------AGLNLEVDYVIRVGKPVISKKLNQWLKK--------TDAYQIIVQNN
MEND_STAES      TYDLLYR------AGLNLEVDYVIRVGKPVISKKLNQWLKK--------TDAYQIIVQNN
MEND_STAHJ      TYDLYYR------AGLDIDVDFVIRVGKPVISKKLNQWLKR--------TNAYQILVQNN
MEND_STAS1      TYDLLLR------SGLELEADFVIRVGKPVISKKLNQWLKV--------TEAFQILVQNN
MEND_BACFN      AMSPEMQ--------EKMIPELVITYGGHIVSKRMKKYLRQH------PPKEHWHVSPDG
MEND_BACFR      AMSPEMQ--------EKMIPELVITYGGHIVSKRMKKYLRQH------PPKEHWHVSPDG
MEND_BACTN      AMPEEKT--------GQMTPELLITYGGHVVSKRLKKYLRQH------PPKEHWHVSADG
MEND_BACV8      SMTPERQ--------EDMAPEILITYGGHIVSKQLKKYLRNH------PPREHWHVAADG
MEND_PARD8      ATPEEEK--------EKLVPELVITYGGHIVSKRLKEFLRKH------PPKEHWHVSLDG
MEND_FLAJ1      TPFDDSD-------FKELEPEVLITFGGMIVSKRIKAFLRKY------KPVHHWHIDT-L
MEND_FLAPJ      TPFTDDD-------FTNFQPEILITMGGMIVSKRIKAFLRKY------KPQQHWHIDE-L
MEND_GRAFK      GPIEKDENREE--LFNRLQPDILLTFGGMIVSKKIKSFLRNY------SPQHHWHIDS-K
MEND_PORGI      AAAGEDE---------SLYPELLISFGGSLISRMLKTFLRRA------KPAEHWGIDERF
MEND_CYTH3      TSIPLTD-------LEELKPDLVISFGGALLSKWLKQFIRSN------ESIDHWYVGPDV
MEND_DESPS      ACDEASR--------SLLAPDCLISFGGHLVAKHIKLLLREF------KPAFHFRLDPAQ
MEND_NOSS1      LILRNQQLA------TRLAPDMVIQIGDMPTSKELRNWIDTHQPRR-------WVID-PS
MEND_TRIV2      LILRNQQLA------TRLAPDMVIQIGDMPTSKELRTWIDTHQPRR-------WVID-PS
MEND_TRIEI      LILRNQKLA------NKLIPKIVLQIGELPTSKQLRTWLEAANSHR-------LIID-QS
MEND_MICAN      LLLRNPALR------TQLTPDVVLQIGELPTSKELRTWLEEIDCPR-------WIID-PH
MEND_ACAM1      LILRNPTIA------SQLQPQQVISIGALPTSKVLRVWLTQSRAQT-------WVVD-VS
MEND_SYNJA      FLLQGE--Q------PPLWPEQVIQLGSLPTSKALRQTLAQARPRT-------WLLD-PR
MEND_SYNJB      LILQRD--R------PQLWPEQVIQLGSLPTSKALRQTLAKVAPRV-------WRLD-PR
MEND_SYNP6      LILRQPHWR------ASLQPEAVLQIGELPTSKELRLWLTEQTCPR-------WIVS-PR
MEND_SYNE7      LILRQPHWR------ASLQPEAVLQIGELPTSKELRLWLTEQTCPR-------WIVS-PR
MEND_THEEB      LLLRDAHLR------EYLRPEAVIQLGPLPTSKALREWLSACDPLI-------WCLD-PT
MEND_SYNY3      FLIRCPRWA------EQLVPEQIIQIGELPTSKALRHWLGTIDCPR-------YILN-FH
MEND_BDEBA      RVLEMGV------------CDSILRIGGIPTARVWRDLEDKYKELP-------VFSVSFN
MEND_PARUW      CSSQHGYP-----------IDGILRIGGIPTARLWRDLEET-NNVK-------VCSISEN
MEND_PROM0      LVLRKHKN-------LIK-CKQLLRLGPMSSSIDLENFLIKFEGIQ-------ILIKEKN
MEND_PROM2      LVLRKNKN-------SIN-CHQLLRLGPMSSSIDLEKFLINFEGIQ-------ILIKEKN
MEND_PROM9      LVLRKNKN-------LIN-CHQLLRLGPMSSSIDLEDFLTTFEGIQ-------ILIKEKN
MEND_PROMS      LVLRKNKN-------LIN-CYQLLRLGPMSSSNDLEKFLINFQGVQ-------ILIKEKN
MEND_PROM5      LIIKKNNN-------VIK-CNQILRLGPLSSSNNLEKFLSDFDGIQ-------ILVKENN
MEND_PROMP      LILKKNKN-------IIQ-CDQILRFGPLSSSNYLEDFLLNFEGLQ-------ILVKENN
MEND_PROM1      LFFSIGLFE------KIK-EIQVLRLGPIPPSRELQTWLKKPGKFQ-------LLITEGD
MEND_PROMT      LFFSIGLFE------KIK-EIQVLRLGPIPPSRELQTWLKKPGKFQ-------LLITEGD
MEND_PROMA      LLISAQIFE------SND-KLQVLRLGPLSCSRALESFLRNTNKKQ-------VLITEGE
MEND_PROM3      LLLAAGLLG------SHE-QLQVLRLGPMSASRSLEAWLKSFGDGQ-------LLITEGD
MEND_PROMM      LLLATGLLG------SQE-QLQVLRLGPMSASRSLEAWLKSFGDGQ-------LLITEGD
MEND_SYNPW      LMLPAGLPT------PER-SLQVLRLGPLPASRRLEAWLRALGPGQ-------WLISEGD
MEND_SYNS3      LLLPNGLSQ------LPA-NAQVLRLGSMPASRRLEAWIANQQGPQ-------LLITEGD
MEND_SYNPX      LQLDRLQL--------AP-GSPVLRLGPLPASRRLEAWLQRQTGPQ-------LLISEGE
MEND_SYNSC      LQLDRLSL--------PD-DAQVLRLGPMPASRRLEAWLQRHQGPQ-------LLITEGD
MEND_SYNS9      LQLEQLIS--------PE-PLQVLRLGPLPASRRLEVWLKRNAGDQ-------VLITEGE
MEND_SYNR3      LLLAEPQR-------LPP-AHQVLRLGSMPASRRLQQWLQTFEGPQ-------LVITEAE
                                       :  *                                 

MEND_ECOLI      EGRLDPAHHRGRRLIANIADWLELHPAEKRQP-----------WCVEIPRLAEQAMQAVI
MEND_ECOHS      EGRLDPAHHRGRRLIANIADWLELHPAEKRQP-----------WCVEIPRLAEQAMQAVI
MEND_ECOLC      EGRLDPAHHRGRRLIANIADWLELHPAEKRQP-----------WCVEIPRLAEQAMQAVI
MEND_SHIF8      EGRLDPAHHRGRRLIANIADWLELHPAEKRQP-----------WCVEIPRLAEQAMQAVI
MEND_SHIFL      EGRLDPAHHRGRRLIANIADWLELHPAEKRQP-----------WCVEIPRLAEQAMQAVI
MEND_ECO24      EGRLDPAHHRGRRLIANIADWLELHPAEKRQP-----------WCVEIPRLAEQAMQAVI
MEND_SHIBS      EGRLDPAHHRGRRLIANIADWLELHPAEKRQP-----------WCVEIPRLAEQAMQAVI
MEND_ECO57      EGRLDPAHHRGRRLIANIADWLELHPAEKRQP-----------WCVEIPRLAEQAMQAVI
MEND_SHISS      EGRLDPAHHRGRRLIANIADWLELHPAEKRQP-----------WCVEIPRLAEQAMQAVI
MEND_ECOK1      EGRLDPAHHRGRRLIANIADWLELHPAEKRQP-----------WCVEIPRLAEQAMQAVI
MEND_ECOL6      EGRLDPAHHRGRRLIANIADWLELHPAEKRQP-----------WCVEIPRLAEQAMQAVI
MEND_ECOL5      EGRLDPAHHRGRRLIANIADWLELHPAEKRQP-----------WCVEIPRLAEQAMQAVI
MEND_ECOUT      EGRLDPAHHRGRRLIANIADWLELHPAEKRQP-----------WCVEIPRLAEQAMQAVI
MEND_ECOSM      EGRLDPAHHRGRRLIANIADWLEQHPAEKRQP-----------WCVEIPRLAEQAMQAVI
MEND_SHIDS      EGRLDPAHHRGRRLIANIADWLELHPAEKCQP-----------WCVEIPRLAEQAMQAVI
MEND_SALCH      EGRLDPAHHRGRRLVAKIADWLELHPAEKRKP-----------WCVEIPRLAELAWQRVV
MEND_SALTY      EGRLDPAHHRGRRLVAKIADWLELHPAEKRKP-----------WCVEIPRLAELAWQRVV
MEND_SALPA      EGRLDPAHHRGRRLVAKIADWLELHPAEKRKP-----------WCVGIPRLAELAWQRVV
MEND_SALPB      EGRLDPAHHRGRRLVAKIADWLELHPAEKRKP-----------WCVEIPRLAELAWQRVV
MEND_SALTI      EGRLDPAHHRGRRLVAKIADWLELHPAEKRKP-----------WCVEIPRLAELAWQRVV
MEND_SALAR      EGRLDPAHHRGRRLVAKIADWLELHPAEKRKP-----------WCVEIPRLAELAWQRVV
MEND_CITK8      EGRLDPAHHRGRRLVAKIADWLELHPAEKRHP-----------WCVDIPRLAEQAWQAVA
MEND_KLEP7      PGRLDPAQHCGRRLLSSVERWLELHPAEKRQP-----------WATVIPQLAGQAWQAAV
MEND_ENT38      EGRLDPAHHRGRRLVSTIGDWLEDHPAEKRQA-----------WATDIPELSRLAWDLTT
MEND_YERPA      PGRLDPANHRGRRIICPVGEWLSRHPAQRRTP-----------WATELAAYSESAQAQVI
MEND_YERPE      PGRLDPANHRGRRIICPVGEWLSRHPAQRRTP-----------WATELAAYSESAQAQVI
MEND_YERPN      PGRLDPANHRGRRIICPVGEWLSRHPAQRRTP-----------WATELAAYSESAQAQVI
MEND_YERPP      PGRLDPANHRGRRIICPVGEWLSRHPAQRRTP-----------WATELAAYSESAQAQVI
MEND_YERPS      PGRLDPANHRGRRIICPVGEWLSRHPAQRRTP-----------WATELAVYSESAQAQVI
MEND_YERE8      AGRLDPANHRGRRIISPVNEWLEQHPALRRTP-----------WASELIIWSENAHAHVE
MEND_SERP5      PGRLDPAHHRGRRIRSSVAQWLELHPAQPRTP-----------WADELTMLADNALDAVS
MEND_PECAS      PGRLDPAHHRGRRLVADVGEWLSAHPADKQTP-----------WADLLVDIADRTQRQVD
MEND_PHOLL      PGRLDPANHRGKKLTCHIADWLLAHPAQPCIPW----AQSCTLWAEELIVWSEKAVNCVR
MEND_CROS8      PGRLDPAHHRGRRIVADISAWLEQHPAHPMMP-----------WDEPLEGLAAQTQRIVA
MEND_HAEI8      GKALDPYHHSLTRFNAKAHHWLRAHPPLRQKP-----------WLLEPLALSKFCATFIE
MEND_HAEIG      GKALDPYHHSLTRFNAKVHHWLRAHPPLRQKP-----------WLLEPLALSKFCATFIE
MEND_HAEIN      GKALDPYHHSLTRFNAKVHHWLRAHPPLRQKP-----------WLLEPLALSKFCATFIE
MEND_HAEIE      GKALDPYHHSLTRFNAKAHHWLRAHPPLRQKP-----------WLLEPLALSKFCATFIE
MEND_PASMU      TGLIDPNHHAHTRFNAKVHHWLRAHPPLRQKP-----------WLLEPLALSKFCASFIE
MEND_MANSM      AHRVDPYHHIHTRFTAKVHHWLRAHPPLRQKP-----------WLLEPLALSKFCASFIE
MEND_ACTSZ      PKRLDPYHHIQTRFNAKAHLWLRAHPPLRQKP-----------WLLEAMALSNFCSSFIE
MEND_HAES1      QKAVDPYHHAHTRFNAKPHHWLRAHPPMRKKP-----------WLLEPLALAKFCADFIK
MEND_HISS2      QKAVDPYHHAHTRFNAKPHHWLRAHPPMRKKP-----------WLLEPLALAKFCADFIK
MEND_ACTP2      SDYLNPFAHHQTRFVAKAHHFLRVHPPLRQKP-----------WLLEPLALSQFCAGFIE
MEND_ACTPJ      SDYLNPFAHHQTRFVAKAHHFLRVHPPLRQKP-----------WLLEPLALSQFCAGFIE
MEND_HAEDU      QRYLNPFAHRQTRFVAKAHHFLRVHPPLRQKP-----------WLLEPLALSQFCASFIE
MEND_PHOPR      AGRLDSTHRRSSRIQAPIGEWA-TCALSLTE------NSEHAGWAMPLQ--VVSERYFEM
MEND_ALIF1      SELLNESCHAHVRYRADISTWCQTHADSLADRDCVFDHAPSVHWSESLK--VASQNALAL
MEND_VIBC3      SARNNPWHAMQQQWVCEISHWVDAVLSKRLA-----GQHTQQGWADELTHYAQSVRQLAQ
MEND_VIBCH      SARNNPWHAMQQQWVCEISHWVDAVLSKRLA-----GQHTQQGWADELTHYAQSVRQLAQ
MEND_VIBCB      LDRDNQSHLPQWHWAEQPSAWVERTSGF---------SSEHAGWADKLAADIKQVTQHAK
MEND_VIBPA      LSRDNQTHLPQLHWVASPKSWVERVDVK---------SSSTQGWADGLLTDIAHVRAHIS
MEND_VIBVU      FERDNQSHLPQQHFVCSIAAWLNVVTNR---------EVQPVAWANELPRFSAEVNKQAR
MEND_VIBVY      FERDNQSHLPQQHFVCSIAAWLNVVTNR---------EVQPVAWANELPRFSAEVNKQAR
MEND_AERHH      PARLDPDYRLRRRLLCDPAAFAAAHPVAHPHL----------PWHRLAERQQA---VSQQ
MEND_AERS4      PARLDPDYRLRRRLVCEPAAFAATHKVSTRHL----------PWHRLAERQQS---ATRQ
MEND_PSYIN      NTRIDPAHSLRKRFVCSATQWIKSLQNKIPDI----------DKHWSQVLQQQNNYITKQ
MEND_SHEB5      QDRLDPSHNAKHIWHANAEQFAALNWYRSSSA----------NWANTLITYND---ELHN
MEND_SHEB9      QDRLDPSHNAKHIWHANAEQFAALNWYRSSSA----------NWANTLITYND---ELHN
MEND_SHEB8      QDRLDPSHNAKHIWHANAEQFAALNWYRSSSA----------NWANTLITYND---ELHH
MEND_SHEPC      QNRLDPSHNAKHVWHANAAQFAALNWYRSSSA----------NWANTLITYND---ELHN
MEND_SHESW      QNRLDPSHNAKHVWHANAAQFTALNWYRSSSA----------NWANTLITYND---ELHN
MEND_SHESA      QDRLDPSHNAKHIWHANAAQFAQLNWYRSSSA----------NWANTLVTYND---ELHS
MEND_SHESM      QDRLDPSHNAKHIWHANAAQFAQLNWYRSSSA----------NWANTLVTYND---ELHS
MEND_SHESR      QDRLDPSHNAKHIWHANAAQFAQLNWYRSSSA----------NWANTLVTYND---ELHS
MEND_SHEON      QDRLDPSHNAKHIWHANAAQFAQLNWYRSSSA----------NWANTLITYND---DLHH
MEND_SHEHH      QQRLDPSNKPKQVWIAPAHQFAALAWPRSSQA----------NWALNLVQFND---ELET
MEND_SHEPA      QQRLDPSHKPKKVWIAAAHQFAKLAWPRSSQA----------NWALKLVQHND---DLET
MEND_SHESH      QMRLDPSHSAKQVWHSSVAAFASQAWPRSSDA----------NWALQLIQFND---GLET
MEND_SHEWM      QMRLDPSHSAKQIWHASVTNITSLSWPRSSEA----------NWALQLTQQND---EMER
MEND_SHELP      QTRLDPSHSAKQVWISPLAAFAQLPWPRSSEA----------NWALQLIEANE---QLAT
MEND_SHEAM      QERLDPSHSNKQLWLGRAGDVCALEWPRSSEA----------NWAASLISLNQ---SVEQ
MEND_SHEFN      GDRLDPTHQSKEFYQASVQAVCQLPWPRSSQA----------NWALQLLPLNE---SLES
MEND_HALHL      DHDLDPDWQATTVQADIATAARALRPAAPQPP---------------LPGLTEALTRVAE
MEND_PELLD      PERYAPDHPVSLSLESSLQTAAEGLMG---CRSE--------PSAIKEPAEGFFLHCSGA
MEND_CHLPM      PGRYSPDHSVTLSIEASLRLTADALRG---CRTG--------ASALMAPAKRFFTEADRE
MEND_CHLCH      PMRFSPDHNVTHRLEASIAATAHALHN---SRST--------PLWRESEADHFFAQAAQE
MEND_CHLPD      ANRYAPDHNVTLSIEASPKLFADALLRDLQNVSL--------PAWKGPVADEFFTFSEEE
MEND_CHLTE      PGRFDPDHNVTLTLEASPAAVASALEG----CRE--------PVPGIRCRDAFSAASGII
MEND_RUBXD      PFRSDPEHLATHRLEADVAELCAALAGRVRRAA---------APGWLSGWLRASGEAGRR
MEND_SALRD      PSRIDPDHRVTHHVEAAVPAAVDALVARLEEGPR--------GTTWRDDWAGASERVGAV
MEND_SYNAS      AGLRDPAHRVNVRLSMPAFAFVEGLHLQ--ENPS--------LDATACCLFLDSLETLYQ
MEND_DECAR      PRWIDPARRLTHLLRSEPAAICKALLDLSLVP---------------------FSETWLS
MEND_PAEAT      PVAWYEEGRRRETPIETLPELADFAGRG------------SAEWLDSWLLAGAAAQHGLD
MEND_ARTS2      PVAWYEPGRRTELPLDNLSDLADFSGRG------------SSGWLDAWLLAGAAAQHALD
MEND_RENSM      PATWFEEGKRSEQIISDWAALSEFTGSG------------SASWLEIWLAAQIQAEAALD
MEND_CLAM3      G---GEDYDPRHRVTAHPAAVRVVGEPADPAE--------ARRWTGTWVQASRAILDEAS
MEND_CLAMS      G---GEDYDPRHRVTAHPAAVRVVGEPADPAE--------ARRWLGTWVHESRAILDEAT
MEND_LEIXX      G---RQAYNPGRRAVIVGAVRPAVEADPRSPE--------ARAWVGLWVSASRRLVEAAE
MEND_KINRD      GTWSDAGFRA-ARVVPAAQVQGPPGAGE-------------QEFAARWDRAGKLAADAVD
MEND_NOCSJ      GVWSERPFPVHSRILGGVGVDAPVDAADGTAD--------DTDWLEEWRTADRAVSARLD
MEND_CUTAK      --WTD--VAGVARVVTGPVELAEIDTDP--------------AWLGRWKDADRPVVPTAK
MEND_COREF      DVITDPGRHADRVGSRVKVT-GEQ----------------QKQWLKICDAASDLAAEGVR
MEND_CORGB      DIITDPGRHADQVGSTVKVT-GTQ----------------EKQWLKICSAASELSADGVR
MEND_CORDI      DTITG---NPQAVGSRVKVT-GEL----------------DKRWLQICEDASTLCADRVK
MEND_CORJK      RNVTDVFDNVDEVGSTVRPR-GEQ----------------PESWLQVARAISDMGVNQVR
MEND_MYCA1      PRWPDVSGNS-QATGTRAVTTGAP----------------SPAWLHRCEQANRHAVAAVR
MEND_MYCPA      PRWPDVSGNS-QATGTRAVTTGAP----------------SPAWLHRCEQANRHAVAAVR
MEND_MYCBO      PRWPDVSGNS-QATGTRAVTTGAP----------------RPAWLDRCAAMNRHAIAAVR
MEND_MYCBP      PRWPDVSGNS-QATGTRAVTTGAP----------------RPAWLDRCAAMNRHAIAAVR
MEND_MYCTA      PRWPDVSGNS-QATGTRAVTTGAP----------------RPAWLDRCAAMNRHAIAAVR
MEND_MYCTU      PRWPDVSGNS-QATGTRAVTTGAP----------------RPAWLDRCAAMNRHAIAAVR
MEND_MYCUA      PRWPDVSGNS-QATGTRAIVTGTP----------------NPSWLDRCAQMNRHAVAAVR
MEND_MYCLE      PCWPDVSGNS-QAAGTRAVTTGTP----------------HPAWLQRCAEMNQHAISTVR
MEND_MYCGI      PRWPDVSGNS-QATGTRAVTSGAA----------------SPEWLRRCAEVNRHAVEAVR
MEND_MYCVP      PRWPDVSGNS-QATGTRAVTAGAP----------------AQAWLRRCAEANRHAVDAVR
MEND_MYCSK      PRWPDVSGNS-QATGTRAVTSGTP----------------DPAWLRRCKEVNDHAVAAVR
MEND_MYCSS      PRWPDVSGNS-QATGTRAVTSGTP----------------DPAWLRRCKEVNDHAVAAVR
MEND_MYCSJ      PRWPDVSGNS-QATGTRAVTSGTP----------------DPAWLRRCKEVNDHAVAAVR
MEND_MYCS2      PRWPDVSGNS-QATGTRAVTSGAP----------------SAAWLRKCAELNEHAVTAVR
