CLUSTAL format seed alignment for MF_01660

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

MENH_BACSU            -------------------------MGTVNITVSDGVRYAVADEGPNASEAVVCLHGFTG
I0JPY5_HALH3          -----------------------------MLIKAEERNYWIEDTG--SGPVWLLLHGFTG
B7GK10_ANOFW          -----------------------------MKFVVGGQTYYVEMYG--SGQPLLLLHGFTG
B7JDD8_BACC0          -----------------------------MNITLQGVSYEYEVVG--SGEPLLLLHGFTG
Q92AY6_LISIN          -----------------------------MLVNGQHYHLINDISG--EKPVLLMLHGFTG
Q8Y6L0_LISMO          -----------------------------MLVNGQHYHLTAAISG--EKPALLMLHGFTG
B1YK26_EXIS2          -------------------------------MKLRHQEYHVEISG--SGPPLLLLHGFTG
Q5HQC4_STAEQ          -----------------------------------MLHYNFYESKNQSKQLLVMLHGFIS
A0A269XJM9_9STAP      -----------------------------------MLYHNFYQSKSSSKQLIVLLHGFIS
Q2FZL6_STAA8          -----------------------------------MTHYKFYEANVETNQVLVFLHGFLS
J9YJF1_LEUGJ          -------------------------MNRKIVTVAGYSYHVFHQINDETATKWVLLHGFMG
K0D9W7_LEUCJ          -------------------------MNEQVLNINGYNYHIFCHVNSQVSEHWVLLHGFMG
Q838J8_ENTFA          ----------------------------------MQYHYQWLTPFDAKRTTVVCLHGFTG
Q9CHK1_LACLA          ------------------------MKIDKKIITIDGFDYAVRIWG--TGEVLFALHGFSE
A2RM74_LACLM          ------------------------MKIDKKIMTIAGLDYAVSIWG--SGKIIFALHGFSE
R4K8L8_CLOPA          -----------------------------MIIEIENIKYHVQIKG--KGKPIIYLHGFSE
A9WBD4_CHLAA          -------------------MRDRHRAEDTTVKITINDITLHIEITGSGP-ALLAIHGFTG
D3F0D2_CONWI          --------------------------------------------MAARA-TIVLLHGFTQ
L7UH13_MYXSD          -----------------------------------MAVTLAYETWGEGSRPLVLLHGFTG
G8TVU4_SULAD          -----------------------------MLAIDELLTRYRPRQAGQSQPVWLLLHGFTG
B3EMZ6_CHLPB          -----------------------------MKIVTSGCTFHAAATGRGKRNGIFLLHGFLG
Q8KBE3_CHLTE          ---------------------------------MTTISLHLTTVGDPALPKIVFLHGFLG
MENH_PECAS            ------------------------------MTHGAVAPIQ---------PWLVCLHGLFG
C6CBR6_DICP7          ---------------------------MQGRQVGQARPGA---------PWLVILHGLLG
MENH_YERPE            ---------------------------MTTLACRKLAPHPESPRHQHAGPWLVWLHGLLG
MENH_SERP5            -----------------------------MLATKVLQQGE------ADRPWLIWLHGLLG
MENH_SALNS            -----------------------------MMLHAQHMPGQPGTP------SLVFLHGFSG
MENH_SALDC            -----------------------------MMLHAQHMPGQPGTS------SLVFLHGFSG
MENH_SALG2            -----------------------------MMLHAQHMPGQPGAP------SLVFLHGFSG
MENH_SALTY            -----------------------------MMLHAQHMPGQPGTP------SLVFLHGFSG
MENH_SALTI            -----------------------------MMLHAQHMPGQPGTP------SLVFLHGFSG
MENH_SALA4            -----------------------------MMLHAQHMPGQPGAP------SLVFLHGFSG
MENH_CITK8            -----------------------------MILRAQANGGQPGSP------WLVFLHGFSG
MENH_ECOUT            -----------------------------MILHAQAKHGKPGLP------WLVFLHGFSG
MENH_ECO81            -----------------------------MILHAQAKHGKPGLP------WLVFLHGFSG
MENH_ECOLI            -----------------------------MILHAQAKHGKPGLP------WLVFLHGFSG
MENH_SHIFL            -----------------------------MILHAQAKHGKLGLP------WLVFLHGFSG
MENH_SHIDS            -----------------------------MILHAQTKHGKPGLP------WLVFLHGFSG
MENH_KLEP7            -----------------------------MILSAAVDNGQPGYP------WLVFLHGFSG
MENH_KLEP3            -----------------------------MTLSAAVDNGQSGYP------WLVFLHGFSG
MENH_CROS8            -----------------------------MPLTAYFQPARAAARG-----TVVWLHGFLG
A4SS25_AERS4          ---------------------------------MASNPNSQELP-------LVLLHGLLG
MENH_HAEIN            ------------------------------------------------MINIIFLHGLLG
A4MXM7_HAEIF          ------------------------------------------------MINIIFLHGLLG
X2JR05_AGGAC          -----------------------------------------------MKPYLVFLHGLLG
Q0I317_HAES1          -----------------------------------------------MMPILVFLHGLLG
W0RAD5_BIBTR          --------------------------------------MLAYQWLAAHGTPVVFLHGLLG
A7MZS1_VIBCB          -------------------------------MLYSERFPATEKHQGGILPTLVFLHGLLG
S5J4F1_VIBPH          -------------------------------MLHSERLSPTEKHQSGDLPTLVFLHGLLG
Q9KQM4_VIBCH          -------------------------------MLSNQLHFAKPTART---PLVVLVHGLLG
B7VHY6_VIBA3          -------------------------------MLYSNYYPAVQESSDK--PLLVFLHGLLG
Q5E481_ALIF1          ------------------------------MPLYSNQLETMKNTTQ---PCVVFLHGLLG
A1SRV1_PSYIN          ------------------------------MPLFSQTQGSPQSP------ALVFLHGFLG
A4Y258_SHEPC          -------------------------------MPTMARYGETSLP------VLVLLHGFLG
Q8E8T3_SHEON          -------------------------------MSTLARYGEVSQP------NLVLIHGFLG
I0AJ72_IGNAJ          ---------------------------MELFFKGIKLNVEIPKEFDASKDTVIFIHGFTG
C8WNX3_EGGLE          MSAVETRRFSCGGASFSFQVWKAPAAEASAADLAPDEGCAIAAACRESAVPLILLHGFAQ
Q2LX92_SYNAS          ---------------------------------MTATVLSCEEFGSPDRGVFIFLHGFMG
                                                                          . :**:  

MENH_BACSU            SKQSWT-FLDE------MLPDSRLIKIDCLGHGETDA--PLNG-KRYSTTRQVSDLAEIF
I0JPY5_HALH3          STHTFDDFLHH------MNNECRLIKIELPGHARTGP--IGT----VSMEKFCLDLAMIL
B7GK10_ANOFW          SCQTWHPFIST------WSQHMQCIAIDILGHGRTDA--PSAV-QRYDIEIVAKDIATLL
B7JDD8_BACC0          SMETWRSFVPS------WSEQFQVILVDIVGHGKTES--PEDV-THYDIRNAALQMKELL
Q92AY6_LISIN          SSETFQDSISL------LKEHFSIIAPDLLGHGKTSC--PKEV-ARYSIENICDDLASIL
Q8Y6L0_LISMO          TSETFQDSISG------LKKRFNIIAPDLLGHGNTAS--PEEI-SSYTMENICEDLAGIL
B1YK26_EXIS2          SSATWDLFGSR------LQSDYTVYRIDLLGHGRT-A--SASY-QRMRLTEQVKDLKSLL
Q5HQC4_STAEQ          DATTYHSHIER------LVEHTNVLTIDLPGHGLDTS--SMD--EVWDFPFITRQLDEVL
A0A269XJM9_9STAP      DGTTFDNHIDK------LTEQTNVLVVDLPGHGEDGT--SMD--IEWSFDFINQALNQVL
Q2FZL6_STAA8          DSRTYHNHIEK------FTDNYHVITIDLPGHGEDQS--SMD--ETWNFDYITTLLDRIL
J9YJF1_LEUGJ          THHDFDALI--------DELPGEVMTFDLLGFGESAN--IVDDPTRFEMAAQIADIQMIL
K0D9W7_LEUCJ          SHHDFNAIV--------EHLPGTVLTLDLLGFGSRAP--YVEEPKRFDMFAQITDLQLIL
Q838J8_ENTFA          TLATFAAVFP-------SQTPYNVLGIDLPGHGATAS--LVA-PERYTMKQVCHDIAELT
Q9CHK1_LACLA          SSNTWRNLH---------LAGYKIVAIDLLGHGSSAK--PKELAPYKLDAILKNLHLLFA
A2RM74_LACLM          SSSTWQKLS---------LTGYEIVAIDLLGHGSSAK--PDTLAPYKLDQVLSDLHLLFT
R4K8L8_CLOPA          NLSTWSLLK---------LEGYQLILIDFIGHGKSDK--PYSSKYYSLKIMIKHLNKLIY
A9WBD4_CHLAA          SGQTWQPLVPT------LAQDHTLVLVDLIGHGASAA--PPDP-HRYTIEQCVTDLLTLL
D3F0D2_CONWI          TGRSWDPVVAA------SAERYRALAPDLRGHGAASA--RRPV-DFASIEADVLALAP--
L7UH13_MYXSD          NRASFQGLRPL------MGRSVRAIAVDLPGHGATPL--PERK-GRDGFLETVDALVALV
G8TVU4_SULAD          SQASWDNLTER------MAPWVRVVRVDLPGHGSHQI--TRR--DEALISRTADELETIM
B3EMZ6_CHLPB          SGNDWQYYADR------LRENFDCIMPDLPGHGTT-L--STDMTPRSF-EEIAGQLAEAA
Q8KBE3_CHLTE          SGSDWLSFARK------LENRFCSILVDLPGHGEAGI--PADGDPKLFFMQTVEALKSNI
MENH_PECAS            SGEDWSPVLP-------FFRDWPMLLVDLPGHGASR------AITTADFAEVSRQLTATL
C6CBR6_DICP7          SGDDWQPLLP-------HLADWPVLLVDLPGHGLSR------DCRTDGFPDVSRQLNALL
MENH_YERPE            SGQDWLPVAQ-------LCGDYPSLLIDLPGHGQSV------SLSADGFADISRQLSQTL
MENH_SERP5            NNNEWRVIAS-------RCPEWPSLAIDLPGHGDSV------AVVCTSFDDISAQISATL
MENH_SALNS            DCREWQPVGE-------QFHGCSRLYIDLPGHGGSA------AIPVGGFADVIRLLRATL