MEND_NOCFA      PRWPDVSGNV-VGTGTRAVTSGGP----------------RPEWLAHCRELDEKARQVVR
MEND_RHOJR      PRWPDVSGNV-LATGTRAVVSGEP----------------DRAWINRCRTLSEHTDKAVR
MEND_SACEN      SHWPTPAHNVREVAETFGASPGPA----------------DPDWLTGWQQADQKASAALH
MEND_THEFY      AFADPVRTATDVVGAVTAPPSATP----------------DTAWAASWAAAEAAARAAAD
MEND_HALMA      GGWSEAEFTATNLLVANPDATADALAGETLGG--------V---AASWREQFIRAEQTHW
MEND_NATPD      GGWREATFTATDLVVADETRLATAVA-DAVDR--------T---PGSYADRLAELEPGYW
MEND_HALS3      GGWREAEFTATDVVAADPAATARAIA-ARADG--------T---RSAWTDAVLDLEARYW
MEND_HALSA      GGWREAEFTATDVVAADPAATARAIA-ARADG--------T---RSAWTDAVLDLEARYW
MEND_HALWD      GEWREATFTATDIVVADPTQLLWQLSRALNTP--------G---SSTWRQRWIEADKAHT
MEND_ROSCS      GVWADDSHRVSHFVVADEAAFIRALIPRLTER------------QSAWRQRFVEAEARVW
MEND_ROSS1      GVWADDSHRVSHFIAADESAFIRALLPHLKER------------RGAWIQMFEEAEAQVW
MEND_CHLAA      AGWREPTSLAREHLHVDEHWFCIALADALASS--------QREGPTLWLRAWVSAEQTAR
MEND_MYXXD      GGLFDPAHRASTVVEGSAVAACEALTRGLARG--------VGAWARG-----FLAAEQRV
MEND_SORC5      HGWNDPTSAAAALVMGEPVEVCEALAARLGGA--------ALSLGRGRRDWAATFARAGE
MEND_BACSU      GGWRDPTQASAHMIHCNASVFAEEIMAGLTAA-----TRSS-EWLEK--------WQFVN
MEND_BACVZ      GGWRDPTQAGAHMIHCHPSVFLEAVRSAETG------KRPS-GWLEK--------WQFVN
MEND_BACLD      GGWRDPTQLSAHMLHCTEEEIAVLADSAVNSE-----NRTG-NWLEK--------WRFAN
MEND_BACP2      GGFRDPGLSASYIIESDVAAFVDEVVNRADQ------REDT-SFLNR--------WQHAN
MEND_BACAH      GQWRDPALVATEVVQASDIAFCSALIEKMP-V-----MKKN-DWFRM--------WQHIN
MEND_BACHK      GQWRDPALVATEVVQASDIAFCSALIEKMP-V-----MKKN-DWFRM--------WQHIN
MEND_BACAN      GQWRDPALVATEVVQASDIAFCSALIEKMP-V-----MKKN-DWFRM--------WQHIN
MEND_BACCZ      GQWRDPALVATEVVQASDIAFCSALIEKMP-V-----MKKN-DWFRM--------WQHIN
MEND_BACC1      GQWRDPALVATEVVQASDIAFCSALIEKMP-V-----MKKN-DWSQM--------WQHIN
MEND_BACCR      GQWRDPALVATEVVQASDIEFCKAAIEKMP-V-----MKKN-DWSLM--------WQHIN
MEND_BACCN      GKWRDPALMTTEVVSASDVAFCKAMTEHMQ-K-----REQN-DWFKK--------WKHIN
MEND_GEOKA      G-WRDPTLSADSFVQSDEWILCRQLLEWAKPK-----ENKS-AWSAI--------WREMN
MEND_GEOTN      G-WRDPTLEAACFVRSDETVLCRQLLDIARPK-----QKES-AWSTT--------WREMN
MEND_OCEIH      EGIRDHSSNQTTFLFADPTTLCQQLEQMTVVD-----QDVSTAWLKT--------WQEMN
MEND_LISMF      AAWKDPIKAVTDMIHCDERFLLDIMQQNMPDD-----AKDA-AWLNG--------WTSYN
MEND_LISMO      AAWKDPIKAVTDMIHCDERFLLDIMQQNMPDD-----AKDA-AWLSR--------WTSYN
MEND_LISIN      AAWKDPIKAVTDMIHCDERFLLDIMQQNMPDD-----TKDA-SWLNR--------WTSYN
MEND_LISW6      AAWKDPIKAVTDMIHCDERFLLDIMQKNMPDD-----TKIS-AWLNR--------WTAYN
MEND_ENTFA      GQWQEQLKKSQTVIQAKETTFVEQLLTVVK--------PTEATWLAQ--------WLLLE
MEND_LACLM      LAYRNPSLTTTITVQSNVATFANSIQKVNQ----------DFSYLEK--------WQKAQ
MEND_LACLS      LVYRNPSLTTTIMVQSNVTTFANSIQKVNQ----------DFSYLEK--------WQKAQ
MEND_LACLA      LDYRNPSLTTTTMVQSDVLPFASSIKKVNS----------DSSYLEK--------WQNAQ
MEND_DESHY      FQYRDPSLSISRYLVASPKAFARSVKVHNT----------DDGYSGR--------WQHYQ
MEND_LEUCK      AGND-HSRHVTRAFQMTPTAFLTQLALT-----------NDMTFYQR--------WQQLN
MEND_LEUMM      AGVD-HTRHIVRAIKMAPHDFLESMHLTLS--------KNQIDFNQK--------WLSLP
MEND_STAA1      DKIDVFPIAPDISYEISANDFFRSLMEDTT--------INRVSWLEK--------WQCLE
MEND_STAA9      DKIDVFPIAPDISYEISANDFFRSLMEDTT--------INRVSWLEK--------WQCLE
MEND_STAAN      DKIDVFPIAPDISYEISANDFFRSLMEDTT--------INRVSWLEK--------WQCLE
MEND_STAA2      DKIDVFPIAPDISYEISANDFFRSLMEDTT--------INRVSWLEK--------WQCLE
MEND_STAAM      DKIDVFPIAPDISYEISANDFFRSLMEDTT--------INRVSWLEK--------WQCLE
MEND_STAAS      DKIDVFPIAPDISYEISANDFFRSLMEDTT--------INRVSWLEK--------WQRLE
MEND_STAAW      DKIDVFPIAPDISYEISANDFFRSLMEDTT--------INRVSWLEK--------WQRLE
MEND_STAA3      DKIDVFPIAPDISYEISANDFFRSLMEDTT--------VNRVSWLEK--------WQCLE
MEND_STAAE      DKIDVFPIAPDISYEISANDFFRSLMEDTT--------VNRVSWLEK--------WQCLE
MEND_STAA8      DKIDVFPIAPDISYEISANDFFRSLMEDTT--------VNRVSWLEK--------WQCLE
MEND_STAAC      DKIDVFPIAPDISYEISANDFFRSLMEDTT--------VNRVSWLEK--------WQCLE
MEND_STAAT      DKIDVFPIAPDISYEISANDFFRSLMEDTT--------VNRVSWLEK--------WQCLE
MEND_STAAB      DKIDVFPIAPDISYEISANDFFRSLMEDTR--------VNRVSWLEK--------WQCIE
MEND_STAAR      DKIDVFPIAPDISYEISANDFFRSLMEDTT--------VNRVSWLEK--------WQRIE
MEND_STAEQ      DQIDVFPTPPHISYEISANDFFRSLMEEPL--------VERKKWLQQ--------WQSLE
MEND_STAES      DQIDVFPTPPHISYEISANDFFRSLMEEPL--------VERKKWLQQ--------WQSLE
MEND_STAHJ      DKIDVFPTPPSISYEISANDFFRNLIEEAA--------VDRKDWINM--------WRTLE
MEND_STAS1      DRPDAFPITPHVSYEMSANDFFRQLSEMPT--------VERKQWLEK--------WQTVE
MEND_BACFN      EVIDLFQGALTTIIEMDPFEFMEKIAFLLD---------NRTPEYPR-------------
MEND_BACFR      EVIDLFQGALTTIIEMDPFEFMEKIAFLLD---------NRTPEYPR-------------
MEND_BACTN      EVVDLY-GSLTTVIEMDPFEFLEKIAPLLD---------NRVPEYPR-------------
MEND_BACV8      KIADLY-GCLTTVIEMDPFEFLEKIAFLLD---------NKPTHYPL-------------
MEND_PARD8      EVADLF-GSLTTVIEMDAFEFLEKIAYMLE---------NRQIEYPK-------------
MEND_FLAJ1      RAYDTF-NALSKHFVMEPNDFFKNLLPKTE---------FVTSKYFS--------KIDKI
MEND_FLAPJ      RAYDTF-GSLTKHFEVLPSVFFKEFIPKIN---------SLESNYLP--------YSLEI
MEND_GRAFK      KAYNTF-FCLNKHFETDVNSFFSEFFPLTK---------RTESDYGS--------FWKDI
MEND_PORGI      PAPDTF-CALTHHICTGASGFWKEFAGRLK---------DKAPESLSPEGISYAGSWQKI
MEND_CYTH3      TTPDVF-QHLCQIIPVQLNEFLSKTTIASN---------TQEQFVQR--------WIQQQ
MEND_DESPS      MGIDTY-QCLSAELDLAPTTFFRRLAQQVE---------PAAGFRDL-------------
MEND_NOSS1      DQNLDPLHGRTTHLRIRVEEL-GYQGVEE--DKSSVSE-------YLQLWCNAETKVRVN
MEND_TRIV2      DQNLDPLHGRTTHLRIRVEEL-GCKGVEE--DKSSVSE-------YLQLWCNAETKVRVN
MEND_TRIEI      DHNFDPLHGKTTHLRISVEQL-AKILITQYFNNNHDIN-------YLNLWCQAEEKVREN
MEND_MICAN      PDNYDPLQGKTGHLRVNIEQL-GDLFPDK---TDNNRE-------YRQLWQKFDQQARLT
MEND_ACAM1      DHNMDPLHGLSIPVRISVEGLITSIPAAKKEHCQPLTA-------YAKSWLNANHSVRTL
MEND_SYNJA      AQNADPLHNPTTHLPFVVEEVAAGIPAGK----AKATA-------FLQTWLRAEAKARAE
MEND_SYNJB      PDNGDPLHNPTTHLPFAVEEWVAGIPEAP----AKRTT-------FLQGWLTAEAQIRAA
MEND_SYNP6      PENFDPLHGSSHHLPVTVEAI--AIPATI----APASD-------YSRQWQQAETAVQAA
MEND_SYNE7      PENFDPLHGSSHHLPVTVEAI--AIPATI----APASD-------YSRQWQQAETAVQAA
MEND_THEEB      GDNNNPLHGRCQMLAIAPQAV--DCPPDP----LPPNP-------YLKDWQDQDQRVREQ
MEND_SYNY3      GENLDPLQGQTIYLSASVAQVAEYIHNQGFIPDAEQKN-------YAHSWLE---KQRQS
MEND_BDEBA      H--FTGLSR-PVQHCNSLDLLSQVEFSY---------------PHHENVKVNIEDAARAT
MEND_PARUW      P--FAGLTNGNIIHTSLREFFKNYRLSFK--------------PIYSFQAWKDANRSYQL
MEND_PROM0      YRKLDPIKK-SFEYDFGLLNFTSILLEELSFNEKNKKS----LTPLALDLIEEGKQIKDI
MEND_PROM2      YRKLDPIKK-SFEYDFGLSNFTTLLIEELSINEKNKKS----LIPMALDLIEEGEQIKEI
MEND_PROM9      YRKLDPIKK-SFEYDFGLLNFITLLLAELSINKINTKS----LTPLAIDLMEEGEQIKKI
MEND_PROMS      HRKLDPIKK-SFEYDFGLTNFTSLLKKELSINEKNKKS----LTPLALDLLEEGKQVKEI
MEND_PROM5      RRKLDPIKK-SLEYEFGLTNFVNQLLGTYSDDQKKKKP----LINLVKVLRREGQKISKI
MEND_PROMP      IRKLDPIKK-SLEYDFGISNFVNQLLGAFLNHKKKSKP----LINLGQVLIKEGAKIKEI
MEND_PROM1      CRNLDPIGG-STQFSEGFSCWVDKMLECIPVKPAIDKKIVS--QKLTKELIKYDLFINHW
MEND_PROMT      SRNLDPIGG-STQFSEGFSCWVDKMLEVIPVKPAIDKKIVS--KKLIKELIKYDLFIHDW
MEND_PROMA      ERYLDPLHL-AKQYSGGLQSWL-KIFKSNYPNLNNNLVNDD--TNILEDLLNKNQLVGDL
MEND_PROM3      SRCLDPLGL-SVQWSHGLTTWWQHHHHRW--IDADAASQQA-TQPLLKKWQIIDRFAQDW
MEND_PROMM      SRCLDPLGL-SVQWNHGLTSWWQHHHHRW--IDADAASQQA-TKALLRKWQISDRFAQEW
MEND_SYNPW      CRSLDPLGL-ASQCSLGLASWWDCVSP-------NPLSLAPGPSSLLTAWRDLEAAVAGE
MEND_SYNS3      PRPLDPLEI-AEQWSGGLAQWWKQLNPRLRVIDATKPDIEARGGSPLQAWRTADLELQQR
MEND_SYNPX      PRGLDPLGL-ADQWSGGLAAWWAEQNQDFPG-------------ASTPEQLMPQSGIASL
MEND_SYNSC      PRPLDPLHT-ANQWSGGMAAWIAQQ-PGLKQ-------------ATKPS--VGTNDLSPW
MEND_SYNS9      PRYMDPLGL-ATQWSGGLAAWCCAQPLDQASRP---------LSADHSAWLRRDQALGLW
MEND_SYNR3      PRRQDPLASGCAQHPHGLAAWVELLPTGEPSATS---------RADAARWQQAESLLQQQ
                                                                            

MEND_ECOLI      AR-----RDAFGEAQ------------------------------LAHRICDYLPE-QGQ
MEND_ECOHS      AR-----RDAFGEAQ------------------------------LAHRICDYLPE-QGQ
MEND_ECOLC      AR-----RDAFGEAQ------------------------------LAHRICDYLPE-QGQ
MEND_SHIF8      AR-----RDAFGEAQ------------------------------LAHRISDYLPE-QGQ
MEND_SHIFL      AR-----RDAFGEAQ------------------------------LAHRISDYLPE-QGQ
MEND_ECO24      AR-----RDAFGEAQ------------------------------LAHRISDYLPE-QGQ
MEND_SHIBS      AR-----RDAFGEAQ------------------------------LAHRISDYLPE-QGQ
MEND_ECO57      AC-----RDAFGEAQ------------------------------LAHRISDYLPE-QGQ
MEND_SHISS      AR-----RDAFGEAQ------------------------------LAHRISDYLPE-QGQ
MEND_ECOK1      AR-----RDAFGEAQ------------------------------LAHRISDYLPE-QGQ
MEND_ECOL6      AR-----RDAFGEAQ------------------------------LAHRISDYLPE-QGQ
MEND_ECOL5      AR-----RDAFGEAQ------------------------------LAHRISDYLPE-QGQ
MEND_ECOUT      AR-----RDAFGEAQ------------------------------LAHRISDYLPE-QGQ
MEND_ECOSM      AR-----RDAFGEAQ------------------------------LAHRISDYLPE-QGQ
MEND_SHIDS      AR-----RDAFGEAQ------------------------------LAHRVCDYLPE-QGQ
MEND_SALCH      AQ-----RDTFGEAQ------------------------------LAHRIRDYLPE-QGQ
MEND_SALTY      AQ-----RDTFGEAQ------------------------------LAHRIRDYLPE-QGQ
MEND_SALPA      AQ-----RDTFGEAQ------------------------------LAHRIRDYLPE-QGQ
MEND_SALPB      AQ-----RDTFGEAQ------------------------------LAHRIRDYLPE-QGQ
MEND_SALTI      AQ-----RDTFGEAQ------------------------------LAHRIRDYLPE-QGQ
MEND_SALAR      AQ-----RDTFGEAQ------------------------------LAHRIRDYLPE-QGQ
MEND_CITK8      AR-----RDMFGEAQ------------------------------LAHRIRDYLPE-QGQ
MEND_KLEP7      AS-----NEPFGEAQ------------------------------LAQRIRRYLPE-QGQ
MEND_ENT38      QQ-----CERFGEAE------------------------------LAHRIRQYLPD-QGQ
MEND_YERPA      ETL----AGQFSEAA------------------------------VAHQLAELLPD-NGQ
MEND_YERPE      ETL----AGQFSEAA------------------------------VAHQLAELLPD-NGQ
MEND_YERPN      ETL----AGQFSEAA------------------------------VAHQLAELLPD-NGQ
MEND_YERPP      ETL----AGQFSEAA------------------------------VAHQLAELLPD-NGQ
MEND_YERPS      ETL----SGQFSEAA------------------------------VAHQLAELLPD-NGQ
MEND_YERE8      QAL----NEQFSEAA------------------------------VAHRLAELLPE-NGQ
MEND_SERP5      GHL----VNRFGEAQ------------------------------LAHRLPELLPE-NGQ
MEND_PECAS      AHL----ASHFGEAQ------------------------------LAQRIPALLPP-DGQ
MEND_PHOLL      TEL----AGKFGEAT------------------------------VAYRLRELLPE-RGQ
MEND_CROS8      RE-----LTEWGEAQ------------------------------VAHRLPELLPP-DGQ
MEND_HAEI8      QQV----GGNLTEAS------------------------------LALRLPTLLPY-NGV
MEND_HAEIG      QQV----GGNLTEAS------------------------------LALRLPTLLPY-NGV
MEND_HAEIN      QQV----GGNLTEAS------------------------------LALRLPTLLPY-NGV
MEND_HAEIE      QQV----GGNLTEAS------------------------------FALRLPTLLPY-NGV
MEND_PASMU      KQV----GGNLNEAS------------------------------LAHHLDRILSN-NGV
MEND_MANSM      QQV----GGNLNEAS------------------------------LAHHIERILPN-NGI
MEND_ACTSZ      QQV----GGSLNEAS------------------------------LAHHIERAFPK-NAA
MEND_HAES1      QRV----GSNLNEAS------------------------------LAHNIELLLPKSNSV
MEND_HISS2      QRV----GSNLNEAS------------------------------LAHNIELLLPKSNSV
MEND_ACTP2      QQV----GGSLNEAS------------------------------LAHHIEEVLAT-SGN
MEND_ACTPJ      QQV----GGSLNEAS------------------------------LAHHIEEVLAT-SGN
MEND_HAEDU      QQV----GGSLNEAS------------------------------LAHHIEQVLAT-NGN
MEND_PHOPR      ---LGEYSDQLTELS------------------------------LAVNLGAWLPD-KTE
MEND_ALIF1      ARSMACNSETLSELS------------------------------FALTVGQ-KAN-DCD
MEND_VIBC3      LHF---SSSSLSEVA------------------------------LALDLTE-RAT-QAD
MEND_VIBCH      LHF---SSSSLSEVA------------------------------LALDLTE-RAT-QAD
MEND_VIBCB      GLFISDPKSELSEIA------------------------------LAIDVAE-RAQ-GVD
MEND_VIBPA      DEFLFSSASTLNEIA------------------------------LAADIEE-RTQ-SVD
MEND_VIBVU      EI----AQSSLCEMM------------------------------IALHLSS-LVG-SAD
MEND_VIBVY      EI----AQSSLCEMM------------------------------IALHLSS-LVG-SAD
MEND_AERHH      VRSAC---ERFSELG------------------------------VCHRLNQLIRG-Q--
MEND_AERS4      IRSAC---DRFSELG------------------------------VCHRLGNLIQG-Q--
MEND_PSYIN      IISPFLDNNLISEIS------------------------------VISALDKLLPA-DNP