MENH_SALDC            DCREWQPVGE-------QFHGCSRLYIDLPGHGGSA------AIPVGGFADVIRLLRATL
MENH_SALG2            DCREWQPVGE-------QFHGCSRLYIDLPGHGGSA------AIPVGGFADVIRLLRATL
MENH_SALTY            DCHEWQPVGE-------QFHGCSRLYIDLPGHGGSA------AIPVDGFADVIRLLRATL
MENH_SALTI            DCREWQPVGE-------QFHGCSRLNIDLPGHGGSA------AIPVGGFADVIRLLRATL
MENH_SALA4            DCREWQSVGE-------QFHGCSRLYIDLPGHGGST------AIPVGGFADVIRLLRATL
MENH_CITK8            DCREWQQIGE-------QFPDFSRLYIDLPGHGDSA------DIRVSGFADVCDLLRNTL
MENH_ECOUT            DCHEWQEVGE-------AFADYSRLYVDLPGHGGSA------TISVDGFDDVTGLLCKTL
MENH_ECO81            DCHEWQEVGE-------AFADYSRLYVDLPGHGGSA------TISVDGFDDVTGLLCKTL
MENH_ECOLI            DCHEWQEVGE-------AFADYSRLYVDLPGHGGSA------AISVDGFDDVTDLLRKTL
MENH_SHIFL            DCHEWQEVGE-------AFADYSRLYVDLLGHGGSA------AISVDGFDDVTDLLRKTL
MENH_SHIDS            DCHEWQEVGE-------VFADYSRLYVDLPGHGGSA------AISVDGFDDVTDLLRKTL
MENH_KLEP7            DRNEWRKVGD-------AFPAWPRLYLDLPGHGGSA------DIAVQDFAGVNTLLQSTL
MENH_KLEP3            DRDEWREVGD-------AFPAWPRLYLDLPGHGGSA------DIAVQDFAGVNTLLLATL
MENH_CROS8            DHREWQTVAA-------ACVEHNHLFIDLPGHGGSA------HLCAVDFAHVNEQLIATL
A4SS25_AERS4          DGRDWQPVIE-------ALPGIDCHALDLPGHGSNQ------GLSVTGFEQAHQWLCDAL
MENH_HAEIN            TKNDWQKVIE----NLPHFNC---IALDLPFHGQAK------DLEVTNFEDSAEYLAQQI
A4MXM7_HAEIF          TKNDWQKVIK----NLPHFNC---IAIDLPFHGQAK------DIEVTNFEETAEYLSQKI
X2JR05_AGGAC          TQADWQKLTE----NLPHFHC---IALDLPWHGSAK------NHPAKNFDEACAYVAQQI
Q0I317_HAES1          TKQDWQYIIEELKKNLPHFSSQSYLCLDLPFHGEQT------NYHIEDFEQSAQYLSRQI
W0RAD5_BIBTR          SREDWAEVFS----VLQNISEIRPLAIDLPFHHHSA------NIACRSFAEVRQQLHQTL
A7MZS1_VIBCB          SGEDWQQCLSAL----PQYDR---VTIDLPGHGHSQ------SIFCSDLNDCCKLLNSAL
S5J4F1_VIBPH          SGADWQACLDEL----TQFER---VVIDLPGHGRSQ------FTKCNDLDDCCKLLNSTL
Q9KQM4_VIBCH          SGADWQPVLSHLA--RTQCAA---LTLDLPGHGTNP------ERHCDNFAEAVEMIEQTV
B7VHY6_VIBA3          SGDDWSACHPFL----EDFPR---LCIDLPGHGQSR------FIDPVGFDHCCTKIVQCV
Q5E481_ALIF1          STKDWSSIAAKVA---KTHPV---LLIDLPGHGNSQS---TLLDHNEGFEQSCQLIVEQL
A1SRV1_PSYIN          SHQDWCETIK------QLKKSFYCISIDLPGHGDSAS---VTIPKDKGFETTHRLIKNVL
A4Y258_SHEPC          TKADWLPLMP------VLSQHFHCICVDLPGHGDNQD--ELAPTELEGFSQCVENVIAHL
Q8E8T3_SHEON          SKADWLPLIP------QLSQHFHCICLDLPGHGDNQP--EIASMLTNGFDFCVQDIINRL
I0AJ72_IGNAJ          CAEDWFPIIEQ------LPDSFNYAAIDLIGHGKSDK--P-VNPDYYTTESIIEQIKFIK
C8WNX3_EGGLE          SSASWNATASEL-----AATGRPVYALDLVGHGGSER--P-ANPRAYALDAQGEALLAFA
Q2LX92_SYNAS          NGRSLQALAAA------LGGTHRCIAFDLPGHGRSLLRCSDSLKALKTFEDAASLILRDL
                                                 :   .                            

MENH_BACSU            DQLKLHK-------VKLIGYSMGGRLAYSFAMTY------PERVSALVLESTTPGLKTLG
I0JPY5_HALH3          DKLGVEE-------INILGYSLGGRTALSFTLLY------PKRVNRLILESASPGLPSEL
B7GK10_ANOFW          EQLEIKK-------AHVLGYSMGGRLALTFAVLY------PQYVQTLILESSSPGLKTEE
B7JDD8_BACC0          DYLHIEK-------AHILGYSMGGRLAITMACLY------PEYVRSLLLENCTAGLERED
Q92AY6_LISIN          HQLKIDS-------CFVLGYSMGGRVATAFAAKY------KELVRGLVLVSSSPGLRDEK
Q8Y6L0_LISMO          HQLNVSR-------CFVLGYSMGGRVATAFAATF------PKRVRGLILVSSSPGLEQED
B1YK26_EXIS2          ATRE-ED-------WSVLGYSMGGRIALLLAAT-------SKQVKQTIAVSTTPGLRSAH
Q5HQC4_STAEQ          IQYQTYD-------VFLLGYSMGGRVALYYAIHG------NETLSGLLLVSTSAGIQNET
A0A269XJM9_9STAP      SEYQQYQ-------LYLFGYSMGGRVALYYALHG------SIELAGLILESTSPGIQSEE
Q2FZL6_STAA8          DKYKDKS-------ITLFGYSMGGRVALYYAING------HIPISNLILESTSPGIKEEA
J9YJF1_LEUGJ          QTYHWSN-------INLLGYSMGGRLALGFAFSH------NELVDQLFLESASAGLNSAL
K0D9W7_LEUCJ          KKLNWTH-------INLLGYSMGGRLALGFAVKY------PNLVKNLYLESSTAGLQYAV