MEND_SHEB5      LFVRNIDQGEFGEAQ------------------------------VIRAIANTRPL-EQQ
MEND_SHEB9      LFVRNIDQGEFGEAQ------------------------------VIRAIANTRPL-EQQ
MEND_SHEB8      LFVRNIDQGEFGEAQ------------------------------VIRAIANTRPL-EQQ
MEND_SHEPC      LFVRNIDHGEFGEAQ------------------------------VVRAIANTRPL-EQQ
MEND_SHESW      LFVRNIDHGEFGEAQ------------------------------VVRAIANTRPL-EQQ
MEND_SHESA      LFVRNIDQGEFGEAQ------------------------------VIRAIANTRPL-EQQ
MEND_SHESM      LFVRNIDQGEFGEAQ------------------------------VIRAIANTRPL-EQQ
MEND_SHESR      LFVRNIDQGEFGEAQ------------------------------VIRAIANTRPL-EQQ
MEND_SHEON      LFVRNIDQGEFGEAQ------------------------------VIRAIANTRPL-EQQ
MEND_SHEHH      LYQQQIDHAEFGEAQ------------------------------AIRAIAKRQTN-EQQ
MEND_SHEPA      LYQQQIDNAEFGEAQ------------------------------TIRAIAKRQTA-EQH
MEND_SHESH      LFQQQIDNAEFGEAM------------------------------VVRAIAKAQNR-QSQ
MEND_SHEWM      LFEQQIDNAEFGEAM------------------------------VVRAIAKSQTK-QQQ
MEND_SHELP      LFQQQIDDAEFGEAQ------------------------------VVRTIAGRG---EQQ
MEND_SHEAM      DFIHHIDGGEFGEAQ------------------------------VIRAIAASHTA-EQQ
MEND_SHEFN      LFKQQIDNTTFGEAQ------------------------------VVRAIALAQSD-QHI
MEND_HALHL      TRSAALANEPFAEPA------------------------------ATERLSRTLPP-GMA
MEND_PELLD      LDDLTEASIPLSEIS------------------------------AARQISQLITP-GEA
MEND_CHLPM      IAAATAPDLPVSEIG------------------------------TARIVSELLPP-DHL
MEND_CHLCH      LEGDVVADQPITEIS------------------------------AARLISRHIGT-EQA
MEND_CHLPD      IEHYCEDDRPVSEIS------------------------------VARIVSRLTGE-HDG
MEND_CHLTE      DKMACVPELAVSEIS------------------------------APRIVSSLAGD-GHA
MEND_RUBXD      LEAALRERKGLSEPG------------------------------VARLVSRLIPE-DHA
MEND_SALRD      VQAHVQESDALTDPL------------------------------VAALLTEEMPS-EHA
MEND_SYNAS      ALQRRIPEETLSFSR------------------------------IASDLLGAVPD-GEG
MEND_DECAR      ALAKFEGNAEADEQR------------------------------NHIHVLLEEVPDDTD
MEND_PAEAT      GVLAGEDLANGPS-----------------------------------VGATVWEHSRGQ
MEND_ARTS2      QALSEEPAATGPT-----------------------------------VGALVWKHARGQ
MEND_RENSM      DALGEE--LSGLR-----------------------------------LARELWGSSE-N
MEND_CLAM3      AAESAPLLPSGTTPAERRD----------FARAELAAVRADVTRRHLVRALWQATWPHDR
MEND_CLAMS      AAESAPLLPSGTTPAERRD----------FARAELAAVRADVTRRHLVRALWQATWPHDR
MEND_LEIXX      RVASPDATAPDLAKARSLDPSDALA----FARMELAAVRAPITRPLLAEALWRHTWPHDR
MEND_KINRD      AALDAEAGLSGPWAA--------------------------------REVVAACAADGST
MEND_NOCSJ      ALLAAEPGLT-PHEV--------------------------------AGAVARALPAGGL
MEND_CUTAK      QRLCRDIWWA------------------------------------------CTTPNAPV
MEND_COREF      EVLAKEEHGFTGLHV--------------------------------AAAVADGLGTGDT
MEND_CORGB      DVLDNQEFGFTGLHV--------------------------------AAAVADTLGTGDT
MEND_CORDI      EVL--EGHGFTGLHV--------------------------------AAAVADTMAVGDT
MEND_CORJK      DGLA-EREPFTAVHA--------------------------------VAVVADALRDGDL
MEND_MYCA1      GQLAAHPLT-TGLHV--------------------------------AAAVADALRPGDQ
MEND_MYCPA      GQLAAHPLT-TGLHV--------------------------------AAAVADALRPGDQ
MEND_MYCBO      EQLAAHPLT-TGLHV--------------------------------AAAVSHALRPGDQ
MEND_MYCBP      EQLAAHPLT-TGLHV--------------------------------AAAVSHALRPGDQ
MEND_MYCTA      EQLAAHPLT-TGLHV--------------------------------AAAVSHALRPGDQ
MEND_MYCTU      EQLAAHPLT-TGLHV--------------------------------AAAVSHALRPGDQ
MEND_MYCUA      EQLAAHPLT-TGLHV--------------------------------AAAVAGALRPGDQ
MEND_MYCLE      SQLAAHPLI-TGLHV--------------------------------AAAVADALRPGDQ
MEND_MYCGI      GQLAAHPLT-TGLHV--------------------------------AAVVADAVGPGDQ
MEND_MYCVP      GQLAAHPLT-TGLHV--------------------------------AAAVADALRPGDQ
MEND_MYCSK      EQLAAHPLT-TGLHV--------------------------------AAAVADAVRPGDQ
MEND_MYCSS      EQLAAHPLT-TGLHV--------------------------------AAAVADAVRPGDQ
MEND_MYCSJ      EQLAAHPLT-TGLHV--------------------------------AAAVADAVRPGDQ
MEND_MYCS2      KQLAAHPMT-TGLHV--------------------------------AAAVADALRPGDQ
MEND_NOCFA      AELAGHPKP-TGLHV--------------------------------AAVVMDALREGDQ
MEND_RHOJR      AQLAAHPKA-TGLHV--------------------------------AAAVMDALTDGDQ
MEND_SACEN      AALDLERWP-NGPVV--------------------------------ARDVVDALPAGSL
MEND_THEFY      RLLDSDETLSELRLA---------------------------------RDLAAHLPAGSL
MEND_HALMA      DAVTETASETY-------------------------------WEGGVLSDVTALAPDPAT
MEND_NATPD      RLVEGEEPQ----------------------------------EGAMLADAVALAPDPST
MEND_HALS3      AAVDDFQPAAT-------------------------------LEGEIAATVAAGAPDPAT
MEND_HALSA      AAVDDFQPAAT-------------------------------LEGEIAATVAAGAPDPAT
MEND_HALWD      DVLANTDSSAHQSLAATNSDSSTDDIIENTDEEGSNESDRWFCEGRILSDVMTAAPDPAT
MEND_ROSCS      AAVEAGIADEP------------------------------YFDGGAVYDVIDLLPEGAS
MEND_ROSS1      SAVEAALNDEP------------------------------YFDGAAVYDAVSLLPEGAA
MEND_CHLAA      TIIQSHLLPQEHIS-----------------------------EPGLFARLGSWLPAGAT
MEND_MYXXD      RTALEAAFAEQPDVLS---------------------------EPRIAREVVAALPAGAP
MEND_SORC5      IAAGHAARACAGDELT---------------------------EGAIARMVASACPAGSL
MEND_BACSU      GRFREHLQTISSEDVSFE-------------------------GNLYRILQHLVPE-NSS
MEND_BACVZ      ERFRSHLQAASMDDLSFE-------------------------GNVYRQLQHLVPE-GSS
MEND_BACLD      SRFRALLRNLEAEDLTFE-------------------------GNIYRNLQHLIPD-NSS
MEND_BACP2      SSFRTHASHYSDEDLSFE-------------------------GNVYRQLQHLLPK-ESV
MEND_BACAH      EKTKETLREMETYDTAFE-------------------------GRVITDIVRVLPE-GAT
MEND_BACHK      EKTKETLREMETYDTAFE-------------------------GRVITDIVRVLPE-GAT
MEND_BACAN      EKTKETLREMETYDTAFE-------------------------GRVITDIVRVLPE-GAT
MEND_BACCZ      EKTKETLREMETYDTAFE-------------------------GRVITDIVRVLPE-GAT
MEND_BACC1      EKTKETLREMETYDTAFE-------------------------GRVITDIVRVLPE-GAT
MEND_BACCR      EKTKETLREMETYETAFE-------------------------GKVITDIVRVLPE-DAT
MEND_BACCN      DKTKETLREVEAYDTAFE-------------------------GKVITDIVRILPE-GAT
MEND_GEOKA      AIARAALERHLPKEEWFE-------------------------GNVFTELADLLPA-GAA
MEND_GEOTN      DIARTVLRQHLPADEWFE-------------------------GKVFTELAELLPA-GAT
MEND_OCEIH      QIAKHYLLEGVE-EQITE-------------------------GEAVRGLAEVIPD-GST
MEND_LISMF      KVAREIVLAEMANTTILEE------------------------GKIVAELRRLLPD-KAG
MEND_LISMO      KVAREIVLAEMANTTILEE------------------------GKIVAELRRLLPE-KAG
MEND_LISIN      QKAREIVLEEMANTTTLEE------------------------GKIVSELRRLLPD-KAG
MEND_LISW6      QTAREIVLTEMENTTTLEE------------------------GKIVAELRRLLPD-KAG
MEND_ENTFA      KTVSEVLLETLNATELNE-------------------------TTASLAVHQTMKE-NGQ
MEND_LACLM      EKMRHQLEKVAQEENPFE-------------------------GRFVQELQKHLKALDAQ
MEND_LACLS      EKMRHQLEKVAQEENPFE-------------------------GRFVQELQKHLKALDAQ
MEND_LACLA      EKMRQLLEKVTYEESPFE-------------------------GRYVQELQKHLEALDAQ
MEND_DESHY      ARMRRRLNLAQDEEELFE-------------------------GKLVQKLQDSLPE-GSR
MEND_LEUCK      D----------IPRHAVGE------------------------ASVSCMLNRILPE-NTA
MEND_LEUMM      K----------VIKTR-NE------------------------MNIITALDDAVPD-DTH
MEND_STAA1      KKGRKEIK--CYLEQATDE------------------------SAFVGELIKKTSE-KDA
MEND_STAA9      KKGRKEIK--CYLEQATDE------------------------SAFVGELIKKTSE-KDA
MEND_STAAN      KKGRKEIK--CYLEQATDE------------------------SAFVGELIKKTSE-KDA
MEND_STAA2      KKGRKEIK--CYLEQATDE------------------------SAFVGELIKKTSE-KDA
MEND_STAAM      KKGRKEIK--CYLEQATDE------------------------SAFVGELIKKTSE-KDA
MEND_STAAS      KKGRKEIK--CYLEQATDE------------------------SAFVGELIKKTSE-KDA
MEND_STAAW      KKGRKEIK--CYLEQATDE------------------------SAFVGELIKKTSE-KDA
MEND_STAA3      KKGRKEIK--CYLEQATDE------------------------SAFVGELIKKTSE-KDA
MEND_STAAE      KKGRKEIK--CYLEQATDE------------------------SAFVGELIKKTSE-KDA
MEND_STAA8      KKGRKEIK--CYLEQATDE------------------------SAFVGELIKKTSE-KDA
MEND_STAAC      KKGRKEIK--CYLEQATDE------------------------SAFVGELIKKTSE-KDA
MEND_STAAT      KKGRKEIK--CYLEQATDE------------------------SAFVGELIKKTSE-KDA
MEND_STAAB      KKGRKEIK--CYLEQATDE------------------------SAFVGELIKKTSE-KDA
MEND_STAAR      KKGRKEIK--CYLEQATDE------------------------SAFVGELIKKTSE-KDA
MEND_STAEQ      QQARIEIS--DYLKHATDE------------------------AAYVGSLIQKLTK-EDT
MEND_STAES      QQARIEIS--DYLKHATDE------------------------AAYVGSLIQKLTK-EDT
MEND_STAHJ      SQARNTID--KHMTNATDE------------------------AAFVKILIDKLTK-DDA
MEND_STAS1      KHAIVEIK--DHLRTATDE------------------------AAYVGNVLDKLTK-DDA
MEND_BACFN      -QWENFCKELPRPELPYSE------------------------MSAIGSLIQALPA-SCA
MEND_BACFR      -QWENFCKELPRPELPYSE------------------------MSAIGSLIQALPA-SCA
MEND_BACTN      -VWENYCKTIPEPEFGYSE------------------------MSAIGALIKALPE-SCA
MEND_BACV8      -MWENYCKTIPMPDLAYSE------------------------ISVIGKLIRALPE-PCA
MEND_PARD8      -AWEYKSRNLPEPEFAYSE------------------------MAAIGGLIRSLPA-ESA
MEND_FLAJ1      YDLRKIKKKQYLSKIGFSD------------------------FKVFEKVIESLPK-NSQ
MEND_FLAPJ      KKVRTQKTNTYLATIPFSD------------------------FKAFEIILPKLPL-YSQ
MEND_GRAFK      KGKRQHRHEDYMAEIPYSD------------------------LKAMQEIYQKIPK-NSV
MEND_PORGI      KRKADLLHRTFMADAGWSD------------------------LKAFEVILRHIPH-DAA
MEND_CYTH3      THIIPAIREFNTKEKVFNE------------------------FTAVFDVLNHLPA-FAK
MEND_DESPS      -----WALPEGVAENQDDE------------------------FLVLKRLLGQLPA-GSI
MEND_NOSS1      VDETLDKMEDLVECK-------------------------------AAWLLSQMLPPETP
MEND_TRIV2      VDETLDKMEDLVECK-------------------------------AAWLLSQILPPETP
MEND_TRIEI      IDTKMAKINHILEPK-------------------------------ISWLISQTLPKNTS
MEND_MICAN      IDRLLAAETKLIEGK-------------------------------IPWLLSQYLPPRTP
MEND_ACAM1      INRAMQKQSELIESK-------------------------------IAWLLSQILPPRTP
MEND_SYNJA      LDRLLADLPEWFEGK-------------------------------LAWWLAHHLPPETP
MEND_SYNJB      LDQAMTDLSEWFEGK-------------------------------VAWWLAHHLPPETP
MEND_SYNP6      IAQHLAQVPDLTEPG-------------------------------IARLLSQHLPAQTP
MEND_SYNE7      IAQHLAQVPDLTEPG-------------------------------IARLLSQHLPAQTP
MEND_THEEB      LKRTFEAIDWFSEVK-------------------------------LIYHLPQWLPSQTA
MEND_SYNY3      QTIIISALADAHTPL-------------------------------MVAQLAHCLPPQTN
MEND_BDEBA      QIRQLLDKYPDSEQG-------------------------------MIYAISKRMKGSS-
MEND_PARUW      ELLKLFEEEPLAELS-------------------------------LFHLLSKKIPEESK
MEND_PROM0      LKDEIIIDNKITEYK-------------------------------LANLVPKLWPAEHP
MEND_PROM2      LKEKITQDNQITEYM-------------------------------LANRVPKLWPAENP
MEND_PROM9      LKEKITNDNQITEYK-------------------------------LANLVPKLWPAENP
MEND_PROMS      LKGNITYENQITEYR-------------------------------LANLVPKLWPAENP
MEND_PROM5      LNEQIFLNKEITEYK-------------------------------LANFVPKIWPENYP
MEND_PROMP      LKEQLFSNTEITEYK-------------------------------LANFVPKIWPENYP
MEND_PROM1      LDKRLFRNGLITEPA-------------------------------LARLLPRLLPDSIP
MEND_PROMT      LDKRLFRNGLITEPA-------------------------------LARLLPRLLPESIP
MEND_PROMA      VDKYLKEDSKITEPS-------------------------------IARKLLDLIPEDIP
MEND_PROM3      LDQQLPLQGAITEPA-------------------------------LARWLSRLLPAELS
MEND_PROMM      LDQQLPLQGAITEPA-------------------------------LARWLSRLLPTELP
MEND_SYNPW      LARQLPQAGPVSEPA-------------------------------LMHVLPQLLPPALP
MEND_SYNS3      LYELLPGHGPANEPA-------------------------------LMFALARLLPAELP
MEND_SYNPX      LRQRLPLQGAVNEPA-------------------------------LAHWLPLLLPPQLP
MEND_SYNSC      LETQLPLRGAVTEPA-------------------------------LAYWLPQLLPEQLP
MEND_SYNS9      LEEQLVSEGPVSEPA-------------------------------LAFQLADLLPPGLP
MEND_SYNR3      LDHDLPLQGPCSEPA-------------------------------LARALQNLIPSEWP
                                                                            

MEND_ECOLI      LFVGNSLVVRLIDALSQLP---AGYPVYSNRGASGIDGLLSTAAGVQRASG---------
MEND_ECOHS      LFVGNSLVVRLIDALSQLP---AGYPVYSNRGASGIDGLLSTAAGVQRASG---------
MEND_ECOLC      LFVGNSLVVRLIDALSQLP---AGYPVYSNRGASGIDGLLSTAAGVQRASG---------
MEND_SHIF8      LFVGNSLVVRLIDALSQLP---AGYPVYSNRGASGIDGLLSTAAGVQRASG---------
MEND_SHIFL      LFVGNSLVVRLIDALSQLP---AGYPVYSNRGASGIDGLLSTAAGVQRASG---------
MEND_ECO24      LFVGNSLVVRLIDALSQLP---AGYPVYSNRGASGIDGLLSTAAGVQRASG---------
MEND_SHIBS      LFVGNSLVVRLIDALSQLP---AGYPVYSNRGASGIDGLLSTAAGVQRASG---------
MEND_ECO57      LFVGNSLVVRLIDALSQLP---AGYPVYSNRGASGIDGLLSTAAGVQRASG---------
MEND_SHISS      LFVGNSLVVRLIDALSQLP---AGYPVYSNRGASGIDGLLSTAAGVQRASG---------
MEND_ECOK1      LFVGNSLVVRLIDALSQLP---AGYPVYSNRGASGIDGLLSTAAGVQRASG---------
MEND_ECOL6      LFVGNSLVVRLIDALSQLP---AGYPVYSNRGASGIDGLLSTAAGVQRASG---------
MEND_ECOL5      LFVGNSLVVRLIDALSQLP---AGYPVYSNRGASGIDGLLSTAAGVQRASG---------
MEND_ECOUT      LFVGNSLVVRLIDALSQLP---AGYPVYSNRGASGIDGLLSTAAGAQRASG---------
MEND_ECOSM      LFVGNSLVVRLIDALSQLP---AGYPVYSNRGASGIDGLLSTAAGVQRASG---------
MEND_SHIDS      LFVGNSLVVRLIDALSQLP---AGYPVYSNRGASGIDGLLSTAAGVQRASG---------
MEND_SALCH      LFVGNSLVVRLIDALSQLP---AGYPVYSNRGASGIDGLLSTAAGVQRASA---------
MEND_SALTY      LFVGNSLVVRLIDALSQLP---AGYPVYSNRGASGIDGLLSTAAGVQRASA---------
MEND_SALPA      LFVGNSLVVRLIDALSQLP---AGYPVYSNRGASGIDGLLSTAAGVQRASA---------
MEND_SALPB      LFVGNSLVVRLIDALSQLP---AGYPVYSNRGASGIDGLLSTAAGVQRASA---------
MEND_SALTI      LFVGNSLVVRLIDALSQLP---AGYPVYSNRGASGIDGLLSTAAGVQRASA---------
MEND_SALAR      LFVGNSLVVRLIDALSQLP---AGYPVYSNRGASGIDGLLSTAAGVQRASA---------
MEND_CITK8      LFVGNSLVVRLIDALSQLP---AGYPVYSNRGASGIDGLISTAAGVQRASA---------
MEND_KLEP7      LFVGNSLVVRLIDALAQLP---AGYPVYSNRGASGIDGLIATAAGVQRASA---------
MEND_ENT38      LFVGNSLVVRLIDALSKLP---AGYPVYSNRGASGIDGLISTAAGVQRAST---------
MEND_YERPA      LFVGNSLIVRLIDALGQLP---AGYPVYSNRGASGIDGLLSTAAGVQRATA---------
MEND_YERPE      LFVGNSLIVRLIDALGQLP---AGYPVYSNRGASGIDGLLSTAAGVQRATA---------
MEND_YERPN      LFVGNSLIVRLIDALGQLP---AGYPVYSNRGASGIDGLLSTAAGVQRATA---------
MEND_YERPP      LFVGNSLIVRLIDALGQLP---AGYPVYSNRGASGIDGLLSTAAGVQRATA---------
MEND_YERPS      LFVGNSLIVRLIDALGQLP---AGYPVYSNRGASGIDGLLSTAAGVQRATA---------
MEND_YERE8      LFVGNSLIVRLIDALGQLP---AGYPVYSNRGASGIDGLLSTAAGVQRATA---------
MEND_SERP5      LFLGNSLIVRLIDALTRLP---AGYPVFSNRGASGIDGLISTAAGVQRATA---------
MEND_PECAS      LFVGNSLVVRLIDALAQLP---QGYPVYGNRGASGIDGLISTLAGVQRATA---------
MEND_PHOLL      LFVGNSLIIRLIDTLGQLP---AGYPVYSNRGASGIDGLISTAAGVQRATA---------
MEND_CROS8      LFLGNSLTVRLVDALAQLP---AGYPVYGNRGASGIDGLVSTAAGVQRATG---------
MEND_HAEI8      LFLGNSLLVRLVDALTQLP---ESYPVYTNRGASGIDGLLATAAGIGIGSN---------
MEND_HAEIG      LFLGNSLLVRLVDALTQLP---ESYPVYTNRGASGIDGLLATAAGIGIGSN---------
MEND_HAEIN      LFLGNSLLVRLVDALTQLP---ESYPVYTNRGASGIDGLLATAAGIGIGSN---------
MEND_HAEIE      LFLGNSLLVRLVDALTQLP---ESYPVYTNRGASGIDGLLATAAGIGIGSN---------
MEND_PASMU      LFLGNSLFVRLVDALAKLP---EGYPVYTNRGASGIDGLLATAAGIGIGAN---------
MEND_MANSM      LFLGNSLFVRLVDALGKLP---EGYPVITNRGASGIDGLLATAAGVGMGSN---------
MEND_ACTSZ      LFLGNSLFVRLVDALTKRT---ENYPIYTNRGASGIDGLIATAVGVGIGAN---------
MEND_HAES1      LFLGNSLFVRLADALSQPS---ANYPIYTNRGASGIDGLLATAAGIAVGSE---------
MEND_HISS2      LFLGNSLFVRLADALSQPS---ANYPIYTNRGASGIDGLLATAAGIAVGSE---------
MEND_ACTP2      LFIGNSLFVRLVDALCKLP---EGYPVYTNRGASGIDGLIATMAGVAKGSG---------
MEND_ACTPJ      LFIGNSLFVRLVDALCKLP---EGYPVYTNRGASGIDGLIATMAGVAKGSG---------
MEND_HAEDU      LFIGNSLFVRLVDALCKLP---EGYPVYTNRGASGIDGLIATMAGIAKASG---------
MEND_PHOPR      LFLGNSLIIRLLDMVGKLP----STATFANRGASGIDGLIATIAGINKARQ---------
MEND_ALIF1      WFVGNSLIVRLLDMTGELN----QKNVYTNRGASGIDGLVATAVGVQLAND---------
MEND_VIBC3      LFLGNSLIVRLVDIFSALD----GREVFSNRGASGIDGLVATASGVQRARQ---------
MEND_VIBCH      LFLGNSLIVRLVDIFSALD----GREVFSNRGASGIDGLVATASGVQRARQ---------
MEND_VIBCB      LFVGNSLFVRLIDMFGKLD----NTEVFTNRGASGIDGLFATASGVQRARN---------
MEND_VIBPA      VFLGNSLFVRLVDMFGRL-----NTEVFTNRGASGIDGLFATASGVQRSRG---------
MEND_VIBVU      LFLGNSLFVRMVDMVGQLH----GVETFTNRGASGIDGLFATASGVQRARS---------
MEND_VIBVY      LFLGNSLFVRMVDMVGQLH----GVETFTNRGASGIDGLFATASGVQRARS---------
MEND_AERHH      LFVGNSMPARLMDMLGEAGK--GPSRVMTNRGASGIDGLIATAYGFAQSVQP--------
MEND_AERS4      LFVGNSMPARLMDMLGEAGK--GPSRVMTNRGASGIDGLIATAYGFAQSSE---------
MEND_PSYIN      VFIGNSMPVRLSDMFFRQNA--ALP--FSNRGASGIDGLLATASGIAKSCA---------
MEND_SHEB5      LFIGNSLPVRLYDMYAPVSC--CTATTYTNRGASGIDGLLATACGIAAHEG---------
MEND_SHEB9      LFIGNSLPVRLYDMYAPVSC--CTATTYTNRGASGIDGLLATACGIAAHKG---------
MEND_SHEB8      LFIGNSLPVRLYDMYAPVSC--CTATTYTNRGASGIDGLLATACGIAAHEG---------
MEND_SHEPC      LFIGNSLPVRLYDMYAPVSC--CTATTYTNRGASGIDGLLATACGLAAHEG---------
MEND_SHESW      LFIGNSLPVRLYDMYAPVSC--CTATTYTNRGASGIDGLLATACGLAAHEG---------
MEND_SHESA      LFIGNSLPVRLYDMYAPVSC--CTATTYTNRGASGIDGLLATACGIAAHQG---------
MEND_SHESM      LFIGNSLPVRLYDMYAPVSC--CTATTYTNRGASGIDGLLATACGIAAHQG---------
MEND_SHESR      LFIGNSLPVRLYDMYAPVSC--CTATTYTNRGASGIDGLLATACGIAAHQG---------
MEND_SHEON      LFIGNSLPVRLYDMYAPVSC--CTATTYTNRGASGIDGLLATACGIAAHQG---------
MEND_SHEHH      LFIGNSLPIRLYDMFAPITT--SSANVFTNRGASGIDGLLATACGVAIAGA---------
MEND_SHEPA      LFIGNSLPVRLYDMFAPITT--SSANVFTNRGASGIDGLLATACGVAAAEG---------
MEND_SHESH      LFIGNSLPVRLYDMYAPITP--DYPRTYTNRGASGIDGLLATACGVAKHEG---------
MEND_SHEWM      LFIGNSLPVRLYDMFAPITT--EQGATFTNRGASGIDGLLASACGVAMHQG---------
MEND_SHELP      LFIGNSLPVRLYDMYAPITP--IAPRVFTNRGASGIDGLLATACGIAAHKA---------
MEND_SHEAM      LFIGNSLPVRLYDMFAPIGC--CAASTYTNRGASGIDGLIATACGVARHSG---------
MEND_SHEFN      LFIGNSLPIRLYDMYAPIAT--NTPAIYTNRGASGIDGLIATACGVAADKN---------
MEND_HALHL      LFAGNSLPIRAVDLFAVAK---HGNPCVTQRGVSGIDGLIATAAGFAHHHP---------
MEND_PELLD      LFTSNSMSVRELDSFAAALQPDG-LPCGLNRGASGIDGIISTAAGYGEGLG---------
MEND_CHLPM      LFLSNSMPVRAMDSYAHTGKENP-IKTGTNRGASGIDGIISTAAGFAEGHG---------
MEND_CHLCH      LFVSNSMAVRDMDMYAASLHEAG-IPTAINRGASGIDGILSTAAGFACGHG---------
MEND_CHLPD      LFMSNSMPVRDMDLFAAATRQTPTISIAMNRGASGIDGILSTAAGFAEGLQ---------
MEND_CHLTE      LFVANSMPARDMDLYAAPVAQKP-LQVALNRGVSGIDGIISTAAGFSAGLG---------
MEND_RUBXD      LVAASSMPVRDLDTFADP--EGPPVPVAANRGASGIDGTVATAAGFARGAG---------
MEND_SALRD      LVAASSMPVRDLNRHAAP--GGTGGPAFANRGASGIDGTVATAAGIAEGRD---------
MEND_SYNAS      LFLGNSLVIRAFDKFRSPFPRKI--SVISNRGVSGIEGNIATSVGFAEASR---------
MEND_DECAR      LFVGNSLAIRQMDTHSGSAD--KTLRIYANRGASGIDGNISTAAGIAASRG---------
MEND_PAEAT      LVLGSSNGIRDVDLAGQPHPEPI-ATVYANRGLAGIDGTIATATGIALGS----------
MEND_ARTS2      LMLGSSNGIRDVDLAGQPAPEPH-ATIFANRGLAGIDGTISTATGIAWGG----------
MEND_RENSM      LVIGSSNPIRDADLAGRPRSES--PRVHANRGLAGIDGTISTATGIALAT----------
MEND_CLAM3      LVLGASRLIREADRALPGKRV----RVHANRGLAGIDGTISTGLGIALASQAGS----GS
MEND_CLAMS      LVLGASRLIREADRALPGKRV----RVHANRGLAGIDGTISTGLGIALASQAGS----GS
MEND_LEIXX      LVLGASRLIRDADRIVPGKRL----RVHSNRGLAGIDGTIATAIGVALASQAVAVE--TG
MEND_KINRD      LVVAASNAIRDVDLTARPLGV----RTVSNRGLAGIDGTTATAEGVALA-----------
MEND_NOCSJ      LVVGASSPIRDLDLMVPRYDVGARRKVVANRGLAGIDGTISTAVGAALGR----------
MEND_CUTAK      LVIGASEVIRCFDRFAVPGDIAP--TALANRGLAGIDGTIATAIGVGLGT----------
MEND_COREF      VFCAASNPIRDLSIVGLPFAG---VDVHSPRGTAGIDGSVSQAIGTALAIQARHPDE---
MEND_CORGB      LFATASNPIRDLSLVGMPFDG---VDTFSPRGVAGIDGSVAQAIGTALAVQSRHPDE---
MEND_CORDI      LFLGASNPVRDASLVGMPLGG---VDIFAARGAAGIDGTVSQAVGVALDVQHRDATA---
MEND_CORJK      LVLGASTAVRDASRAGLPFDG---VQAIANRGAAGIDGTISTAVGAAMAHAHADPTA---
MEND_MYCA1      LVLGASNPVRDAALVGLDSHH---IRVRSNRGVAGIDGTVSTAIGAALAHEAAHDG----
MEND_MYCPA      LVLGASNPVRDAALVGLDSHH---IRVRSNRGVAGIDGTVSTAIGAALAHEAAHDG----
MEND_MYCBO      LVLGASNPVRDVALAGLDTRG---IRVRSNRGVAGIDGTVSTAIGAALAYEGAHERTGSP
MEND_MYCBP      LVLGASNPVRDVALAGLDTRG---IRVRSNRGVAGIDGTVSTAIGAALAYEGAHERTGSP
MEND_MYCTA      LVLGASNPVRDVALAGLDTRG---IRVRSNRGVAGIDGTVSTAIGAALAYEGAHERTGSP
MEND_MYCTU      LVLGASNPVRDVALAGLDTRG---IRVRSNRGVAGIDGTVSTAIGAALAYEGAHERTGSP
MEND_MYCUA      LVLGASNPVRDAALVGLDTAG---LRVRSNRGVAGIDGTVSTAIGAALGYERDHHG----
MEND_MYCLE      LVLGASNPVRDMALVGLSTDG---IQVRSNRGVAGIDGTVSTAIGAALAYERSPGYAGST
MEND_MYCGI      LVLGASNPVRDIALVGFNTAD---VKVRSNRGVAGIDGTVSTAIGAALAHERATGG----
MEND_MYCVP      LVLGASNPVRDIALVGFHTAD---VKVRSNRGVAGIDGTVSTAIGAALAHER-SGG----
MEND_MYCSK      LVLGASNPVRDAALVGFTPHG---VQVRSNRGVAGIDGTVSTAIGAALAHDR-TGG----
MEND_MYCSS      LVLGASNPVRDAALVGFTPHG---VQVRSNRGVAGIDGTVSTAIGAALAHDR-TGG----
MEND_MYCSJ      LVLGASNPVRDAALVGFTPHG---VQVRSNRGVAGIDGTVSTAIGAALAHDR-TGG----
MEND_MYCS2      LVLGASNPVRDAALVGLRPDG---IKVRSNRGVAGIDGTISTAIGAALAHDG--------
MEND_NOCFA      LLLGASNPVRDAALVATPRPG---VRVLSNRGVAGIDGTVSTAVGAALAHP---------
MEND_RHOJR      LLLGASNPVRDAALVSYPAPK---IRVLSNRGVAGIDGTVSAAVGAALAYEE--------
MEND_SACEN      LVLGSSNPTRDVALAANHRPD---VVVHRNRGVAGIDGTVSAAIGSALAHGG--------
MEND_THEFY      LFAGASMPIRDLDAVMRPRCG---LRLIGNRGVSGIDGTVSTAVGAALAHQADGGG----
MEND_HALMA      LFISNSMPIRDMDRFGGPRDAD--LTVLGNRGASGIDGITSTALGAGSA-----------
MEND_NATPD      VFVSNSMPVRDLDRFGAPQAAS--LSVLGNRGASGIDGIASTALGAGFG-----------
MEND_HALS3      VFVSNSMPIRDFDRFAAPRGAD--LAVLGNRGASGIDGVVSSALGAGSA-----------
MEND_HALSA      VFVSNSMPIRDFDRFAAPRGAD--LAVLGNRGASGIDGVVSSALGAGSA-----------
MEND_HALWD      IFVSNSMPVRDLDRFGSPTTQN--RTVLGNRGASGIDGIISTALGAGSAL----------
MEND_ROSCS      LFVGNSLPVRHLDQFGKPGVRH--ICAFANRGASGIDGNISTALGIGAG-----------
MEND_ROSS1      LFVGNSLPVRHLDQFGKPGARR--IHAFANRGASGIDGNISTALGVGAG-----------
MEND_CHLAA      LFVGNSMPVRDCDTFLGPRTNP--LYVVGNRGANGIDGLVSTALGLAAG-----------
MEND_MYXXD      LFVSSSMPIRDLDAFAPAGTVP--LRVLANRGANGIDGIVSSALGMAAA-----------
MEND_SORC5      LAIGNSMPVRDLDTYCPPSARA--LRVLHQRGASGIDGLVSAAAGARVA-----------
MEND_BACSU      LFVGNSMPIRDVDTFFEKQD--RPFRIYSNRGANGIDGVVSSAMGVCEGTKA--------
MEND_BACVZ      IFVGNSMPIRDVDTFFEKQD--RSFRVYANRGANGIDGVVSSAMGLCEGTKA--------
MEND_BACLD      VFVGNSMPIRDADTFFENQE--RTFRIFANRGANGIDGVVSTALGIYAATKE--------
MEND_BACP2      LFIGNSMPIRDVDTFFEAQS--KPFRMMANRGANGIDGVVSTALGTYAALKQ--------
MEND_BACAH      LFASNSMPIRDTDSFFFTSD--KNIQVMANRGVNGIDGIISTALGASMICD---------
MEND_BACHK      LFASNSMPIRDTDSFFFTSD--KTIQVMANRGVNGIDGIISTALGASMICD---------
MEND_BACAN      LFASNSMPIRDTDSFFFTSD--KNIQVMANRGVNGIDGIISTALGASMICD---------
MEND_BACCZ      LFASNSMPIRDTDSFFFTSD--KNIQVMANRGVNGIDGIISTALGASIICD---------
MEND_BACC1      LFASNSMPIRDTDSFFFTSD--KNIQVMANRGVNGIDGIISTALGASMICD---------
MEND_BACCR      LFASNSMPIRDTDSFFFTSD--KNIHVMANRGVNGIDGIISTALGASVICD---------
MEND_BACCN      LFVSNSMPIRDADTFLFTNE--KKIHVMANRGVNGIDGIISTALGASTVCE---------
MEND_GEOKA      LFVGNSMPIRDADTFLFATD--KPLRVLANRGANGIDGVVSSALGASVAAN---------
MEND_GEOTN      LFVGNSMPIRDADTFLFATD--KPLRVLANRGANGIDGVVSSALGASLAAS---------
MEND_OCEIH      LYVGNSMAIRDVDTFYMTSP--KTINILANRGANGIDGMVSSGVGASADNE---------
MEND_LISMF      LFIGNSMPIRDVDTYFSQID--KKIKMLANRGANGIDGVVSSALGASVVFQ---------
MEND_LISMO      LFIGNSMPIRDVDTYFSQID--KKIKMLANRGANGIDGVVSSALGASVVFQ---------
MEND_LISIN      LFIGNSMPIRDVDTYFSQID--KKIKMLANRGANGIDGVVSSALGASVVFQ---------
MEND_LISW6      LFIGNSMPIRDVDTYFSQID--KKIKMLANRGANGIDGVVSSALGASVVFQ---------
MEND_ENTFA      LFVSNSMAIRYLDRFMDS----RPYRMFGNRGINGIDGIVSTALGMSAIAPT--------
MEND_LACLM      LLVSNSMEIRDIDYWWKKED--SKVRILGNRGVNGIDGTESTALGIATTGK---------
MEND_LACLS      LLVSNSMEIRDIDYWWEKED--SKVRILGNRGVNGIDGTESTALGIATTGK---------
MEND_LACLA      LLVSNSMEIRDIDYWWKKAD--AKVRILGNRGVNGIDGTESTALGIATTGK---------
MEND_DESHY      LFVANSMAIRDVDYFLEARR--QRIKVLGNRGANGIDGTVSTALGVATSGH---------
MEND_LEUCK      VFVANSMAIRDMDDVFSGR---TTQKIYANRGVNGIDGVVSTALGMSTVSS---------
MEND_LEUMM      IFVANSMPIRDMDNFFTGN---HTQRIYANRGANGIDGVISSALGMSAVVK---------
MEND_STAA1      LFISNSMPIRDVDNLLLNK---NID-VYANRGANGIDGIVSTALGMAVH-----------
MEND_STAA9      LFISNSMPIRDVDNLLLNK---NID-VYANRGANGIDGIVSTALGMAVH-----------
MEND_STAAN      LFISNSMPIRDVDNLLLNK---NID-VYANRGANGIDGIVSTALGMAVH-----------
MEND_STAA2      LFISNSMPIRDVDNLLLNK---NID-VYANRGANGIDGIVSTALGMAVH-----------
MEND_STAAM      LFISNSMPIRDVDNLLLNK---NID-VYANRGANGIDGIVSTALGMAVH-----------
MEND_STAAS      LFISNSMPIRDVDNLLLNK---NID-VYANRGANGIDGIVSTALGMAVH-----------
MEND_STAAW      LFISNSMPIRDVDNLLLNK---NID-VYANRGANGIDGIVSTALGMAVH-----------
MEND_STAA3      LFISNSMPIRDVDNLLLNK---NID-VYANRGANGIDGIVSTALGMAVH-----------
MEND_STAAE      LFISNSMPIRDVDNLLLNK---NID-VYANRGANGIDGIVSTALGMAVH-----------
MEND_STAA8      LFISNSMPIRDVDNLLLNK---NID-VYANRGANGIDGIVSTALGMAVH-----------
MEND_STAAC      LFISNSMPIRDVDNLLLNK---NID-VYANRGANGIDGIVSTALGMAVH-----------