Q838J8_ENTFA          ESLNLPC-------FCLLGYSMGARTALGFALHY------PQKVQHLLLESGSPGLATAA
Q9CHK1_LACLA          QFTDGNS-------FSLLGYSMGGRLALRYCLAYP-----SAPVKYLILESTGPGLLSSE
A2RM74_LACLM          QFADGKP-------FSLLGYSMGGRLALRYCLAYP-----SAPVEKLILESTGPGIFSIS
R4K8L8_CLOPA          KLG-LKK-------YSMLGYSMGGRIALAYATAY------SHEIDKLILESSSYGEVGFI
A9WBD4_CHLAA          DYLGIEH-------TDLLGYSMGGRIGLLL------TAHAPTRIRRQILIGASPGLADPA
D3F0D2_CONWI          -----PR-------FTLAGYSMGGRIALDLALRGDGTGAAQERIERLVLIGASPGLEDPT
L7UH13_MYXSD          DKLGVGT-------VDLLGYSQGARIALAA------AVRAPDRFGRLIMESGSPGLHRRQ
G8TVU4_SULAD          QHLGYPH-------YGVLGYSMGGRVALHL------ARQYPQAVSRLILESASPGIADPT
B3EMZ6_CHLPB          SRCHPCP-------LHLVGYSMGGRLALYLALHY------PGIFRSAVIISSSPGLNTAA
Q8KBE3_CHLTE          RRLRAEP-------CVLVGYSMGGRIGLALALLY------PELFSKAIIVSSSPGLQTDE
MENH_PECAS            LEQGIE-------RYWLLGYSLGGRIAMYHACEGHHDG-----MLGLLVEGGHPGLATPE
C6CBR6_DICP7          AQQGIE-------TYWLMGYSLGGRIAMYHACHGDSSG-----LRGLLVEGGHPGLTTAA
MENH_YERPE            QANGIR-------EYWLAGYSLGGRIAIYHACYGRHHG-----LQGLLVEGGNLGLENAE
MENH_SERP5            QMHGIE-------RYWLVGYSLGGRIAMYHACHGEPRG-----LQGVIIEGGNPGLADAA
MENH_SALNS            ISYNIL-------KFWLVGYSLGGRVAMMAACQG-IPG-----LCGLVVEGGHPGLQNEQ
MENH_SALDC            ISYNIL-------KFWLVGYSLGGRVAMMAACQG-IPG-----LCGLVVEGGHPGLQNEQ
MENH_SALG2            ISYNIL-------KFWLVGYSLGGRVAMMAACQG-IPG-----LCGLVVEGGHPGLQNEQ
MENH_SALTY            ISYNIL-------KFWLVGYSLGGRVAMMAACQG-IPG-----LCGLVVEGGHPGLQNEQ
MENH_SALTI            ISYNIL-------KFWLVGYSLGDRVQMIASCQG-IPG-----LCGLVVEGGHPGLQNEQ
MENH_SALA4            ISYNIL-------KFWLVGYSLGGRVAMMAACQG-IPG-----LCGLVVEGGHPGLQNEQ
MENH_CITK8            FSYNIL-------KYWLVGYSLGGRVAMMAACQT-LPG-----FCGLVVEGGHPGLQREA
MENH_ECOUT            VSYNIL-------NFWLVGYSLGGRVAMMAACQE-PAG-----LCGVVVEGGHPGLQNAE
MENH_ECO81            VSYNIL-------NFWLVGYSLGGRVAMMAACQE-LAG-----LCGVVVEGGHPGLQNAE
MENH_ECOLI            VSYNIL-------DFWLVGYSLGGRVAMMAACQG-LAG-----LCGVIVEGGHPGLQNAE
MENH_SHIFL            VSYNIL-------DFWLVGYSLGGRVAMMAACQG-LAG-----LCGVIVEGGHPGLQNAE
MENH_SHIDS            VSYNIL-------DFWLVGYSLGGRVAMMAACQG-LAG-----LCGVIVEGGHPGLQNAE
MENH_KLEP7            NSYNIH-------KYWLIGYSLGGRVAMNFASQP-RAG-----MRGLIVEGGHPGLQDAE
MENH_KLEP3            NSYNIL-------NYWLIGYSLGGRVAMNFACQP-RAG-----LRGLIVEGGHPGLQDAE
MENH_CROS8            NSYNIL-------EYWLVGYSLGGRIAMFHATQGNTPG-----LRGLVVEGGHPGLLNAD
A4SS25_AERS4          KALGIE-------QYRLAGYSLGGRLALYHASQS-PAG-----LQALLLENCHPGLPLAE
MENH_HAEIN            KSAVKN------GPYFLVGYSLGGRIALYYALQAQLER---SNLQGVILEGANLGLKTDE
A4MXM7_HAEIF          KSAVKN------EPYFLVGYSLGGRIALYYAMQAQVER---SNLQGVILEGANLGLKTDE
X2JR05_AGGAC          QSAVGN------QPYFLIGYSLGGRIALYYALHSNCEK---YNLLGLIIEGGNLGLTDEQ
Q0I317_HAES1          TAKIAD------KPYILVGYSLGGRLALNYALQSKYPQ---SKLVALILEGANLGLENEQ
W0RAD5_BIBTR          QYCLGN------QPFYLVGYSLGGRLALDYLCHMHNP-----HLQGALLEGANVGLASQQ
A7MZS1_VIBCB          SLLFPS-----QQPLILIGYSMGGRIAMHGLAHQCFPE---PNICGAIVEGGNFGLQSES
S5J4F1_VIBPH          SLLFPP-----QQPLILIGYSMGGRIAMHGLAGECFSD---LNIVGAIVEGGNFGLQTES
Q9KQM4_VIBCH          QAHVTS-----EVPVILVGYSLGGRLIMHGLAQGAFSR---LNLRGAIIEGGHFGLQENE
B7VHY6_VIBA3          TYQLAANDLPADYPIVMIGYSMGGRLAMYGVTSPCFET---LNLEKVIIEGGNFGLVCDE
Q5E481_ALIF1          EK--SP-----YQTFILVGYSLGGRLAMYLHAMYSLPSS--IEVKGLCIEGGNFGLVSEE
A1SRV1_PSYIN          NDLKIK-------EYILIGYSLGGRIALDYARTQQDQH-----LKALVLESCHTGYQTQD
A4Y258_SHEPC          DGLHIG-------QFHLYGYSLGGRIALHLANTYPQRL------LSLTLESCHPGLDDLE
Q8E8T3_SHEON          DRLGIE-------AFYLYGYSLGGRIALHLAKAYPNRV------LSLWLESCHPGLTNTE
I0AJ72_IGNAJ          DKLTSSN------PAILIGYSMGGRAALSFATTH------PKEIKGLILESSSAGIKNDA