MEND_STAAT      LFISNSMPIRDVDNLLLNK---NID-VYANRGANGIDGIVSTALGMAVH-----------
MEND_STAAB      LFISNSMPIRDVDNLLLNK---NID-VYANRGANGIDGIVSTALGMAVH-----------
MEND_STAAR      LFISNSMPIRDVDNLLLNK---NID-VYANRGANGIDGIVSTALGMAVH-----------
MEND_STAEQ      LFVGNSMPIRDVDNLLFDS---EAS-VYANRGANGIDGVVSTALGMAAH-----------
MEND_STAES      LFVGNSMPIRDVDNLLFDS---EAS-VYANRGANGIDGVVSTALGMAAH-----------
MEND_STAHJ      IFVSNSMPVRDIDNLLYNS---EVE-VYANRGANGIDGVVSTAIGMAVH-----------
MEND_STAS1      IFVSNSMPIRDVDNLFIDC---EAE-VFANRGANGIDGVTSTALGMAVH-----------
MEND_BACFN      LHLANSSAVRYAQLYSL--P--DTVEVCCNRGTSGIEGSLSTAIGYAAASK---------
MEND_BACFR      LHLANSSAVRYAQLYSL--P--DTVEVCCNRGTSGIEGSLSTAIGYAAASK---------
MEND_BACTN      LHLANSSVIRYAQLYQV--P--STIEVCCNRGTSGIEGSLSTAVGYAAGSD---------
MEND_BACV8      LHLANSSTVRYAQLFTV--P--PQVEICCNRGVNGIEGSLSTAIGYAAASS---------
MEND_PARD8      LHLGNSSTVRYAQLYTV--P--ETVEVCCNRGTSGIEGSLSTAIGYASASQ---------
MEND_FLAJ1      LQISNSSAIRYAQLIEI--D--PSIEVFCNRGTSGIDGSTSTAVGAAVGSG---------
MEND_FLAPJ      LQISNSSAIRYAQLFSI--H--SSIEVFCNRGTSGIDGSTSTAIGAAIASG---------
MEND_GRAFK      LHFGNSSTIRYAQLFEW--D--KSLKIYCNRGTSGIDGSVSTAVGASVSSE---------
MEND_PORGI      LHAANSTPVRYLQLFEHA-H--YAGGEWSNRGTNGIEGATSTAMGFSEVYS---------
MEND_CYTH3      LHLANSMSVRYANTLGIS-Q--RNAEVFANRGTSGIDGVISTAYGYALKTS---------
MEND_DESPS      AHLGNSMSVRHAQKLAS--R--ADLLYHSNRGVAGIDGCLSTAVGVALATD---------
MEND_NOSS1      LFIANSMPVRDVEFFWKPNNL--RVRSHFNRGANGIDGTLSTALGISH------------
MEND_TRIV2      LFIANSMPVRDVEFFWKPNNL--RVRSHFNRGANGIDGTLSTALGIAH------------
MEND_TRIEI      IFVANSMPVRDVEFFWVPNNS--QIQPFFNRGVNGIDGTLSTALGIAH------------
MEND_MICAN      IFISNSMPVRYAEFFNPPSDR--QIRPYFNRGANGIDGNLSTAIGIAY------------
MEND_ACAM1      LFIANSMPVRDIEYFWQPGTL--HIQPYFNRGANGIDGTLSTALGMSH------------
MEND_SYNJA      LFIANSTPVRDVEWFWPPNDR--RIRPYFNRGTNGIDGILSTAFGVAY------------
MEND_SYNJB      LFIANSTPVRDVEWFWPPNDR--RIRPYFNRGTNGIDGILSTALGVAHGS----------
MEND_SYNP6      IFVANSTPIRDLEWFWLANDQ--RRSLYCSRGANGIDGTLSTAIGIAH------------
MEND_SYNE7      IFVANSTPIRDLEWFWLANDQ--RRSLYCSRGANGIDGTLSTAIGIAH------------
MEND_THEEB      IFVASSMPVRDVESVWQGSDR--RHRFYFNRGANGIDGTLSTALGVAH------------
MEND_SYNY3      LFVANSLPVRWLEFFWPANGD--HHRIFVNRGANGIDGTLSTAMGIAHR-----------
MEND_BDEBA      VYLGNSLPIREWDSSSSHDFP--PARVAANRGANGIDGQISTFLGWAH------------
MEND_PARUW      IYVGNSLPIREWDQAADWTNK--HFQVFANRGANGIEGQLSTFLGLAS------------
MEND_PROM0      IMLSASSPIRDWLTFSENGTL--TRNCFSFRGASGIDGTLSLALGISR------------
MEND_PROM2      IMLSASSPIRDWLTFSENGTL--TRNCFSFRGASGIDGTLSLAVGIAR------------
MEND_PROM9      IMLSASSPIRDWLTFSENGTL--TRNCFSFRGASGIDGTLSLALGISR------------
MEND_PROMS      IMLSASSPIRDWLTFSENGTL--TRNCFSFRGASGIDGTLSLALGISR------------
MEND_PROM5      IMLSASSPIRDWLTFSENGTL--TRKCFSFRGASGIDGTLSLALGIAR------------
MEND_PROMP      IMLSASSPIRDWLTFSENATL--TRECFSFRGASGIDGTLSLALGIAR------------
MEND_PROM1      VMIASSSPIRDWLSYSGEGAF--LRRCFGFRGASGIDGTLSMGMGLSI------------
MEND_PROMT      VMIASSSPIRDWLSYSGEGAF--LRRCFGFRGASGIDGTLSMGMGLSI------------
MEND_PROMA      IMLSASSPVRDFLAYSGFSPF--KRRLYSFRGASGIDGNLSLAIGLSI------------
MEND_PROM3      IMLAASSPVRDWLAYADKSLF--SRRCFSFRGASGIDGTLSLSMGLAM------------
MEND_PROMM      IMLAASSPVRDWLAYADKSLF--SRRCFSFRGASGIDGTLSLSMGLAM------------
MEND_SYNPW      VMLAASSPVRDWQAFAAADAG--QRRCFSFRGASGIDGTLSLAVGLSR------------
MEND_SYNS3      VMLAASSPVRDWQAFAASDTG--RRRCYSFRGASGIDGTLSLALGIAA------------
MEND_SYNPX      VMLAASSPVRDWLIWGGLQAQ--NRRCFSFRGASGIDGTLSLAMGLAM------------
MEND_SYNSC      VMLAASSPVRDWLTWGGYSCG--RHRCFSFRGASGIDGTLSLAMGLAA------------
MEND_SYNS9      VMLSASSPVRDWLTWSGRSGS--DRRCFSFRGASGIDGTLSLAMGLAL------------
MEND_SYNR3      VMLASSSPVRDWESFAGRQSG--HRTIVSFRGASGIDGTLSLAAGIAQ------------
                     *   *                    **  **:*  :   *               

MEND_ECOLI      ---KPTLAIVGDLSALYDLNALALLRQVS----APLVLIVVNNNGGQIFSLLPTP---QS
MEND_ECOHS      ---KPTLAIVGDLSALYDLNALALLRQVS----APLVLIVVNNNGGQIFSLLPTP---QS
MEND_ECOLC      ---KPTLAIVGDLSALYDLNALALLRQVS----APLVLIVVNNNGGQIFSLLPTP---QS
MEND_SHIF8      ---KPTLAIVGDLSALYDLNALALLRQVS----APLVLIVVNNNGGQIFSLLPTP---QS
MEND_SHIFL      ---KPTLAIVGDLSALYDLNALALLRQVS----APLVLIVVNNNGGQIFSLLPTP---QS
MEND_ECO24      ---KPTLAIVGDLSALYDLNALALLRQVS----APLVLIVVNNNGGQIFSLLPTP---QS
MEND_SHIBS      ---KPTLAIVGDLSALYDLNALALLRQVS----APLVLIVVNNNGGQIFSLLPTP---QS
MEND_ECO57      ---KPTLAIVGDLSALYDLNALALLRQVS----APLVLIVVNNNGGQIFSLLPTP---KS
MEND_SHISS      ---KPTLAIVGDLSALYDLNALALLRQVS----APLILIVVNNNGGQIFSLLPTP---KS
MEND_ECOK1      ---KPTLAIVGDLSALYDLNALALLRQVS----APLVLIVVNNNGGQIFSLLPTP---KS
MEND_ECOL6      ---KPTLAIVGDLSALYDLNALALLRQVS----APLVLIVVNNNGGQIFSLLPTP---KS
MEND_ECOL5      ---KPTLAIVGDLSALYDLNALALLRQVS----APLVLIVVNNNGGQIFSLLPTP---KS
MEND_ECOUT      ---KPTLAIVGDLSALYDLNALALLRQVS----APLVLIVVNNNGGQIFSLLPTP---KS
MEND_ECOSM      ---KPTLAIVGDLSALYDLNALALLRQVS----APLVLIVVNNNGGQIFSLLPTP---KN
MEND_SHIDS      ---KPTLAIVGDLSALYDLNALALLRQVS----APLVLIVVNNNGGQIFSLLPTP---KS
MEND_SALCH      ---KSTLAIVGDLSALYDLNALALLRQVS----APFVLIVVNNNGGQIFSLLPTP---QS
MEND_SALTY      ---KSTLAIVGDLSALYDLNALALLRQVS----APFVLIVVNNNGGQIFSLLPTP---QS
MEND_SALPA      ---KSTLAIVGDLSALYDLNALALLRQVS----APFVLIVVNNNGGQIFSLLPTP---QS
MEND_SALPB      ---KSTLAIVGDLSALYDLNALALLRQVS----APFVLIVVNNNGGQIFSLLPTP---QS
MEND_SALTI      ---KSTLAIVGDLSALYDLNALALLRQVS----APFVLIVVNNNGGQIFSLLPTP---QS
MEND_SALAR      ---KSTLAIVGDLSALYDLNALALLRQVS----APFVLIVVNNNGGQIFSLLPTP---QS
MEND_CITK8      ---KSTLAIVGDLSALYDLNALALLRQVS----APFVLIVVNNNGGQIFSLLPTP---QS
MEND_KLEP7      ---RPTLAIVGDLSALYDLNSLALLRQAS----APLVLIVVNNNGGQIFSMLPTP---QD
MEND_ENT38      ---KPTLAIVGDLSALYDLNALALLRQAS----APFVLIVVNNNGGQIFSLLPTP---QS
MEND_YERPA      ---KPTLAIVGDLSALYDLNALALLRQSS----APMVLLVINNNGGQIFSLLPTP---EA
MEND_YERPE      ---KPTLAIVGDLSALYDLNALALLRQSS----APMVLLVINNNGGQIFSLLPTP---EA
MEND_YERPN      ---KPTLAIVGDLSALYDLNALALLRQSS----APMVLLVINNNGGQIFSLLPTP---EA
MEND_YERPP      ---KPTLAIVGDLSALYDLNALALLRQSS----APMVLLVINNNGGQIFSLLPTP---EA
MEND_YERPS      ---KPTLAIVGDLSALYDLNALALLRQSS----APMVLLVINNNGGQIFSLLPTP---EA
MEND_YERE8      ---KPTLAIVGDLSALYDLNALALLRQSS----APTVLLVVNNNGGQIFSLLPTP---EA
MEND_SERP5      ---KPTLAVVGDLSALYDLNALALLRQCS----APTVLIVVNNNGGQIFSLLPTP---EE
MEND_PECAS      ---KATLGIVGDLSALYDLNALALLRQSP----APLVLIVVNNNGGQIFSLLPTP---VA
MEND_PHOLL      ---KPTLAVIGDLSALYDLNSLALLRHPS----APMVLIVVNNNGGQIFSLLPTQ---EE
MEND_CROS8      ---KPTLAVLGDLSTLYDLNALALLRDAP----APFVLIVVNNNGGQIFSMLPTP---AR
MEND_HAEI8      ---KPVVAVIGDTSTLYDLNSFALFKNVT----QPTLIFVINNNGGAIFDMLPVD---EQ
MEND_HAEIG      ---KPVVAVIGDTSTLYDLNSFALFKNVT----QPTLIFVINNNGGAIFDMLPVD---EQ
MEND_HAEIN      ---KPVVAVIGDTSTLYDLNSFALFKNVT----QPTLIFVINNNGGAIFDMLPVD---EQ
MEND_HAEIE      ---KPVVAVIGDTSTLYDLNSFALFKNVT----QPTVIFVINNNGGAIFDMLPVD---EQ
MEND_PASMU      ---QPLVAMIGDVSALYDINSLALFKKVT----QPTIIFVINNNGGAIFDMLPVE---AD
MEND_MANSM      ---QPVVAMIGDVSALYDLNSLALFKNVN----QPTIIFLINNNGGAIFDMLPVE---SS
MEND_ACTSZ      ---QAVAAVVGDMSALYDLNSLALLKKVT----QPFVLFVINNNGGAIFDMLPVE---AE
MEND_HAES1      ---QTLVAMIGDTSTLYDLNSFALFKQLN----QPAIIFVINNNGGAIFDMLPVD---IA
MEND_HISS2      ---QTLVAMIGDTSTLYDLNSFALFKQLN----QPAIIFVINNNGGAIFDMLPVD---IA
MEND_ACTP2      ---QPTVGVIGDISALHDLNSVSLLNKIS----HPCILFVINNSGGAIFDMLPVE---AQ
MEND_ACTPJ      ---QPTVGIIGDISALHDLNSVSLLNKIS----HPCILFVINNSGGAIFDMLPVE---AQ
MEND_HAEDU      ---QPTVGVVGDISALHDLNSISLLSKIN----HPSILFVINNSGGAIFDMLPVE---AR
MEND_PHOPR      ---APMVGLLGDTSLLYDLNSLALLRDVS----QPVVIIVTNNDGGGIFDLLPVP---AL
MEND_ALIF1      ---KPLLALVGDTSLLYDLNSLALLKQAT----QPMVVVVMNNDGGGIFDLLPVN---EK
MEND_VIBC3      ---KPLLMLLGDTSLLYDLNSLALMRNPA----QPTVIVVTNNDGGAIFDLLPVP---SE
MEND_VIBCH      ---KPLLMLLGDTSLLYDLNSLALMRNPA----QPTVIVVTNNDGGAIFDLLPVP---SE
MEND_VIBCB      ---NPMLMFIGDTSALYGLNSLALFTHSE----LPSVLVIANNDGGAIFDLLPVP---QE
MEND_VIBPA      ---KPLLMYIGDTSALYDLNSLALFSRND----LPSVLVVTNNDGGAIFDMLPVP---QE
MEND_VIBVU      ---NPMLLMIGDTSALYDLNSLALYSHQE----TPVVIVVTNNDGGAIFDLLPVP---PQ
MEND_VIBVY      ---NPMLLMIGDTSALYDLNSLALYSHQE----TPVVIVVTNNDGGAIFDLLPVP---PQ
MEND_AERHH      GSNEPTTLLLGDLSALHDLNSLALLGKSS----RPLVVILLNNDGGSIFRMLPVPT-QDA
MEND_AERS4      ---QPTTLLIGDLSALHDLNSLALLGKSS----RPLVVILLNNDGGSIFRMLPVPT-GDR
MEND_PSYIN      ---SITTLLIGDTSFLHDLNSLALLKQLQ----GPFVIIVFNNDGGAIFNLLPVPT-QQK
MEND_SHEB5      ---KPTSLIIGDLSQLHDLNSLAIAKGLS----SPLVIVILNNDGGNIFNLLPVP--NEQ
MEND_SHEB9      ---KATSLIIGDLSQLHDLNSLAIAKGLT----SPLVIVILNNDGGNIFNLLPVP--NEQ
MEND_SHEB8      ---KPTSLIIGDLSQLHDLNSLAIAKGLS----SPLVIVILNNDGGNIFNLLPVP--NEQ
MEND_SHEPC      ---KPTSLIIGDLSQLHDLNSLAIAKSLA----SPLVIVILNNDGGNIFNLLPVP--NEQ
MEND_SHESW      ---KPTSLIIGDLSQLHDLNSLAIAKSLA----SPLVIVILNNDGGNIFNLLPVP--NEQ
MEND_SHESA      ---KPTSLIIGDLSQLHDLNSFAIARSLT----SPLVIIILNNDGGNIFNLLPVP--NEE
MEND_SHESM      ---KPTSLIIGDLSQLHDLNSFAIARSLT----SPLVIIILNNDGGNIFNLLPVP--NEE
MEND_SHESR      ---KPTSLIIGDLSQLHDLNSFTIARSLT----SPLVIIILNNDGGNIFNLLPVP--NEE
MEND_SHEON      ---KPTSLIIGDLSQLHDLNSFAIARSLT----SPLVIIILNNDGGNIFNLLPVP--NEE
MEND_SHEHH      ---KPTTLIIGDISALHDLNSLAIARTVT----SPFVIVILNNDGGNIFNLLPVP--NEQ
MEND_SHEPA      ---KPTSLIIGDISALHDLNSLAIARSVT----SPLVIVILNNDGGNIFNLLPVP--NEQ
MEND_SHESH      ---KATTLLIGDISQLHDLNSLAIARTIE----SPFVIVILNNDGGNIFNLLPVP--DEK
MEND_SHEWM      ---RATTLIIGDISQLHDLNSLAIASHCS----SPLVIVILNNDGGNIFNLLPVP--DEK
MEND_SHELP      ---SSTTLVIGDLSQLHDLNSLALAAKQQ----GTLVIVILNNDGGNIFNLLPVP--DEK
MEND_SHEAM      ---RPTTLILGDLSALHDLNSLALARDCQ----SPLVIVVLNNDGGNIFNLLPVP--TEE
MEND_SHEFN      ---APTTLVMGDLSCLHDFNSLALLKQMT----QPFVLVIINNDGGNIFNLLPVP--NES
MEND_HALHL      ---DGVTLVIGDLSALHDLNSLALLDQAR----HTCVVVVLNNDGGGIFDLLPARSEGDD
MEND_PELLD      ---RKVTLLIGDIAFLHDLNALSLLRSLS----RPMRIVLLNNNGGGIFSFLPVAS-CND
MEND_CHLPM      ---QPLCLMIGDLAFLHDLNALSLINSLR----VPIQLILLNNNGGGIFSFLPVSE-FDD
MEND_CHLCH      ---KSTTLLIGDIAFLHDLNALSLLGSLT----VPLQIVLLNNNGGGIFSFLPIAA-CDD
MEND_CHLPD      ---KPVTLVIGDIAFLHDLNALSLLESSS----VPLRIIVVNNNGGGIFSFLPIAA-EKD
MEND_CHLTE      ---KPTTLLIGDISFLHDLNALCLLNHPW----NPLIVIVLNNHGGSIFSFLPIAS-QTD
MEND_RUBXD      ---RPVTLLIGDLALLHDLNSLAMLRGL------PAVVVVLNNDGGGIFHFLPVAE-HGG
MEND_SALRD      ---GPVTLLIGDLALQHDLNGLALLQDR------PVVAIVVNNDGGGIFHFLPIRK-HDE
MEND_SYNAS      ---RRVTAVIGDISFLHDLNSLLLLAQSA----TPVVLIIINNGGGRIFERLPIRD-FPE
MEND_DECAR      ----RAVALIGDLTCQHDLGGLALAQGQN------IVIIVVNNGGGGIFDHLPQRD--LP
MEND_PAEAT      --GRETTVLLGDVTFLHDAGGLLLGHGEP--VP-DLRIVVLNDSGGAIFSLLEHGAVEDS
MEND_ARTS2      --RQETTLLLGDVTFLHDAGGLLLGFAEN--DP-LLRIVVLNDAGGAIFNLLEHGAVQES
MEND_RENSM      --ARPTRLLVGDLTFLHDVGGLLLPRGEQ--VP-DLQIVVLNDSGGGIFTLLEHGTLGDE
MEND_CLAM3      AAAGITRVLVGDLTLLHDVGSLLIGTGER--VP-RIQVIVGNDGGGTIFDGLEVANTAA-
MEND_CLAMS      AAAGITRVLVGDLTLLHDVGSLLIGTGER--VP-RIQVIVGNDGGGTIFDGLEVSRTAA-
MEND_LEIXX      TLPGITRVLLGDLALLHDAGALLGGSGEA--WP-NVQVIVGNDGGGTIFDGLEVATIAS-
MEND_KINRD      --TGPTRLLLGDLAFLHDANALLPVPGEV--RP-DLTVVVVNDDGGGIFETLEHASAVD-
MEND_NOCSJ      PRSTRALTLMGDVTFLHDAGALVIGPGEA--VP-DLTIVVVNDDGGSIFAMLEQGAAEY-
MEND_CUTAK      --GRPVRVVVGDLTFAHDAMSLLLGETEP--EP-DVQVVVLDDRGGAIFSGLEHAAAP--
MEND_COREF      IRAPRTVALLGDLAFIHDAGGLLIGPDEP--RPENLTIVVANDNGGGIFELLETGAPGLR
MEND_CORGB      IRAPRTVALLGDLSFLHDIGGLLIGPDEP--RPENLTIVVANDNGGGIFELLETGADGLR
MEND_CORDI      IRADRTVALMGDVTFLHDVGGLLGA------RPENLTIVVANDDGCGIFETLEIGAPEFR
MEND_CORJK      IRAPRTIAVMGDLTFAHDLGGLNIGPLEP--RPDNLLIVLTNDSGGGIFETLEPGAENLR
MEND_MYCA1      ----RTVALIGDLTFVHDSSGLLIGPTEP--TPRRLTIVVSNDNGGGIFELLEQGDPRFS
MEND_MYCPA      ----RTVALIGDLTFVHDSSGLLIGPTEP--TPRRLTIVVSNDNGGGIFELLEQGDPRFS
MEND_MYCBO      DSPPRTIALIGDLTFVHDSSGLLIGPTEP--IPRSLTIVVSNDNGGGIFELLEQGDPRFS
MEND_MYCBP      DSPPRTIALIGDLTFVHDSSGLLIGPTEP--IPRSLTIVVSNDNGGGIFELLEQGDPRFS
MEND_MYCTA      DSPPRTIALIGDLTFVHDSSGLLIGPTEP--IPRSLTIVVSNDNGGGIFELLEQGDPRFS
MEND_MYCTU      DSPPRTIALIGDLTFVHDSSGLLIGPTEP--IPRSLTIVVSNDNGGGIFELLEQGDPRFS
MEND_MYCUA      ----RTVALIGDLTFVHDSSGLLIGPTEP--TPRQLTIVVSNDNGGGIFELLEQGDPRFS
MEND_MYCLE      DRPARTVALIGDLAFVHDSSGLLIGPTEP--TPQQLKIVVSNDNGGGIFELLEQGDPRLS
MEND_MYCGI      ----RTVALIGDLTFVHDSSGLLVGPTEP--TPRKLTIVVSNDNGGGIFELLEQGDPRFS
MEND_MYCVP      ----RTVALIGDLTFVHDSSGLLIGPTEP--TPRKLTIVVSNDNGGGIFELLEQGDPRFS
MEND_MYCSK      ----RTIALMGDLTFVHDSSGLLIGPTEP--TPRNLTIVVSNDNGGGIFELLEQGDPRFS
MEND_MYCSS      ----RTIALMGDLTFVHDSSGLLIGPTEP--TPRNLTIVVSNDNGGGIFELLEQGDPRFS
MEND_MYCSJ      ----RTIALMGDLTFVHDSSGLLIGPTEP--TPRNLTIVVSNDNGGGIFELLEQGDPRFS
MEND_MYCS2      ----RTVALIGDLTFVHDSSGLLIGPTEP--TPRSLTIVVSNDNGGGIFELLEQGDPRFS
MEND_NOCFA      ---GRTIALIGDLTFLHDAAGLLIGRGEP--RPADLTIVVANDDGGGIFELLEQGDPQYA
MEND_RHOJR      ---GRTVALLGDLTFLHDASGLLIGSGEP--RPRDLTIVVANDDGGGIFELLEQGDPQYA
MEND_SACEN      ----PSYALLGDLTFLHDSNGLMLGPQEQ--RP-DLTIVVLNDDGGGIFSLLEQGSPEHR
MEND_THEFY      ----EAFALLGDLALLHDQNGLLLGPDEP--RP-NLTIVVVNNDGGGIFSELEQAGHPD-
MEND_HALMA      -TSDPLVLVTGDLAYYHDMNGLLALGRC----AVDATVVLLNNDGGGIFHMLP--IED--
MEND_NATPD      -TDDPLVAVTGDLAYYHDMNGLLAVSRA----GVDATIVCINNDGGGIFHVLP--IEA--
MEND_HALS3      -TADPVVGLVGDLAYFHDSNGLLALERC----GVDATIVLVNNDGGSIFHMLP--IEQF-
MEND_HALSA      -TADPVVGLVGDLAYFHDSNGLLALERC----GVDATIVLVNNDGGSIFHMLP--IEQF-
MEND_HALWD      ATTEHLIAITGDLAYYHDMNGLAALERC----DVTATIVLINNDGGGIFHKLP--IESY-
MEND_ROSCS      RPDAPLAAIVGDITFYHDMNGLLAVRRC----GVPATIVLLNNDGGGIFHRLP--INRF-
MEND_ROSS1      RPDTPMAAIVGDITFYHDMNGLLAVRRC----GVPITIVLLNNDGGGIFHRLP--INRF-
MEND_CHLAA      -QARPLVMALGDLSLLHDSNGLLAARLH----RLDATILLINNDGGGIFSFLP--QASE-
MEND_MYXXD      -AGRSAVLLTGDLALLHDVGAFVTASRT----RVPLTVVAVNNDGGGIFSFLPIAQVAP-
MEND_SORC5      -AAAPVTLLLGDLSLLHDLTGLLLAAKATGDGRAPLVIVVVQNDGGRIFEHLPIARRGA-
MEND_BACSU      ----PVTLVIGDLSFYHDLNGLLAAKKLGI----PLTVILVNNDGGGIFSFLPQASE-KT
MEND_BACVZ      ----PVTLVIGDLSFYHDLNGLLAAKKLGI----PLTVILINNDGGGIFSFLPQASD-KT
MEND_BACLD      ----PVTLVIGDLSFYHDLNGLLVSKTLDI----PLTVVLVNNDGGGIFSFLPQSAE-ER
MEND_BACP2      ----PVTLVIGDLSFYHDMNGLLAAKLMDI----PLTVVLLNNDGGGIFSFLPQASE-EP
MEND_BACAH      ----PLVLVIGDLSFYHDLNGLLAAKLHEL----NITIVVVNNDGGGIFSFLPQYEK-KE
MEND_BACHK      ----PLVLVIGDLSFYHDLNGLLAAKLHEL----NITIVVVNNDGGGIFSFLPQYEK-KE
MEND_BACAN      ----PLVLVIGDLSFYHDLNGLLAAKLHEL----NITIVVVNNDGGGIFSFLPQYEK-KE
MEND_BACCZ      ----PLVLVIGDLSFYHDLNGLLAAKLHEL----NITIVVVNNDGGGIFSFLPQYEK-KE
MEND_BACC1      ----PLVLVIGDLSFYHDLNGLLAAKLHEL----NITIVVVNNDGGGIFSFLPQYEK-KE
MEND_BACCR      ----PLVLVIGDLSFYHDLNGLLAAKLHEL----NITIVVVNNDGGGIFSFLPQYEK-KE
MEND_BACCN      ----PLVLVIGDLSFYHDLNGLLAAKLHDL----NITIVVVNNDGGGIFSFLPQYES-KE
MEND_GEOKA      ----PLVLVIGDLSFYHDLNGLLAAKMHSL----SATIVLLNNNGGGIFSFLPQARH-KG
MEND_GEOTN      ----PLVLVIGDLSFYHDLNGLLAAKMHGL----QATIVLMNNNGGGIFSFLPQARH-EG
MEND_OCEIH      ----RVTLLLGDLSLFHDMNGLFAAKHYKL----PITIVLINNNGGGIFSFLPQAKD-KR
MEND_LISMF      ----PMFLLIGDLSFYHDMNGLLMAKKYKM----NLTIVIVNNDGGGIFSFLPQANE-PK
MEND_LISMO      ----PMFLLIGDLSFYHDMNGLLMAKKYKM----NLTIVIVNNDGGGIFSFLPQANE-PK
MEND_LISIN      ----PMFLLIGDLSFYHDMNGLLMAKKYKM----NLTIIIVNNDGGGIFSFLPQANE-PK
MEND_LISW6      ----PMFLLIGDLSFYHDMNGLLMAKKYKM----NLTIIIVNNDGGGIFSFLPQAKE-PK
MEND_ENTFA      ---QQNVLLIGDLALYHDMNGLFLAKRYQL----PLTIVLLNNNGGGIFSFLSQRTLRED
MEND_LACLM      ----PTVLLTGDLSMLHDLNGLIIGKTHEL----NLTIVLFNNDGGGIFHHLAQKGV--P
MEND_LACLS      ----PTVLLTGDLSMLHDLNGLIIGKTHEL----NLTIVLFNNDGGGIFHHLAQKGV--P
MEND_LACLA      ----PTVLLTGDLSMLHDLNGLIVGKTHEL----NLTIVLFNNDGGGIFHHLAQKGV--P
MEND_DESHY      ----PTVLLTGDLAFFHDLNGLLIGKNHGL----NLIIVLLNNNGGAIFKYLPQSEN--K
MEND_LEUCK      ---QRSILLTGDLTLFHDMNGLMMAKKYQL----NIDIIVINNNGGSIFSFLPQ-SQADE
MEND_LEUMM      ---QRSVLLTGDLTLFHDMNGLMMAKNYQL----PLDIIVINNNGGGIFSFLPQ-AGAPK
MEND_STAA1      ---KRITLLIGDLSFYHDMNGLLMSKLNNI----QMNIVLLNNDGGGIFSYLPQKESATD
MEND_STAA9      ---KRITLLIGDLSFYHDMNGLLMSKLNNI----QMNIVLLNNDGGGIFSYLPQKESATD
MEND_STAAN      ---KRITLLIGDLSFYHDMNGLLMSKLNNI----QMNIVLLNNDGGGIFSYLPQKESATD
MEND_STAA2      ---KRITLLIGDLSFYHDMNGLLMSKLNNI----QMNIVLLNNDGGGIFSYLPQKESATD
MEND_STAAM      ---KRITLLIGDLSFYHDMNGLLMSKLNNI----QMNIVLLNNDGGGIFSYLPQKESATD
MEND_STAAS      ---KRITLLIGDLSFYHDMNGLLMSKLNNI----QMNIVLLNNDGGGIFSYLPQKESATD
MEND_STAAW      ---KRITLLIGDLSFYHDMNGLLMSKLNNI----QMNIVLLNNDGGGIFSYLPQKESATD
MEND_STAA3      ---KRITLLIGDLSFYHDMNGLLMSKLNNI----QMNIVLLNNDGGGIFSYLPQKESATD
MEND_STAAE      ---KRITLLIGDLSFYHDMNGLLMSKLNNI----QMNIVLLNNDGGGIFSYLPQKESATD
MEND_STAA8      ---KRITLLIGDLSFYHDMNGLLMSKLNNI----QMNIVLLNNDGGGIFSYLPQKESATD
MEND_STAAC      ---KRITLLIGDLSFYHDMNGLLMSKLNNI----QMNIVLLNNDGGGIFSYLPQKESATD
MEND_STAAT      ---KRITLLIGDLSFYHDMNGLLMSKLNNI----QMNIVLLNNDGGGIFSYLPQKESATD
MEND_STAAB      ---KRITLLIGDLSFYHDMNGLLMSKLNNI----QMNIVLLNNDGGGIFSYLPQKESATD
MEND_STAAR      ---KRVTLLIGDLSFYHDMNGLLMSKLNNI----QMNIVLLNNDGGGIFSYLPQKESATD
MEND_STAEQ      ---KNVTLLIGDLSFYHDMNGLLMAKLNEL----HINIVLVNNNGGGIFSYLPQKRSATK
MEND_STAES      ---KNVILLIGDLSFYHDMNGLLMAKLNEL----HINIVLVNNNGGGIFSYLPQKRSATK
MEND_STAHJ      ---KKITLIIGDLAFYHDMNGLLMAKINNI----NLNIVLLNNDGGGIFSYLPQKASAEA
MEND_STAS1      ---KKITLLIGDLAFYHDMNGLLMSKLNDI----QLNIVLLNNDGGGIFSYLPQKNEADA
MEND_BACFN      ---KLNFVVIGDLSFFYDMNALWNNHFGS-----NLRILLLNNGGGEIFHTLPGLEM-SG
MEND_BACFR      ---KLNFVVIGDLSFFYDMNALWNNHFGS-----NLRILLLNNGGGEIFHTLPGLEM-SG
MEND_BACTN      ---KLNFIVIGDLSFFYDMNALWNINVRP-----NLRILLLNNGGGEIFHTLPGLDM-SG
MEND_BACV8      ---KLNFIIIGDLSFFYDMNALWNQNYGA-----NIRILLLNNEGGEIFHTLPGMDK-SS
MEND_PARD8      ---KLNFIVIGDLSFFYDMNALWNGNLHN-----NLRILLLNNGGGEIFQALPGFKM-NE
MEND_FLAJ1      ---KPNVFITGDISFLYDSNALWNSYIPK-----NFKIILINNGGGGIFRILPGHQE-KP
MEND_FLAPJ      ---KETILITGDISFLYDSNALWNNYIPE-----NFKIILLNNGGGGIFRILPGHKE-NE
MEND_GRAFK      ---EPVTIITGDLSFFYDSNALWNNYIPS-----NFRIIILNNNGGGIFRILPGNKN-SE
MEND_PORGI      ---GTTLLITGDLSFMYDSNALWMPYVNG-----RIRVIVMRNGGGGIFRFIPGPDS-LK
MEND_CYTH3      ---QLVTIITGDLAFFYDRNAFWNNYKPS-----NLRVVLLNNHGGGIFRMIDGPSA-LP
MEND_DESPS      ---QLVLCCLGDLSFVYDSNALWNRNLPS-----NLRIVILNNQGGDIFRRLKGPSV-SP
MEND_NOSS1      -RQQSSVLITGDLALLHDTNGFLIRNKFV----GHLTIILINNNGGGIFEMLPIAKFE--
MEND_TRIV2      -RHQSSVLITGDLALLHDTNGFLIRNKFV----GHLTIILINNNGGGIFEMLPIAKFE--
MEND_TRIEI      -RYQKTVMLTGDLALLHDTNGFLLRNKLV----GHLTIILINNQGGGIFEMLPIANFE--
MEND_MICAN      -KNVPSLLLTGDLALLHDTNGFLIKKYFV----GSLTIILINNKGGGIFQMLPIAKFD--
MEND_ACAM1      -RQQSSVLLTGDLALLHDTNGFLLQDYWQ----GHLTIIVVNNGGGGIFQMLPISAFD--
MEND_SYNJA      -RHRPTVLLTGDLAFLHDCGGLRLAQCLQ----GSLTILLINNQGGGIFELLPIAEAG--
MEND_SYNJB      -HKRPTVLLTGDLAFLHDSSGLRLGQQVR----GSLTILLINNQGGGIFELLPIAEVGRQ
MEND_SYNP6      -QNRPSVLITGDLSLLHDSNGFLQRSQLQ----GHLTVVLIDNSGGGIFELLPIRDCG--
MEND_SYNE7      -QNRPSVLITGDLSLLHDSNGFLQRSQLQ----GHLTVVLIDNSGGGIFELLPIRDCG--
MEND_THEEB      -RGQPTLLITGDLACLHDTNGWLITPQFQ----GCLTVLLINNRGGGIFEHLPIRQFD--
MEND_SYNY3      -SRGETVLLTGDLSLLHDSNGFLNQSQMR----GNLTIILLNNNGGGIFQTLPIAQCE--
MEND_BDEBA      -PELENWCLVGDLTALYDLSSLWVTSQLD---AKKFRVVVINNGGGQIFHRMFK------
MEND_PARUW      -PEQNNWAILGDLTTLYDMIAPWVIHQIQ---PLKVNVVVVNNSGGQIFAPKFA------
MEND_PROM0      -IKNPLLLVTGDLAFVHDINGWLIENSVD----MNLTILLIDNNGGNIFNRIYKKNLKE-
MEND_PROM2      -IKNPLLLVTGDLAFIHDINGWLIENSVD----MNLTILLIDNNGGNIFNRIYKENLKE-
MEND_PROM9      -IKNPLLLVTGDLAFVHDLNGWLIENSID----LNLTILLINNNGGNIFNRLYKDNLKE-
MEND_PROMS      -IKNPLLLVTGDLAFLHDINGWLIENSID----MNLTILLINNNGGNIFNRIYKKNLKE-
MEND_PROM5      -ITQPLLLVTGDLALIHDINGFLIENSID----LNLTVLLINNNGGNIFNNLYKNNLEK-
MEND_PROMP      -ITKPLLLVTGDLALIHDINGFLIENAIE----LNLTILLINNNGGNIFNNLYKNNLDE-
MEND_PROM1      -IMGRMVLVTGDLALLHDTNGWLFSKDKN----ISLIVIMIDNGGGGIFNQLNIDRIKE-
MEND_PROMT      -IMGRMVLVTGDLALLHDTNGWLFSKDKN----ISLIVIMIDNGGGGIFNQLNIDRIEE-
MEND_PROMA      -FLGPLVVVCGDLAFLHDSNALLLNQPKK----YPLIILLIDNNGGGIFKQLSLAPIFK-
MEND_PROM3      -ALGPTLLVSGDLALLHDSNGWLLAHPQR----PPLVVVLIDNGGGGIFEQLLVKKAPS-
MEND_PROMM      -ALGPTLLVSGDLALLHDSNGWLLAHPQR----PPLVVVLIDNGGGGIFEQLLVKTAPS-
MEND_SYNPW      -ELGPLVLLTGDLALLHDSNGWLLASASA----PPLLVLLIDNGGGGIFGQLPIPTAPA-
MEND_SYNS3      -ELGPTVLITGDLALLHDSNGWLLASAAQ----QPLLVLLIDNAGGGIFEQLPIETTPR-
MEND_SYNPX      -EQGPMVLVTGDLALLHDSNGWLHGAQGN----PPLLVLLIDNQGGGIFQQLPIQSKQ--
MEND_SYNSC      -NLGPLALVTGDLALLHDSNGWLHASSAAA--PPPLLVLLIDNGGGGIFQQLPIATPG--
MEND_SYNS9      -ETGPMLLVTGDLALLHDSNGWLHGQSDG----PPLVVLLIDNGGGGIFQQLPIEQASP-
MEND_SYNR3      -QWQRLVLVTGDLALLHDANGWLWRRQLS----GELRLVVIDNGGGGVFEQLPIPRQS--
                          ** :  :.  .                 .   : *  :*           

MEND_ECOLI      E-------RERFYLMPQNVHFEHAAAMFELKYHRPQNWQELETAFADAWRTP----TTTV
MEND_ECOHS      E-------RERFYLMPQNVHFEHAAAMFELKYHRPQNWQELETAFADAWRTP----TTTV
MEND_ECOLC      E-------RERFYLMPQNVHFEHAAAMFELKYHRPQNWQELETAFADAWRTP----TTTV
MEND_SHIF8      E-------RERFYLMPQNVHFEHAAAMFELKYHHPQNWQELETAFADAWRTP----TTTV
MEND_SHIFL      E-------RERFYLMPQNVHFEHAAAMFELKYHHPQNWQELETAFADAWRTP----TTTV
MEND_ECO24      E-------RERFYLMPQNVHFEHAAAMFELKYHRPQNWQELETAFADAWRTP----TTTV
MEND_SHIBS      E-------RERFYLMPQNVHFEHAAAMFELKYHRPQNWQELETAFADAWRTP----TTTV
MEND_ECO57      E-------RERFYLMPQNVHFEHAAAMFELKYHRPQNWQELETVLADAWRTP----TTTV
MEND_SHISS      E-------RERFYLMPQNVHFEHAAAMFELKYHRPQNWQELETALADAWRTP----TTTV
MEND_ECOK1      E-------RERFYLMPQNVHFEHAAAMFELKYHRPQNWQELETTLVDAWRTP----TTTV
MEND_ECOL6      E-------RERFYLMPQNVHFEHAAAMFELKYHRPQNWQELETTLVDAWRTP----TTTV
MEND_ECOL5      E-------RERFYLMPQNVHFEHAAAMFELKYHRPQNWQELETTLVDAWRTP----TTTV
MEND_ECOUT      E-------RERFYLMPQNVHFEHAAAMFELKYHRPQNWQELETTLVDAWRTP----TTTV
MEND_ECOSM      E-------RERFYLMPQNVHFEHAAAMFELKYHRPQNWQELETALVDAWRTP----TTTV
MEND_SHIDS      E-------RECFYLMPQNVHFEHAAAMFELKYHRPQNWQELETVLADAWRTP----TTTV
MEND_SALCH      K-------RERFYLMPQNVHFDHAAAMFNLRYHRPENWEELESALAGAWRTP----AATV
MEND_SALTY      K-------RERFYLMPQNVHFDHAAAMFNLRYHRPENWEELESALAGAWRTP----ATTV
MEND_SALPA      K-------RERFYLMPQNVHFDHAAAMFNLRYHRPENWEELESALAGAWRTP----ATTV
MEND_SALPB      K-------RERFYLMPQNVHFDHAAAMFNLRYHRPENWEELESALAGAWRTP----ATTV
MEND_SALTI      K-------RERFYLMPQNVHFDHAAAMFNLRYHRPENWEELESALAGAWRTP----ATTV
MEND_SALAR      K-------RERFYLMPQNVHFDHAAAMFNLRYHRPENWEELELALASAWRTP----ATTL
MEND_CITK8      E-------RERFYLMPQNVHFEHAAAMFNLKYHRPQSWDELDAALAGAWRTP----TTTV
MEND_KLEP7      E-------RRQFYLMPQDVDFSHAAVMFGLAYHRPDDWPSLDEALAGAWRRA----GATV
MEND_ENT38      E-------RERFYLMPQNVQFEHAAAMFSLKYHRPQSWSELDDAMSTAWRQP----GATL
MEND_YERPA      E-------RQRFYCMPQDVNFEHAAVMFSLGYARPNSWPQLRELAHQCWLRG----GTTL
MEND_YERPE      E-------RQRFYCMPQDVNFEHAAVMFSLGYARPNSWPQLRELAHQCWLRG----GTTL
MEND_YERPN      E-------RQRFYCMPQDVNFEHAAVMFSLGYARPNSWPQLRELAHQCWLRG----GTTL
MEND_YERPP      E-------RQRFYCMPQDVNFEHAAVMFSLGYARPNSWPQLRELVHQCWLRG----GTTL
MEND_YERPS      E-------RQRFYCMPQDVNFEHAAVMFSLGYARPNSWPQLREHVHQCWLRG----GTTL
MEND_YERE8      D-------RQRFYCMPQNVSFEHAAAMFGLGYSRPESGLMLKQQVDQCWLRG----GVTL
MEND_SERP5      D-------RQRFYCMPQNVEFSHAAAMFQLAYARPENWGQLLQAVEQGWRHG----GATL
MEND_PECAS      Q-------REAFYCMPQNVEFGHAAAMFGLNYVRAESWEQLADTVSDCWTQG----GVTL
MEND_PHOLL      A-------RQRFYCMPQYVNFDHAAAMFGLKYASPQNWMELQQSIKQAWQQN----ETTL
MEND_CROS8      E-------REKFYCMPQNVCFAPAAAMFSLNYDAPESLAALKEAVTRAWRSS----VATV
MEND_HAEI8      V-------KDQFYRLPHNGDFSQIAAMFDLKYAHPYTWADLNSVVKQAYSRR----KATL
MEND_HAEIG      V-------KDQFYRLPHNGDFSQIAAMFDLKYAHPYTWADLNSVVKQAYSRR----KATL
MEND_HAEIN      V-------KDQFYRLPHNGDFSQIAAMFDLKYAHPYTWADLNSVVKQAYSRR----KATL
MEND_HAEIE      V-------KDQFYRLPHNGDFSQIAAMFDLKYAHPYTWADLNSVVKQAYSRR----KATL
MEND_PASMU      V-------KEKYYRMPHHLEFSQLVQTFDLKYARPYTWADLGAVLKVAYSRR----ETTL
MEND_MANSM      V-------KSEFYRMPHHTEFSQAASMFDLKYARPYTWADLSSVLKQAYSRK----EATV
MEND_ACTSZ      A-------KNAYYRLPHNLGFAEAASVFDLKYARPYTWADLGSVLKQAYMRK----EATV
MEND_HAES1      V-------KEKYYRMSHYLEFSHIAAMFDLKYARPYTWADLATVLKQAYSRR----ETTV
MEND_HISS2      V-------KEKYYRMSHYLEFSHIAAMFDLKYARPYTWADLATVLKQAYSRR----ETTI
MEND_ACTP2      A-------KEQFYRLSHNYEFAPIATMFGIEYIRPFTWADLKAKLKLAYGRK----GVTI
MEND_ACTPJ      A-------KEQFYRLSHNYEFAPIATMFGIEYIRPFTWADLKAKLKLAYGRK----GVTI
MEND_HAEDU      V-------KEQFYRLSHNYEFSQVAAMFGIEYIRPFTWADLKAKLKLAYGRK----SATI
MEND_PHOPR      Q-------RDELYRMPHGLEFSHAAAMFGLAYYCPESLPQAEEQCLYALTQP----KTTI
MEND_ALIF1      K-------KDDFYRMPHQLEFSHAAAMFGLSYHRPETLSCAMSMINDGLEK-----GIHL
MEND_VIBC3      Q-------REALYQMPHGMDFAHAASQFGLAYCAAQTLEHYQTLVEEHFAHGA---GTLL
MEND_VIBCH      Q-------REALYQMPHGMDFAHAASQFGLAYCAAQTLEHYQTLVEEHFAHGA---GTLL
MEND_VIBCB      H-------RESFYQMPHGYEFEHAAKQFGLQYRKPSSLAEYQSLVSEHFASGQ---GALV
MEND_VIBPA      H-------RTAYYQMPHGYQFEHAAKQFGLKYEKPTTLQMYQAMVADHLSSGQ---GTML
MEND_VIBVU      Q-------KQALYQMPHGYRFEFAAKQFGLDYVCPTSMTELTERIVGHFAHGC---GALL