C8WNX3_EGGLE          RLIADVE----GVRPAVLGYSMGGRVTLAALRRD------PRAFSAVILEAAGFGPATQA
Q2LX92_SYNAS          DTLGINR-------FSLYGYSMGGRVAQNVALLA------PERIERLVLESASFGIADPE
                                      : *** * *                             *     

MENH_BACSU            ERRERIMRDR-KLADFILRDGLEAFVAYWENIPLFSSQQRLAEDIRYRIRSGRLRNNK-I
I0JPY5_HALH3          ERRERRAKDQ-RLAGLLYREGIKSFVKYWESLPLFETLNRLPEQRRKTLREERTSHSV-E
B7GK10_ANOFW          ERMKRRKEDE-RLAQFIEKHGVASFVDRWENIPLFSSLQRLPKSVQQRLREERLQHTA-I
B7JDD8_BACC0          ERKERCEKDE-RLADKIEREGIESFVTMWENIPLFETQKSLAQNVQEAVRKERLANNS-N
Q92AY6_LISIN          ARASRISADN-RLADTLDADGIEPFVAYWENLALFASQKNLPFALKKRIRLERLAQNP-H
Q8Y6L0_LISMO          IRASRVEADN-RLADWIEEEGLVPFVDYWENLALFASQKVLSPEMKRRIRSERLSQNS-H
B1YK26_EXIS2          ERRLRRQADR-RLADRLLTDGLADFIDYWESLPLFASQRHLPVEVQESIRRGRLAQSP-E
Q5HQC4_STAEQ          DKVERAQVDA-ARAKVLEIAGLDIFVNDWEKLPLFRSQYNLAPEIRQSIRNNRLNQDA-N
A0A269XJM9_9STAP      DRIERQQVDA-ARAKVLEIAGLEIFVNDWERLPLFQSQYDLDKSVKKQIRDNRMSQNP-H
Q2FZL6_STAA8          NQLERRLVDD-ARAKVLDIAGIELFVNDWEKLPLFQSQLELPVEIQHQIRQQRLSQSP-H
J9YJF1_LEUGJ          NRKKRRAADT-EKAKQILTD-FHEFVLNWEKLPLFATQKKLTATQRQVIRAQRLAQQP-Q
K0D9W7_LEUCJ          ERQQRIVNDE-KKAQEIECD-FPEFVKQWEQMPLFNTQKYLPVTQQLAIRQQRLSQHP-K
Q838J8_ENTFA          ERQARICQDH-RLAERLLEEPLVDFIDFWQELPLFQTQKALSVAQQMAIRQERLSQSA-F
Q9CHK1_LACLA          DRKKRRLADE-ELGQKILLNGAAWFADFWANISLFESQKKLSVKIQQEIWESRASNSP-L
A2RM74_LACLM          DREKRQFTDE-ELAQKILLNGSEWFANFWGNLSLFNSQKKLSVRIQKEIWQRRANNSP-L
R4K8L8_CLOPA          NRFKRRRKDL-NLAKSILTNGIEWFNKYWSNLSIFESQRKLPNTIIDEIRKRRLSNIT-Y
A9WBD4_CHLAA          ERTARLASDE-ALARLIEERGLEWFVDYWAAQPIFASQQRLPPAVLAAQRAQRLAGSA-Q
D3F0D2_CONWI          ERAARRAADD-ALAHEIERDGVEPFARRWAAQPLFAGQ---PPVVAAAAHAERLRSTP-D
L7UH13_MYXSD          ERAARREADG-QLATFIRARGVDAFVERWEALPLFDGLRAMPTERRETLRAHRRACSS-E
G8TVU4_SULAD          EREARRQSDA-QLAQNIRERGILWFVDYWSSQPLFADQ---PEDVRHQENRIRRQQSP-E
B3EMZ6_CHLPB          ERDRRMESDS-ILAESIRDN-YHRFLDNWYNLTLFEPLKQHPLFPEVLQR--RYTNDP-A
Q8KBE3_CHLTE          KRASRRKSDE-GIARKIERN-FEGFIGFWYDQPLFSTLKSHSLFREVEAQ--RKQGTP-Q
MENH_PECAS            QRTERIHHDA-RWAQRFRQDPLPEALQDWYQQAVFADIDSVQREQLIARRSANHGAS---
C6CBR6_DICP7          EREARALHDA-GWAQRFRREPIGQVLADWYRQPVFADLSDAQRAALTERRAHNQGNA---
MENH_YERPE            LRQARLQQDR-QWAQRFRQEPLPQVLDDWYQQAVFADLDPQQREQLVLLRADNHGPA---
MENH_SERP5            QRELRLAHDT-AWAERFRREPLAQVLADWYQQPVFANLSAVHRDALIDARSDNAGAA---
MENH_SALNS            ARAERRLSDG-RWAERFRHEPLTEVFHDWYQQPVFASLTAQQRQALTALRSQNNGET---
MENH_SALDC            ARAERRLSDG-RWAERFRHEPLTEVFHDWYQQPVFASLTAQQRQALTALRSQNNGET---
MENH_SALG2            ARAERRLSDG-RWAERFRHEPLTEVFHDWYQQPVFASLTAQQRQALTALRSQNNGET---
MENH_SALTY            ARAERRLSDG-RWAERFRHEPLTEVFHDWYQQPVFASLTAQQRQALTALRSQNNGET---
MENH_SALTI            ARAERRLSDG-RWAERFRHEPLTEVFHDWYQQPVFASLTAQQRQALTALRSQNNGET---
MENH_SALA4            ARAERRLSDG-RWAERFRREPLTEVFHDWYQQPVFASLTAQQRQALTALRSQNNGET---
MENH_CITK8            ERDARRRSDG-RWAARFRREPLRDVFTDWYQQPVFASLDASQREALVALRSQNNGET---
MENH_ECOUT            QRAERQRSDR-QWAQRFRTEPLTAVFADWYQQPVFASLNDDQRRELVALRSNNNGAT---
MENH_ECO81            QRAERQRSDR-QWAQRFRTEPLTAVFADWYQQPVFASLNDDQRRELVALRSNNNGAT---
MENH_ECOLI            QRAERQRSDR-QWVQRFLTEPLTAVFADWYQQPVFASLNDDQRRELVALRSNNNGAT---
MENH_SHIFL            QRAERQRSDR-QWAQRFRTEPLTAVFADWYQQPVFASLNDDQRRELVALRSNNNGAT---
MENH_SHIDS            QRAERQRSDR-QWAQRFRTEPLTAVFADWYQQPVFASLNDDQRRELVALRSNNNGAT---
MENH_KLEP7            ARQARRSNDS-AWAERFRREPLEQVFADWYQQPVFASLNAAQRESLVALRSRNNGAT---
MENH_KLEP3            ARQARRSNDR-AWAERFRRDPLAQVFADWYQQPVFASLDAAQRESLVALRSRNNGAT---