MEND_VIBVY      Q-------KQALYQMPHGYRFEFAAKQFGLDYVRPTSMTELTERIVGHFAHGC---GALL
MEND_AERHH      L-------LETYYCLPHGLHFEHAAAMFGLHYRTPASLADFERDYTTAL-----EKGVTL
MEND_AERS4      L-------LETYYCLPHGLHFEHAAAMFGLHYRAPTTLAEFEQAYTAALKKPELEKKVTL
MEND_PSYIN      ---------QDYYQLPHGLTFADSCRQFSIDYYQPESLDQFVGDYQKSL-----QNRLSL
MEND_SHEB5      V-------RSEYYRLSHGLEFGYAAAMFNLPYNQVDNLADFQDSYNEALD----FQGASI
MEND_SHEB9      V-------RSDYYRLSHGLEFGYAAAMFNLPYNQVDNLADFQDSYNEALD----FQGASI
MEND_SHEB8      V-------RSDYYRLSHGLEFGYAAAMFNLPYNQVDNLADFQDSYNEALD----FQGASI
MEND_SHEPC      V-------RNDYYRLSHGLEFGYAAAMFNLPYNQVDNLADFQDSYNEALD----FQGASI
MEND_SHESW      V-------RNDYYRLSHGLEFGYAAAMFNLPYNQVDNLADFQDSYNEALD----FQGASI
MEND_SHESA      L-------RSDYYRLSHGLEFGYAAAMFNLPYNQVDNLADFQSCYHEALD----YQGASV
MEND_SHESM      L-------RSDYYRLSHGLEFGYAAAMFNLPYNQVDNLADFQSCYHEALD----YQGASV
MEND_SHESR      L-------RSDYYRLSHGLEFGYAAAMFNLPYNQVDNLADFQSCYHEALD----YQGASV
MEND_SHEON      L-------RSDYYRLSHGLEFGYAAAMFNLPYNQVDNLADFQTCYNEALD----FQGASV
MEND_SHEHH      L-------RSDYYRLSHGLEFGFGAAMFGLAYNQVDSLSDFIESYEYAMT----YSGPSV
MEND_SHEPA      L-------RTDYYRLSHGLEFGFGAAMFGLAYNQVDSISDFIESYEYAMT----YSGPSV
MEND_SHESH      L-------RSDYYRLAHGLEFGYGAAMFGLAYNRVDDFESFNEAYQEAIA----FQGPSV
MEND_SHEWM      L-------RSDYYRLAHGFEFGYGAAMFGIPYNRVEELESFEESYQDAIH----YEGASV
MEND_SHELP      L-------RSGYYRLAHGLEFGYGAAMFGLPYNRVEDIVSFNEAYDDALA----YPGASV
MEND_SHEAM      L-------RSDFYRLSHGLEFGYGAAMFGLPYDRAEDMEAFIDAYQAALE----HPGASV
MEND_SHEFN      L-------RNDFYRLSHGLEFGYGAAMFGLAYRQADDIESFNQAYQEAFE----FNCASV
MEND_HALHL      A-------HRRLFRMPHGYGFSQAAAQFRLPYWQCTDGDSLEAAHREACTRP----GGSV
MEND_PELLD      I-------FEEHFATPQHFHAQHAAGMFGLRYAAPRTNREFEECFLAAGEAP----QSTI
MEND_CHLPM      I-------FEPNFATPQNFSGRPAAAMFGLDYTAPLTNSEFRESLLSALNSN----RSTI
MEND_CHLCH      L-------FETYFATPQHYSIPLAAETFGLHYANPTTNSEFVAAYHQAQQSP----QSTI
MEND_CHLPD      V-------FETHFATPQHYSIASAAATFGVAHASPKTNREFADTCTEAFESN----ESIV
MEND_CHLTE      R-------LDECFATPQNFSIESAARTFGIDYACPETNGDFTQLYAEALTTK----KSLI
MEND_RUBXD      I-------FEPYFGTPHGLGFRQAAEMFGLGYSGPRTAGELSLAYQRACAEG----GPHL
MEND_SALRD      --------FDPYFTTPHGHDFEHAAALFDLPYHRPDSPSALRSAYAQACRSG----ESAL
MEND_SYNAS      I-------LEPYMTTPHGMTFDLLAAQFDLPYFRAATPDELRKAYESALDAE----RSAV
MEND_DECAR      E-------FTQGWRTPQNVNFEHAAMAFGLGYAATHSDDDLRPALRHAFAAG----GPHL
MEND_PAEAT      G--AYGTAVERLFGTPHSVGIGALAAAYGVGHQTVSTTAELAAALKSPL------KGRTI
MEND_ARTS2      G--TYGNAVERLFGTPHKVDISSLAAAYGVEHCAVSTTAELAKALAAPS------SGRSI
MEND_RENSM      P--AYQAAVERYFGTAHDAELASLAAAYGLEYQLVSSTEQLVEMLQAPV------SGRSV
MEND_CLAM3      -----PAAIDRVMFTPQRVDLASLAKAYGWTHLRAATHGELEAALTTAS------GAPLL
MEND_CLAMS      -----PASIDRVMFTPQRVDLASLARAYGWAHLRAATHGELEAALTTAS------EAPLL
MEND_LEIXX      -----PAAFDRVLYTPQRGDIAALSTAYGWAHRVVRTKGELDQALSAPP------AGASV
MEND_KINRD      -----RATFERVVATPHGVDVAALCAAFGVAHSRPATRAEALAALTARP------RGLRV
MEND_NOCSJ      -----ADQYDRLFGTPHRVDLASLCAATRTPHWRVDSLAELEHALASPA------GGIEV
MEND_CUTAK      -----APVLRRMFLTPQRLDSAALAHALGASHRRVS--PDDLQFLDEPV------VGRQV
MEND_COREF      S------RFERAFGTPHDVNISDLCDAYGVDYRRANTLQDLLMELEDTIEI----PGFTV
MEND_CORGB      P------NFERAFGTPHDASIADLCAGYGIEHQAVDNLQDLIIALVDTTEV----SGFTV
MEND_CORDI      P------SFEQAFGTPHGVHIEAIAQAYGVNYLRAETLPELIEALIDTTDS----AGFNI
MEND_CORJK      TFADGTAAFERVFGTPLDLDFAELCAGFGVEHKLATSVEELATVIDEHAEIGG--SGITV
MEND_MYCA1      D------VSSRVFGTPHDVDVGALCRAYHVESAQIEVGELAAALDEPGP-------GMRV
MEND_MYCPA      D------VSSRVFGTPHDVDVGALCRAYHVESAQIEVGELAAALDEPGP-------GMRV
MEND_MYCBO      D------VSSRIFGTPHDVDVGALCRAYHVESRQIEVDELGPTLDQPGA-------GMRV
MEND_MYCBP      D------VSSRIFGTPHDVDVGALCRAYHVESRQIEVDELGPTLDQPGA-------GMRV
MEND_MYCTA      D------VSSRIFGTPHDVDVGALCRAYHVESRQIEVDELGPTLDQPGA-------GMRV
MEND_MYCTU      D------VSSRIFGTPHDVDVGALCRAYHVESRQIEVDELGPTLDQPGA-------GMRV
MEND_MYCUA      D------VSSRIFGTPHDVDVGALCRAYHVENRQIEVDQLPAALDEPGS-------GLRV
MEND_MYCLE      A------VSSRIFGTPHDVDVGALCRAYHVEGRQIEVDKLREALDEPGV-------GMRV
MEND_MYCGI      D------VSSRIFGTPHDVDVGALCRAYHVESTQIEAGELAAALAEDFD-------GMRV
MEND_MYCVP      D------VSSRIFGTPHDVDVGALCRAYHVESRQIEVGELAGALDEDFD-------GMRV
MEND_MYCSK      D------VSSRVFGTPHDVDVGALCRAYHVDNRQIEVGQLADALDEPHE-------GMRV
MEND_MYCSS      D------VSSRVFGTPHDVDVGALCRAYHVDNRQIEVGQLADALDEPHE-------GMRV
MEND_MYCSJ      D------VSSRVFGTPHDVDVGALCRAYHVDNRQIEVGQLADALDEPHE-------GMRV
MEND_MYCS2      D------VSSRIFGTPHDVNIGALCHAYHVDYHQIEADALGAALEDPFQ-------GMRV
MEND_NOCFA      G------VFERVFGTPHGMDLAALCAAYRIPHRQVDPAELAAELAGDAH-------GLRV
MEND_RHOJR      G------VFERVFGTPHGMDLAALCAAYRVEHHLVGLGELSTRLSAPEAPGD---RGIRV
MEND_SACEN      G------SFERVFGTPHGTDIGSLCAAHGVEHTVVRQRSEFGVALRRRP-------GLRV
MEND_THEFY      --------FERVFGTPHGVAVEQVAATAGLPYTRVEWATDLPKALIGDG--------LRL
MEND_HALMA      -----HPTFEDQFRTPHGLDFEPTEALYSLQFERVA--DRRQFRERFAESVQT--DGTQV
MEND_NATPD      -----HESFDKWFRTPHGLDFEPSAALYDIEFARTD--SREGFRSLYSEAVGS--GETQV
MEND_HALS3      -----DPPFTGQFKTPHGLDFAPTADTYALSFARTD--TVGEFRAAYRAALGD--AGTHV
MEND_HALSA      -----DPPFTGQFKTPHGLDFAPTADTYALSFARTD--TVGEFRAAYRAALGD--AGTHV
MEND_HALWD      -----DPPFTTQFVTPHGLDFEPTEDIYDLSFARVRGTDRDGFHTAFTEATTT--TGSHV
MEND_ROSCS      -----EPEFTDYFVTPHGLDFAHAAKMYGLEYVPVK--DRTAFRSAFRASIDA--RAATL
MEND_ROSS1      -----EPEFTDYFVTPHGLHFAHAAKMYGLDYVQVR--DREAFRRAFRESIEA--RAATI
MEND_CHLAA      -----TDQFELLFGTPHGVDFAPLAAMHNAHYTLAT--DWSAVHEALQASF-T--GGLHL
MEND_MYXXD      -----RDTFETLFGTPHGVDLSHAAALGGARLHRPE--TPVALRSAVREGLE---GGLHL
MEND_SORC5      ------ALLERCFTMPQHLDFAPAAAMFGLAYERAG--TAGELARALAAGYQR--AGATL
MEND_BACSU      H-------FEDLFGTPTGLDFKHAAALYGGTYSCPASWDEFKTAYAPQADKPG----LHL
MEND_BACVZ      H-------FEELFGTPTGLDFRHAAALYGGTYTCPETWEAFKDAYQPQADKPG----LHI
MEND_BACLD      Y-------FELLFGTPTGLEFEHAAKLYGGRYICPESSAHFADAYLSSVNRRG----LDI
MEND_BACP2      Y-------YEKLFGTPTGLNFEYASKLYGGTYSKPSTKQEFHDVYKAHIEEPG----LHL
MEND_BACAH      H-------FESLFGTPIGLDYEHVVTMYGGSFSRVNGWEQFREEVQKGATTEG----LHV
MEND_BACHK      H-------FESLFGTPIGLDYEHVVTMYGGSFSRVNGWEQFREEVQKGATTEG----LHV
MEND_BACAN      H-------FESLFGTPIGLDYEHVVTMYGGSFSRVNGWEQFREEVQKGVTTEG----LHV
MEND_BACCZ      H-------FESLFGTPIGLDYEHVVTMYGGSFSRVNGWEQFREEVQKGATTEG----LHV
MEND_BACC1      H-------FESLFGTPIGLDYEHVVNMYGGSFSRVNGWEQFREEVQKGTTTEG----LHV
MEND_BACCR      H-------FESLFGTPIGLDYEHVVKMYGGSFSRVNGWEQFREEVRKGTTTEG----LHV
MEND_BACCN      H-------FESLFGTPLGLDYEHVVKMYGGSFVRVSGWEAFREEVQKGIIERG----LHV
MEND_GEOKA      A-------FETLFGTPTDLSFAHAVEMYGGRHTVPHNWAEFRRHVSESLSSGG----LHV
MEND_GEOTN      P-------FETLFGTPTDLTFAHAVEMYGGRYAVPHTWGEFRHHVAESLNTGG----LSV
MEND_OCEIH      H-------FEALFGTPMDLSFEQVAKLYEANYNHVKTEEQLKAALYESYQLDG----LSI
MEND_LISMF      Y-------FESLFGTSTELDFRFAAAFYDADYHEAKSVDELEEAIDKASYHKG----LDI
MEND_LISMO      Y-------FESLFGTSTELDFRFAAAFYDADYHETQSVDELEEAIDKASYHKG----LDI
MEND_LISIN      Y-------FESLFGTSTELDFRFAAAFYDADYHEAKSVDSLEEAIDKASYHKG----LDI
MEND_LISW6      Y-------FESLFGTSTELDFRFAAAFYDGDYHEAKSVDELEEAVDKATYHKG----LDI
MEND_ENTFA      D-------FEPLFGTPLDLDFSLVAELYGASYQEVKTIAELKQILQAAAEEPQ----FQV
MEND_LACLM      N-------FDYLFSTPHGLNFEGLAELTGLDYHLVSNYADFGQQFETSIRQPG----IHL
MEND_LACLS      N-------FDYLFSTPHGLNFEGLAELTGLDYHLVSNYADFGQQFETSICQPG----IHL
MEND_LACLA      N-------FDYLFSTPHGLNFAGLAELTGLDYHLVSGYADFGQQFEASLHQSG----IHL
MEND_DESHY      Y-------FELLFMTPHGMDFSGLKTLYDLTYYEPVDYESFAQNFQEALTLSG----VKV
MEND_LEUCK      Y-------FEDMFGTPLDLDMSKVAYLYDMPYIQLKGAAALGECL--SHQVHG----PRL
MEND_LEUMM      Y-------FEQLFGTPLNIDIKKIADLYYIDYHQLNVPEALSQIL--QTPSKT----TRL
MEND_STAA1      Y-------FERLFGTPTGLDFEYTAKLYQFDFKRFNSVSEFKNA---TLLSET----STI
MEND_STAA9      Y-------FERLFGTPTGLDFEYTAKLYQFDFKRFNSVSEFKNA---TLLSET----STI
MEND_STAAN      Y-------FERLFGTPTGLDFEYTAKLYQFDFKRFNSVSEFKNA---TLLSET----STI
MEND_STAA2      Y-------FERLFGTPTGLDFEYTAKLYQFDFKRFNSVSEFKNA---TLLSET----STI
MEND_STAAM      Y-------FERLFGTPTGLDFEYTAKLYQFDFKRFNSVSEFKNA---TLLSET----STI
MEND_STAAS      Y-------FERLFGTPTGLDFEYTAKLYQFDFKRFNSVSEFKNA---TLLSET----STI
MEND_STAAW      Y-------FERLFGTPTGLDFEYTAKLYQFDFKRFNSVSEFKNA---TLLSET----STI
MEND_STAA3      Y-------FERLFGTPTGLDFEYTAKLYQFDFKRFNSVSEFKNA---TLLSET----STI
MEND_STAAE      Y-------FERLFGTPTGLDFEYTAKLYQFDFKRFNSVSEFKNA---TLLSET----STI
MEND_STAA8      Y-------FERLFGTPTGLDFEYTAKLYQFDFKRFNSVSEFKNA---TLLSET----STI
MEND_STAAC      Y-------FERLFGTPTGLDFEYTAKLYQFDFKRFNSVSEFKNA---TLLSET----STI
MEND_STAAT      Y-------FERLFGTPTGLDFEYTAKLYQFDFKRFNSVSEFKNA---TLLSET----STI
MEND_STAAB      Y-------FERLFGTPTGLDFEYTAKLYQFDFKRFNSVSEFKNA---TLLSET----STI
MEND_STAAR      Y-------FERLFGTPTGLDFEYTAKLYQFDFKRFNNVSEFKNA---TLLSET----STI
MEND_STAEQ      Y-------FERLFGTPTGLNFEYTALLYDFTFKRFDNLTDFKYA---ELSKMG----SHM
MEND_STAES      Y-------FERLFGTPTGLNFEYTALLYDFTFKRFDNLTDFKYA---ELSKMG----SHM
MEND_STAHJ      Y-------FERLFGTPTGLNFEYTALLYDFTFKRFNTVADFTQE---KLSHVN----SHI
MEND_STAS1      Y-------FERLFGTPTGLNFEHTALLYDFAFDRFDTIEAFKYA---DLSQFG----SHI
MEND_BACFN      T-------SHRFVTAVHKTSAKGWAEERGFLYQEVQDEKQLDEAMKTFTQPEL-LTQPVI
MEND_BACFR      T-------SHRFVTAVHKTSAKGWAEERGFLYQEVQDEKQLDEAMKTFTQPEL-LTQPVI
MEND_BACTN      T-------SHKYITAVHKTSAKGWAEERGFLYQRVENEEQLAEAMKTFTQPEA-MEQPVL
MEND_BACV8      R-------SREFITAEHYTTAKGWAEERGFIYMKVTGEEELEEAMQPFTSPET-RMQPML
MEND_PARD8      R-------THRYVTASHQTSAEGWATERGFSYSAVHNAEELAAAMSAFTQTEQPSEHPLF
MEND_FLAJ1      V-------FNTYFETSHHLTAEHLAKMYQCSYFKADDLSSLNENLELLYNSNE---APGI
MEND_FLAPJ      T-------FNTYFETSHRLTAKYLAKMYNFGYEKAVDEKTLAEKLKITINTKK---SI-I
MEND_GRAFK      N-------FEKYFETTHNLKAKPICDLYNFDYEKANSEEEIQKVMKDFYSESG---KPKL
MEND_PORGI      E-------LETCFETPLEVPVREMAGAYGWRYMKAVSAEELETVLPSFFASGD---RAVL
MEND_CYTH3      E-------LDELFETKQTLSARYLATEHGLEYTLCKNLNGLNQALESFFQPSM---FGKI
MEND_DESPS      G-------YQDFFVAHHPVQIGKMIEAYGVAYRRCLASEIDGFSEEFLGLQDG----PLV
MEND_NOSS1      ------PPFEEFFGTPQDIDFAQLCTTYNVQHELIHSWVHLQQRLNPLPNT-----GIRV
MEND_TRIV2      ------PPFEEFFGTPQDIDFAQLCTTYNVQHELIHSWVHLQQRLNPLPNT-----GIRV
MEND_TRIEI      ------PPFTEFFATPQEIDFADLCKTYGLEHQKISSWNQLQQLLNPLPSS-----GIRI
MEND_MICAN      ------PPFEEFFATPQNIDFCQLCRTYGIDYHLISDWTDFEQKIAVLPES-----GIRL
MEND_ACAM1      ------PPFERFFRTPQQVQLKHLAATYQAKWTLIQSWAHLQQALNPLPES-----GLHI
MEND_SYNJA      ------PPFEPYFATPQAVDFALLCQAHGIPHRRIETWEELAQALDPLPAQ-----GVRV
MEND_SYNJB      GP---DPPFEPYFATPQLVDLALLCQAHGIPHRRVESWQELAQALDPLPAQ-----GVRV
MEND_SYNP6      ------PSFEPFVATPQTVDFAALCQAYGVDYQAIATEAELIKAIQTLPTS-----GIRV
MEND_SYNE7      ------PSFEPFVATPQTVDFAALCQAYGVDYQAIATEAELIKAIQTLPTS-----GIRV
MEND_THEEB      ------PPFEAFFATPQQVDFSYLAAAYGIPYHCLKDWADVEAQLRQTPWP-----KIRL
MEND_SYNY3      ------DVFETYFATPQGVDFGQLCRTYGVEHKIITNLWDLKEQWPSNNSS-----PIRV
MEND_BDEBA      ---------KEIFINKHQISFESWAKMWNWSYDKWHTIPEDNKELNLADHQ--------I
MEND_PARUW      ---------HLSFLNSHQLNFKAFADFWGWEYDCWHEIP--TTILGSQTSR--------L
MEND_PROM0      ------DEFKKLFLMPKEINWSKLSESYQVKFKSVSNFKKLREAFDWSISI----QKSVI
MEND_PROM2      ------DELRKLFLMPKEINWPKLAEGYQVNFKNVANFKKLREALDWSISI----QKSVI
MEND_PROM9      ------DELKKLFLMPKEINWKKLAEGYQVNFKSVTNFKKLREAFEWSISI----RESVI
MEND_PROMS      ------DEFKKLFLMPKEINWPKLAEGYQVNFRSVANFKKLREAFDWSISI----EKSAI
MEND_PROM5      ------EELKKLFLMPKSINWENLAKAFQVPIKIVSDLNKLPESFEWSLSM----QKSVI
MEND_PROMP      ------EELKKLFIMPKSINWENLAKGYQVPIKNVSDLNKLREAFEWSLSM----QKSVI
MEND_PROM1      ------GDFEEIFLMPQQVCHLTLAKAYGLKYKQVACLDDLEKAIEWSFSL----STNVL
MEND_PROMT      ------GDFEDIFLMPQQVCHLTLAKAYGLKYKQVACLDDLEKAIEWSFSL----STNVL
MEND_PROMA      ------GSVDKLFSMPQSINIGDLAKAHNIPFRTISSFDELNSALEWSLKL----SGPVI
MEND_PROM3      ------EAFEQLFAMPQAVDPLVLAAAHNIPHRQVACLEDLPAALEWGLFQ----TGPVL
MEND_PROMM      ------EAFEQLFAMPQEVDPLALAGAHNIPHRQVACLEDLPAALEWGLFQ----AGPVL
MEND_SYNPW      ------AAFDHLFAMPQAVDPLALARAHAVPTRQLASLEDLPQALEWGLDQ----RRAVL
MEND_SYNS3      ------DGFNQLFAMPQQVDPLALAAAHSIPVRQLACLDDLPSALEWGLGS----AGPTL
MEND_SYNPX      --------FDRLFAMPQRVNPLALAAAHGIDGRQVACLEDLPEALEWGLAQ----GRPAL
MEND_SYNSC      --------FESLFAMPQQVDSLALAAAHGVPGRQVACLEDLQEALAWGLSQ----QRPVL
MEND_SYNS9      ------KRFDALFAMPQRVNPIALAAAHGVPGRSIAVIDDLPEALSWALAQ----QGPVL
MEND_SYNR3      ------MDFDRLFAMPQSCDAMALAAAHGVAARDCSAMETLAADLQWLLEPG---DAMRL
                                                                           .

MEND_ECOLI      IEMVVNDTDGAQTLQQLLAQVSHL--------------------
MEND_ECOHS      IEMVVNDTDGAQTLQQLLAQVSHL--------------------
MEND_ECOLC      IEMVVNDTDGAQTLQQLLAQVSHL--------------------
MEND_SHIF8      IEMVVNDTDGAQTLQQLLAQVSHL--------------------
MEND_SHIFL      IEMVVNDTDGAQTLQQLLAQVSHL--------------------
MEND_ECO24      IEMVVNDTDGAQTLQQLLAQVSHL--------------------
MEND_SHIBS      IEMVVNDTDGAQTLQQLLAQVSHL--------------------
MEND_ECO57      IEMVVNDTDGAQTLQQLLAQVSHL--------------------
MEND_SHISS      IEMVVNDTDGAQTLQQLLAQVSHL--------------------
MEND_ECOK1      IEMVVNDTDGAQTLQQLLAQVSHL--------------------
MEND_ECOL6      IEMVVNDTDGAQTLQQLLAQVSHL--------------------
MEND_ECOL5      IEMVVNDTDGAQTLQQLLAQVSHL--------------------
MEND_ECOUT      IEMVVNDTDGAQTLQQLLAQVSHL--------------------
MEND_ECOSM      IEMVVNDTDGAQTLQQLLAQVSHL--------------------
MEND_SHIDS      IEMVVNDTDGAQTLQQLLAQVSHL--------------------
MEND_SALCH      IELVVNDTDGAQTLQQLLAQVSHL--------------------
MEND_SALTY      IELVVNDTDGAQTLQQLLAQVSHL--------------------
MEND_SALPA      IELVVNDTDGAQTLQQLLAQVSHL--------------------
MEND_SALPB      IELVVNDTDGAQTLQQLLAQVSHL--------------------
MEND_SALTI      IELVVNDTDGAQTLQQLLAQVSHL--------------------
MEND_SALAR      IELVVNETDGAQTLQQLLAQVSHL--------------------
MEND_CITK8      IELVVNDTDGAQTLQQLLAQVSHL--------------------
MEND_KLEP7      IELAVNETDGAQTLQQLLAQVSRL--------------------
MEND_ENT38      IELVVNDSDGAQKLQHLLAQVSHL--------------------
MEND_YERPA      IEVQVPPSQGAETLQQLVQQVTLIPQVAP---------------
MEND_YERPE      IEVQVPPSQGAETLQQLVQQVTLIPQVAP---------------
MEND_YERPN      IEVQVPPSQGAETLQQLVQQVTLIPQVAP---------------
MEND_YERPP      IEVQVPPSQGAETLQQLVQQVTLIPQVAP---------------
MEND_YERPS      IEVQVPPSQGAETLQQLVQQVTLIPQVAP---------------
MEND_YERE8      IEIEVPPSQGAETLQQLVQQVAQL--------------------
MEND_SERP5      IELQVPPSDGAQTLQHLVQQMTEQ--------------------
MEND_PECAS      LEVVVEPKDGAETLNELVAQVAAWTH------------------
MEND_PHOLL      IELKVPDREGAECLQQLLKQVAML--------------------
MEND_CROS8      IELRVPETAGAQVFSRLLKAVCA---------------------
MEND_HAEI8      IEIKTNPSDGSSLYKRLIDQISHAVIGA----------------
MEND_HAEIG      IEIKTNPSDGSSLYKRLIEQISHAVIGA----------------
MEND_HAEIN      IEIKTNPSDGSSLYKRLIEQISHAVIGA----------------
MEND_HAEIE      IEIKTNPSDGSSLYKRLIEQISHAVIGA----------------
MEND_PASMU      IEIKVGASDASTIYKRLIEQISYAVIGE----------------
MEND_MANSM      IEIKVGPMDGSNTYKRLIEQISYAVIGA----------------
MEND_ACTSZ      IEIKAGPNDATNLYKRLLEQISFAVIGA----------------
MEND_HAES1      IEIKVNPNDGSNIYKDLIDKIGHALIGV----------------
MEND_HISS2      IEIKINPNDGSNIYKDLIDKIGHALIGV----------------
MEND_ACTP2      VEIKVNDQDGSNLYKSLVKQISQAEIA-----------------
MEND_ACTPJ      VEIKVNDQDGSNLYKSLVKQISQAEIA-----------------
MEND_HAEDU      VEIKVNDQDGSNLYKSLIKQISQAEIA-----------------
MEND_PHOPR      IEIKTPAGEAGEMIKALFGKVKNATLL-----------------
MEND_ALIF1      IEINTPAGQSGEELTRLFQTIQHAALF-----------------
MEND_VIBC3      IEVKTPPQQASMHIKQLTSQLHAL--------------------
MEND_VIBCH      IEVKTPPQQASMHIKQLTSQLHAL--------------------
MEND_VIBCB      VEVQTPSNQAVEHLKSFDKNLHALF-------------------
MEND_VIBPA      VEVQTPPSQAAELIKAFNKSLHASL-------------------
MEND_VIBVU      VEVNTPPNQASQHIKQLADHVRSLV-------------------
MEND_VIBVY      VEVNTPPNQASQHIKQLADHVRALV-------------------
MEND_AERHH      IEIKVPSSEVAEDLKALGSAIRGS--------------------
MEND_AERS4      IEIKVPSSEVAEDLKALGAAIRGL--------------------
MEND_PSYIN      IEICVKNDQTYNHLEYIKEQIKYATF------------------
MEND_SHEB5      IEVNVSQNQASDQIAALNLWVKQS--------------------
MEND_SHEB9      IEVNVSQNQASDQIAALNLWVKQS--------------------
MEND_SHEB8      IEVNVSQNQASDQIAALNLWVKQS--------------------
MEND_SHEPC      IEVNVSQTQASDQIAELNLWVKQS--------------------
MEND_SHESW      IEVNVSQTQASDQIAELNLWVKQS--------------------
MEND_SHESA      IEVSVSQHQASEQIAALNLWVKQS--------------------
MEND_SHESM      IEVSVSQHQASEQIAALNLWVKQS--------------------
MEND_SHESR      IEVSVSQHQASEQIAALNLWVKQS--------------------
MEND_SHEON      IEVTVSQHQASEQIAALNLWVKQS--------------------
MEND_SHEHH      IEVTVAQNQASEQIAQISSWVKQS--------------------
MEND_SHEPA      IEVTVAQDQASEQIAQIASWVKQS--------------------
MEND_SHESH      IEVSVAQHQASEQIASIATWVKQS--------------------
MEND_SHEWM      IEVIVPQQQASDQIARIASWIKQS--------------------
MEND_SHELP      IEVCVAQDQASEQIARLAAWIKQS--------------------
MEND_SHEAM      IEVTVAQDQASNQIRRMAEWIRSR--------------------
MEND_SHEFN      IEVNVSPTQASDQITQISQWVKQH--------------------
MEND_HALHL      IEVACPPGAGSEQMANLFRTLEAL--------------------
MEND_PELLD      IEIASSRSENVEQHRTLQARFNAFAETAFTDR------------
MEND_CHLPM      IEVVCSRSENVRLHRALQARLGLLATEAFFIP------------
MEND_CHLCH      IEVKSSRTNNLQHHRLLNARLQAIAAKLFNG-------------
MEND_CHLPD      IEITGSREDNVSAHRSLQHTINMLARKFLKKQ------------
MEND_CHLTE      IEIRSDREKNLLLHRSLKARLDPVFEKADCSR------------
MEND_RUBXD      IEVVTDRRENLALHRELLRGAAG---------------------
MEND_SALRD      IEVRTDRATNRQVHDRLEASVERAVEEG----------------
MEND_SYNAS      LEVTLDPEEDLRTFQTFQNVRLP---------------------
MEND_DECAR      IELRQC--------------------------------------
MEND_PAEAT      VEVRVDRSGLRALHARIKEAVSAAVGQVLTAG------------
MEND_ARTS2      IEVRTDRAGLRKLHGRIKAAVGEAARSVLAG-------------
MEND_RENSM      LEIRTERTALRGLHDRVRAAISAALTI-----------------
MEND_CLAM3      IEVPLVR-------------------------------------
MEND_CLAMS      IEVPLAR-------------------------------------
MEND_LEIXX      LEVPLER-------------------------------------
MEND_KINRD      VELVTARDRVRPRLERIAAAVRAAVA------------------
MEND_NOCSJ      VEAVVRRDNRRDLDERIRALRP----------------------
MEND_CUTAK      VSVPLT--------------------------------------
MEND_COREF      IEAVTVRDTRRALQRELTAKVR----------------------
MEND_CORGB      IEASTVRDTRRAQQQALMTKVR----------------------
MEND_CORDI      IEAVTTRSTRRDIDKALTL-------------------------
MEND_CORJK      LEVKVSRRGRQEIEKRIAGTR-----------------------
MEND_MYCA1      LEVKADRSSLRQLHAAIKAAL-----------------------
MEND_MYCPA      LEVKADRSSLRQLHAAIKAAL-----------------------
MEND_MYCBO      LEVKADRSSLRQLHAAIKAAL-----------------------
MEND_MYCBP      LEVKADRSSLRQLHAAIKAAL-----------------------
MEND_MYCTA      LEVKADRSSLRQLHAAIKAAL-----------------------
MEND_MYCTU      LEVKADRSSLRQLHAAIKAAL-----------------------
MEND_MYCUA      LEVKADRSSLRQLHAAIKAAL-----------------------
MEND_MYCLE      LEVKADRSSLRQLHAAITATL-----------------------
MEND_MYCGI      LEVKADRSSLRALHASIKAGL-----------------------
MEND_MYCVP      LEVKADRSSLRALHASIRANL-----------------------
MEND_MYCSK      LEVKADRSSLRALHASIKAAL-----------------------
MEND_MYCSS      LEVKADRSSLRALHASIKAAL-----------------------
MEND_MYCSJ      LEVKADRSSLRALHASIKAAL-----------------------
MEND_MYCS2      LEVKADRSSLRSLHASIKAAL-----------------------
MEND_NOCFA      LEVITERSSLRELHATVRAKIAP---------------------
MEND_RHOJR      LEVTTERSGLRELHAAVRAQL-----------------------
MEND_SACEN      VEVRADRAELRGVHERLHAAVRGALHG-----------------
MEND_THEFY      VEVRTDRAASARLRRALQEAVAAAVR------------------
MEND_HALMA      IEVRFDAGDSHAVRDQLTEQVAETLAGD----------------
MEND_NATPD      IEVQTESGHNHADRTALREAVVEELGR-----------------
MEND_HALS3      IEVSTDAEASHRERERLADRVTGLSV------------------
MEND_HALSA      IEVSTDAEASHRERERLADRVTGLSV------------------
MEND_HALWD      IEVVTDSESSHRVREQLHDRVIKRILDN----------------
MEND_ROSCS      IELRTDARTDLVRRNALIQAARATGA------------------
MEND_ROSS1      IELRTDARADLARRPALMRSAKASDVRGL---------------
MEND_CHLAA      IEVRTRRDQNVIDHRTIWPLVSNALAQAGITVAE----------
MEND_MYXXD      VEVRVDRNANVDEHRRLFA---RMAASLGEGPWA----------
MEND_SORC5      IEAVVPPHDGAARVARLWSDVRRDVAALGSAPAADGAAADLQTP
MEND_BACSU      IEIKTDRQSRVQLHRDMLNEAVREVKKQWEL-------------
MEND_BACVZ      IELKTDRTSRVQFHRDLLQAAVREVKKEWKL-------------
MEND_BACLD      IEVKTKRDDRVEQHRRMLDSALHEIRKEWPF-------------
MEND_BACP2      IEIETDRHSRVSKHRQMMDDILEEVKKECLLS------------
MEND_BACAH      VEICTNRDENLTLHRKLWAKTQDVITTSLQGESK----------
MEND_BACHK      VEICTNRDENVTLHRKLWAKTQDVITTSLQGESK----------
MEND_BACAN      VEICTNRDENLTLHRTLWAKTQDVITTSLQGESK----------
MEND_BACCZ      VEICTNRDENLTLHRTLWAKTQDVITTSLQGESK----------
MEND_BACC1      VEICTNRDENLTLHRTLWAKTQDVITTSLQGESK----------
MEND_BACCR      VEICTNRDENLTLHRTLWAKTMDVITTSLQGESK----------
MEND_BACCN      VEICTNREENVQLHRKLWAKSVIEIKDMLQGDTE----------
MEND_GEOKA      IEVRTSRAENVRMHRLLWNEVAREIAKCLE--------------
MEND_GEOTN      IEVRTSRTENVQMHRFLWERVSQEIAKFLEQKGTEEPWN-----
MEND_OCEIH      IEVKTDREQNVQWHQAKWQLIKEAILKDG---------------
MEND_LISMF      IEVKTNRHENKANHQALWVKIADALKALD---------------
MEND_LISMO      IEVKTNRHENKANHQALWAKIADALKALN---------------
MEND_LISIN      IEVKTNRHENKANHQALWEKIATALKALD---------------
MEND_LISW6      IEVKTNRHENKANHQALWDKIATGLKALD---------------
MEND_ENTFA      IEVKGNRQENVHLYESILAEIGRRVERQGISWNG----------
MEND_LACLM      LEIKTDKDLSLALHKKYTAYEN----------------------
MEND_LACLS      LEIKTDKDLSLALHKKYTAYEN----------------------
MEND_LACLA      LEIKTDKDLSLALHQKYTTYEN----------------------
MEND_DESHY      LNVKIDARLSKELHDRLTNLD-----------------------
MEND_LEUCK      IEINFDRQENVANHRELLELNQHE--------------------
MEND_LEUMM      IEYKSDHQRNRDDHREVLEMLK----------------------
MEND_STAA1      YELITNREDNFKQHQILYQKLSEMIHDTL---------------
MEND_STAA9      YELITNREDNFKQHQILYQKLSEMIHDTL---------------
MEND_STAAN      YELITNREDNFKQHQILYQKLSEMIHDTL---------------
MEND_STAA2      YELITNREDNFKQHQILYQKLSEMIHDTL---------------
MEND_STAAM      YELITNREDNFKQHQILYQKLSEMIHDTL---------------
MEND_STAAS      YELITNREDNFKQHQILYQKLSEMIHGTL---------------
MEND_STAAW      YELITNREDNFKQHQILYQKLSEMIHGTL---------------
MEND_STAA3      YELITNREDNFKQHQILYQKLSEMIHDTL---------------
MEND_STAAE      YELITNREDNFKQHQILYQKLSEMIHDTL---------------
MEND_STAA8      YELITNREDNFKQHQILYQKLSEMIHDTL---------------
MEND_STAAC      YELITNREDNFKQHQILYQKLSEMIHDTL---------------
MEND_STAAT      YELITNREDNFKQHQILYQKLSEMIHDTL---------------
MEND_STAAB      YELITNREDNFKQHQILYQKLSEMIHDTL---------------
MEND_STAAR      YELITNREDNFKQHQILYQKLSEMIHDTL---------------
MEND_STAEQ      YEVITNRDENLHQHQNLYQKLSEIVNVTL---------------
MEND_STAES      YEVITNRDENLHQHQNLYQKLSEIVNVTL---------------
MEND_STAHJ      YEMVTNRDDNMSQHQILYKKLSGILNVTL---------------
MEND_STAS1      YEIMTHREDNKQQHLKLYKKLSDIIDVTL---------------
MEND_BACFN      MEVFTNKNKDARILKDYYHQLKN---------------------
MEND_BACFR      MEVFTNKNKDARILKDYYHQLKN---------------------
MEND_BACTN      MEVFSNKNKDARILKDYYHQLKQK--------------------
MEND_BACV8      LEVFTDKEKDTTLLREYYHGLKNKNE------------------
MEND_PARD8      MEVFTDKAEDVRLLKEYYHQLKNSSQAQNI--------------
MEND_FLAJ1      LEVFTPTFENDVILKQYFKELT----------------------
MEND_FLAPJ      LEVFTPTKVNDLVLLNYFKNLT----------------------
MEND_GRAFK      LEIFTPRKINDEVLLEYFNFMKS---------------------
MEND_PORGI      LEVETPRFENAPVLKSYFTYISGESYPVNR--------------
MEND_CYTH3      LEIETDSVKNTEVFKRFKKTIQQSYLS-----------------
MEND_DESPS      LEVFVDPTKRD---------------------------------
MEND_NOSS1      LELRTNRKIDAQWRRDNLSNFAADNII-----------------
MEND_TRIV2      LELRTNRKIDAQWRRDNLSNFAADNII-----------------
MEND_TRIEI      LELQTDRQLDARWRLDNLDTFIDL--------------------
MEND_MICAN      LEISCDRAFNTQWFLSNYV-------------------------
MEND_ACAM1      LEISCDCQNDTQWRRIFFKECVKSL-------------------
MEND_SYNJA      LEILTDRRADARRRQEWFRRWSELPSTL----------------
MEND_SYNJB      LEILTDRKADAQRRRDWFQQWSELPSKP----------------
MEND_SYNP6      LHLFTDRRQNAAWRRALFAELAAIPSQS----------------
MEND_SYNE7      LHLFTDRRQNAAWRRALFAELAAIPSQS----------------
MEND_THEEB      LEFRSDRHRNAQWRQQVLAHLGG---------------------
MEND_SYNY3      LEIIGDRHQEAQWLKSLQAQFCCADSLIQ---------------
MEND_BDEBA      IELSPNWEHTQEFWKEYDLLWKE---------------------
MEND_PARUW      IELVPDPSATDRLRKKMQRM------------------------
MEND_PROM0      IKVDIDPENEIYEKNALLEKIIGS--------------------
MEND_PROM2      IKVDIDPENEIFEKNALLEKIIGS--------------------
MEND_PROM9      IKVDIDPENEISDKNALLEKIIGS--------------------
MEND_PROMS      IKVDIDPQNEICEKNSLLEKIIGS--------------------
MEND_PROM5      IKVDINVDNEMKERSLILKKILNN--------------------
MEND_PROMP      IKVDINVENEMKGRNLILKKILTS--------------------
MEND_PROM1      IRVCTNSIEDHRLRVNLSDDLKKTLSENLSSFD-----------
MEND_PROMT      IRVCTNSIEDHRLRVNLSDDLKKTLSENLSSFD-----------
MEND_PROMA      IRACTNSEEDTLLRKNITDGLKKYIN------------------
MEND_PROM3      IRVCTHRGQDSSMRQQLREGLVMHLQSISQNGHIDL--------
MEND_PROMM      IRVCTHRRQDSSMRQQLREGLMMHLQSISQNGHIDL--------
MEND_SYNPW      LRVCTNRGADAALRQMLRREVEQALCVVQGSTKEG---------
MEND_SYNS3      LRVCTDRSSDAQLRRNLRKALQQSKSLS----------------
MEND_SYNPX      LRLATDREADARLRTQLRSAAQNAEPLL----------------
MEND_SYNSC      LRLCSDRGRDAVLRQQLRAAAQNEGTEL----------------
MEND_SYNS9      LRVCTDRHADAAFRRKLRSAAQNVEPGV----------------
MEND_SYNR3      LRCSTDRSRDAQLRQQLRDKPWWEQTPAP---------------