MENH_CROS8            ERDARFVADK-QWAQRFHDEPIETVLDAWYRQPVFATLTDAQRQELITLRACNAPTA---
A4SS25_AERS4          -RAARIEHDE-GWARRFEREPLTEVLADWYQQGVFADLDEAARARQIAGRLGNQGPA---
MENH_HAEIN            EKQARFQQDF-AWAQRFMQESPEKVLNDWYQQPVFSHLTTEERLQLVEKRKSNCGKN---
A4MXM7_HAEIF          EKQARFQQDF-AWAQRFVQELPENVLNDWYQQPVFSHLTAEERLQLVEKRKSNCGEN---
X2JR05_AGGAC          AKKVRWKNDV-FWAQRFRYETAESVLNDWYQQAVFAHLTEHQRNALIEKRRANCGEN---
Q0I317_HAES1          QRLERWQNDL-AWAKRFSQETMSKVLNDWYQQPVFAHLSARERKQLISQRRHQSGQN---
W0RAD5_BIBTR          ARQRRWQNDN-DWAKRFQYEPIEQVLKDWYQQAVFADLDTRKRAEFLQKRQKNDGKL---
A7MZS1_VIBCB          DRQARFDNDS-RWAKRFKTEPLACVLNDWYQQLVFSSLNHEQRQTLVAKRSANLGSA---
S5J4F1_VIBPH          EIQSRLHNDQ-KWALRFESEPLERVLSDWYQQAVFSSLNHEQRQTLITKRSANLGSA---
Q9KQM4_VIBCH          EKAARWQHDQ-QWAQRFSQQPIEHVLSDWYQQAVFSSLNHEQRQTLIAQRSANLGSS---
B7VHY6_VIBA3          ERAQRLVHDT-QWAVRFAQQSIEDVLDDWYQQSVFSSLNHEQRQTLVIKRSGNLGVS---
Q5E481_ALIF1          EKLLRLENDI-QWAKRFEELPIVDVLDNWYQQAVFSSLNPEQRQVLVTKRSDNLGPA---
A1SRV1_PSYIN          EKDKRFAHDL-SWAKRFATQSIRQSLNQWYEQDIFNDLSCEQKNNLFNKRSRNYGVC---
A4Y258_SHEPC          EKTTRASNDA-LWADRLMRLSSKEFLALWYQQAVFADMGTTKRQSLIDLRTKALDQHPKQ
Q8E8T3_SHEON          EQAARSKNDQ-LWAKRLHSLSSRDFLQLWYQQAVFADMSDNVRNTLIAKRAAQLDQHPKH
I0AJ72_IGNAJ          ERKKRYEDDL-NLVQFIHDHTMEEFIELWYDQEMFNTQRRFSNDKIKKLHRKKYDNSK-I
C8WNX3_EGGLE          EREAVAKRDA-ACATRLRADGLEAFMDFWEQLPLFASQRDLPPDVRERLRAGRMANDA-E
Q2LX92_SYNAS          ERLWRYFRDSILLADVRTDKDLAAFLEGWHRLPLFCTLQGTPVLQRILREKRDNDVEE--
                              *                   *    :*                         

MENH_BACSU            GLANSLTGMGTGSQPS-----LWSRVEEID-VPVLLICGEWDEKFCAINQEVHKMLPSSR
I0JPY5_HALH3          GLAESLEGMGTGSQPS-----WWEKLEEVR-ANVLLVTGGEDEKFRSINQHMEQRLFNVR
B7GK10_ANOFW          GLANSLRGMGTGAQPS-----WWGALHQLH-MPTLLICGEDDEKFCRIASEMVQLLPNGT
B7JDD8_BACC0          GLANSLRGMGTGAQPS-----WWNELQNLK-MPVLLMNGEYDEKFFRILKNIEKCVSDAK
Q92AY6_LISIN          GLAKSLRGMGTGKQPS-----YWENLADFT-FPVLLITGNLDEKFEKIAREMKQLLPNST
Q8Y6L0_LISMO          GLAMSLRGMGTGKQPS-----YWNCLANFT-FPVLLITGALDEKFEKIAQEMHQLLPNST
B1YK26_EXIS2          GLAASLIAQGTGNMAP-----VWHLLDTSS-IDWIVGND--DDKFKKIAIEAAPSE---K
Q5HQC4_STAEQ          KLAKALRDYGTGHMPN-----LWPHLSLIR-IPTLILVGEKDKKFVQIGQQLENHLQDSH
A0A269XJM9_9STAP      RLAKALRDYGTGHMPN-----LWPLLSQVD-IPTYIMAGELDEKFVKIAQKLKDSIVNSR
Q2FZL6_STAA8          KMAKALRDYGTGQMPN-----LWPRLKEIK-VPTLILAGEYDEKFVQIAKKMANLIPNSK
J9YJF1_LEUGJ          NVANSLNYMGTGVQVN-----FWPKLAQLK-LPTILLVGEFDQKFNQIADDMMMLLPNGQ
K0D9W7_LEUCJ          NVANSLRYMGTGSQPN-----FWPNLVMLQ-CPTLLLVGSLDTKFRRIASDMNQLLPHAK
Q838J8_ENTFA          GLVSSLWYMGTGAQES-----YWERLAELQPIPTDLLVGGEDQKFIGIAKKMQARQPLLR
Q9CHK1_LACLA          ALTQTLNGTGQGQLSY-----IGDKISLIK-SNILYLSGDLDEKYSKIAIEIFAPNPNVT
A2RM74_LACLM          ALAQTLRGTGQGQLDY-----IGDKISLVN-PEILYLSGDLDEKYSNIAKEIFAPNSNVT
R4K8L8_CLOPA          ALSNTLLCSGQGKFPC-----MKNHIGKLS-MPILYISGEYDKKYKQIGKDFEKLNSYTK
A9WBD4_CHLAA          GYANALRGMSVGRQPS-----LWATLPTIT-TPTLLITGALDSKFCAIAAQMTALMPHAR
D3F0D2_CONWI          GLAASLRGVGTGAMEP-----LWDDLPALR-VPVALIAGERDAKFRAIAERMAERIPHAE
L7UH13_MYXSD          GLAGALETLGLGVQPD-----YWSELHHQR-LPTLLLTGARDDKFTQTARRMAAELPVVW
G8TVU4_SULAD          GLAWSLKAAGAGSQQS-----LWPDLPRLA-MPIRLVVGERDAKYVGLARQMVQQLPQAS
B3EMZ6_CHLPB          ALADALEEMSTGRQPS-----LWEKLRENK-LPVNFFVGEKDTKYVEIGRQMVNLCPYSE
Q8KBE3_CHLTE          NLARALRLLGTGNQPS-----FWDKLPGNR-LPMLFCVGEKDAKYVDIAKQVVELCPSSS
MENH_PECAS            -VAAMLEATSLGRQPF------LAARLQHLSIPFIYLCGASDVKFQTLAAQYGLP-----
C6CBR6_DICP7          -VADMLEATSLSRQPL------LAEPLCRLNIPFGYLCGSLDNKFQALAARYRFR-----
MENH_YERPE            -VAEMLEATSLGHQPW------LLPALQRLNVPYTYLCGDRDHKFLQLAQQYRLP-----
MENH_SERP5            -VADMLEATSLGTQPC------LAPQLQQLAVPLVVLCGADDHKFQQLTRDAGLP-----
MENH_SALNS            -LAAMLEATSLAAQPD------LREALNALAFPFYYLCGERDSKFRALAQEVAAT-----
MENH_SALDC            -LAAMLEATSLAVQPD------LREALNALAFPFYYLCGERDSKFRALAQEVAAT-----
MENH_SALG2            -LAAMLEATSLAVQPD------LREALNALAFPFYYLCGERDSKFRALAQEVAAT-----
MENH_SALTY            -LAAMLEATSLAVQPD------LREALNALAFPFYYLCGERDSKFRALAQEVAAT-----
MENH_SALTI            -LAAMLEATSLAVQPD------LREVLNALAFPFYYLCGERDSKFRALAQEVAAT-----
MENH_SALA4            -LAAMLEATSLAAQPD------LREALNALAFPFYYLCGERDSKFRALAQEVAAT-----
MENH_CITK8            -LAAMLEATSLAVQPD------LRARLNARTFPFYYLCGERDSKFRALAAELSVP-----
MENH_ECOUT            -LAAMLEATSLAVQPD------LRANLSARTFAFYYLCGERDSKFRALAAELAAD-----
MENH_ECO81            -LAAMLEATSLAVQPD------LRANLSARTFAFYYLCGERDSKFRALAAELAAD-----
MENH_ECOLI            -LAAMLEATSLAVQPD------LRANLSARTFAFYYLCGERDSKFRALAAELAAD-----
MENH_SHIFL            -LAAMLEATSLAVQPD------LRANLSARTFAFYYLCGERDSKFRALAAELAAD-----
MENH_SHIDS            -LAAMLEATSLAVQPD------LRANLSARTFAFYYLCGERDSKFRALAAELAAD-----
MENH_KLEP7            -LAAMLQATSLAAQAD------LRASLQARDFPFHYLCGERDAKFRAIAQTLAAD-----
MENH_KLEP3            -LAAMLQATSLAGQAD------LRAPLQARDFPFHYLCGERDAKFRAIAQALAAD-----
MENH_CROS8            -LATMLEATSPGRQPP------LYEPLARLSVPFHYLCGERDAKFRALAATLNVP-----
A4SS25_AERS4          -VATMLRATSLGQQPN------LAPWLVSTRLPVTWISGSRDHKFHQLACQLVKQGCN-I
MENH_HAEIN            -IGKMLLATSLSKQPD------FSEKVRLSSLPFFYFCGERDHKFQVLAKENQID-----
A4MXM7_HAEIF          -IGKMLLATSLSKQPD------FSEKVRLSSLPFFYFCGERDHKFQTIAKENQIN-----
X2JR05_AGGAC          -IAQMLLATSLAKQPD------LRSAVKNSPYPIYYFCGERDHKFKHMALENQLN-----
Q0I317_HAES1          -IAKMLIATSLAKQPS------FHQKVRSFSLPIYYFCGEKDEKFKKMAQENQLN-----
W0RAD5_BIBTR          -IAQMLRATSLAKQPL------LLPPAQ---VKYCFVIGEKDQKFRQMATQYQLH-----
A7MZS1_VIBCB          -VANMLIATSLAKQSY------LLPALQQQSVPLYYLCGEKDKKFSQLAEKSGLA-----
S5J4F1_VIBPH          -IANMLMATSLAKQAY------LLPALQQQRIPIYYVCGAKDKKFSQLAQTSGLA-----
Q9KQM4_VIBCH          -VAHMLLATSLAKQPY------LLPALQALKLPIHYVCGEQDSKFQQLAESSGLS-----
B7VHY6_VIBA3          -VANMLLSTSLAKQPD------LRATLKAHEHQLHYVCGEKDRKFMELAENSGFE-----
Q5E481_ALIF1          -IGMMLRSTSLAKQPY------LLDALHRSTIPILYICGEADKKFQHLAEQSQLT-----
A1SRV1_PSYIN          -LANMLLATSLAEQTDALPF-LQKNTAQAKPLSIYYCFGEKDNKFKTLGRALAKLKNI-Q
A4Y258_SHEPC          KLQQIYLATSLAKQAS------LWNVPSQLTCECHFFAGTEDSKFSAIAEKWQQQAPI-L
Q8E8T3_SHEON          ALKHIFLATSLARQAS------LWDLPANLACESHFFAGSQDAKFTAIAKEWQAKQPI-I
I0AJ72_IGNAJ          GLMNILKGFSTGIMPP------LHDKLKTIPVKVVLISGELDSKYTFINSKIVRGFHKAK
C8WNX3_EGGLE          ALARTFEQAGQHVMPSRAETLETLAVLRAGGTPLLYLAGERDEKYRALAAQAAEAGAT--
Q2LX92_SYNAS          -LRLALKILSVGNHPS------FAERLTGQPFPLFYFCGERDEAYAGAAETMKKKIPAMR
                               .                            .  *  :               

MENH_BACSU            IEIVPKAGHTVHVEQPRLFGKIVSEFLTSI-----------------------
I0JPY5_HALH3          WVEVAGAGHTIHLEKPRVFAKIVEKFMI-------------------------
B7GK10_ANOFW          LIVFPQAGHVVHMEQRERFDTLVQQFVLRGGLLHGD-----------------
B7JDD8_BACC0          FVKIDGAGHAIHVEQPEKFDTIVKGFLKTMQ----------------------
Q92AY6_LISIN          HVTVQEAGHAVYLEQPNIFSSQLIYWLEGILKEEEK-----------------
Q8Y6L0_LISMO          HVSIQEAGHAVYLEQPNSFSSQLNYWLEDILKEEEK-----------------
B1YK26_EXIS2          IHLIEGASHAPHIDQPEKFVTIVEKLLLINQMGELK-----------------
Q5HQC4_STAEQ          KVQISNVGHTIHVEDSTEFDTIILGFLKEEQND--------------------
A0A269XJM9_9STAP      KTIVSDVGHTIHVEDSTEFDTIILGFLKEEQND--------------------
Q2FZL6_STAA8          CKLISATGHTIHVEDSDEFDTMILGFLKEEQND--------------------
J9YJF1_LEUGJ          KHVIKNAGHNMHVEQPNQVIEVLKNVSY-------------------------
K0D9W7_LEUCJ          VVTVAQAGHNVHFEAPKQVIEVLNHVSC-------------------------
Q838J8_ENTFA          LTIFPEAGHCIHLEQPTIFYEKVTALLEGAI----------------------
Q9CHK1_LACLA          WISVAASGHNIHLENPVTYQKILEEFLP-------------------------
A2RM74_LACLM          WIPVAGSGHNIHLENPSLYQKILEEFLA-------------------------
R4K8L8_CLOPA          HETIKGAGHNTHIEDPNAFIKVLSKFLSDDYPL--------------------
A9WBD4_CHLAA          HEIVPDAGHAVHLEQPDAVATLVSAFLA-------------------------
D3F0D2_CONWI          LHVVSGAGHAVQLERPEVVAALL------------------------------
L7UH13_MYXSD          RHAFADCGHAPHLEAPEEYVREVLGFLQTPWYEAPQFEGPTATAAASPGRVSP
G8TVU4_SULAD          LTVIPGAGHTVHLEQPERFWQAIKDFVVITGTTPDPHS---------------
B3EMZ6_CHLPB          LVIFPGCGHTLHIENRPLFLDRLVAFLARIP----------------------
Q8KBE3_CHLTE          LELFEHCGHTLHIEEPERFLASVERFIETHPHNSISHDDL-------------
MENH_PECAS            LLSVALAGHNAHQANPAAYAERVRTFLSH----PVKD----------------
C6CBR6_DICP7          LLTVDGAGHNAHQANPAAFGARIREFVSH----PAEE----------------
MENH_YERPE            LHTLARAGHNAHRANPGAFAAQVLAFLSQSSCLPPSSLSR-------------
MENH_SERP5            LRIVPQAGHNSHLANPQAFAAELRNFLVN----PG------------------
MENH_SALNS            CHVIRNAGHNAHRENPAGVVDSLAQILRL------------------------
MENH_SALDC            CHVIRNAGHNAHRENPAGVVDSLAQILRL------------------------
MENH_SALG2            CHVIRNAGHNAHRENPAGVVDSLAQILRL------------------------
MENH_SALTY            CHVIRNAGHNAHRENPAGVVDSLAQILRL------------------------
MENH_SALTI            CHVIRNAGHNAHRENPAGVVDSLAQILRL------------------------
MENH_SALA4            CHVIRNAGHNAHRENPAGVVDSLAQILRL------------------------
MENH_CITK8            CHMIRNAGHNAHRENPAGVVDSLAQILRL------------------------
MENH_ECOUT            CHVIPRAGHNAHRENPAGVIASLAQILRF------------------------
MENH_ECO81            CHVIPRAGHNAHRENPAGVIASLAQILRF------------------------
MENH_ECOLI            CHVIPRAGHNAHRENPAGVIASLAQILRF------------------------
MENH_SHIFL            CHVIPRAGHNAHRENPAGVIASLAQILRF------------------------
MENH_SHIDS            CHVIPRAGHNAHRENPAGVIASLAQILRF------------------------
MENH_KLEP7            LHLIHHAGHNAHRDNPAAVIACLAQILAS------------------------
MENH_KLEP3            THIIHHAGHNAHRDNPAAVIACLAQILAS------------------------
MENH_CROS8            LHLITGAGHNAHRENPAAVACCLNAILRP------------------------
A4SS25_AERS4          NHLTLDGGHNLHASQPERFASCLRDWIASTP----------------------
MENH_HAEIN            LVTIPCAGHNSHLENSKYFSKKIENCILKIVRP--------------------
A4MXM7_HAEIF          LVTIPCAGHNSHLENSKYFSKKIENCILKIARP--------------------
X2JR05_AGGAC          LTVIPNAGHNAHQENPTAFAAQLNALLEDKFVAF-------------------
Q0I317_HAES1          LFLIERAGHNAHLENPIAFANKIVEIINRT-----------------------
W0RAD5_BIBTR          YQLIEQAGHNTHQANPHAFAQMLIQFVQTP-----------------------
A7MZS1_VIBCB          YRQIEGAGHNVHQEQSQRFAMQVDQIIHSHFE---------------------
S5J4F1_VIBPH          YRQIEGAGHNVHQEQPKQFAMHIKQIIHSHFQ---------------------
Q9KQM4_VIBCH          YSQVAQAGHNVHHEQPQAFAKIVQAMIHSIID---------------------
B7VHY6_VIBA3          YSQVDYAGHNVHFEQPELFSNLIIQCIASRC----------------------
Q5E481_ALIF1          YQIIAQAGHNAHVEQPERFTHVLNTFLQQWT----------------------
A1SRV1_PSYIN          PTEFAGAGHNIHQQSPVQYARFIKQHFSQ------------------------
A4Y258_SHEPC          LHSIHGAGHNIHQMAPAALISKIVALLG-------------------------
Q8E8T3_SHEON          LHRIEQAGHNIHQANPAGLLACIRSFFVERLP---------------------
I0AJ72_IGNAJ          HKVVKNSGHNTHLEEPKRFVEIVTNYLIQLLPAQVQK----------------
C8WNX3_EGGLE          VCIIPGAGHNAHLEAPATFAKEVASFLRK------------------------
Q2LX92_SYNAS          LTVFRGASHDIHSQFPERIIRALQRLLEDESGEENAEAVSISEE---------
                             .*             :