CLUSTAL format seed alignment for MF_01668

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

IOLC_CLOBA       MGYIKFQKDRKFEIVPIGRVAIDFNPTDINRPLSKSMTFKKYLGGSPANIAVGLSRLGKK
IOLC_CLOBB       MGYIKFQKDRKFEIVPIGRVAIDFNPIDINRPLSESKTFKKYLGGSPANIAVGLSRLGKK
IOLC_CLOB8       MEYIKFDKARKMDIVPIGRVAIDFNPIDINKPLSESSTFKKYLGGSPANIAVGLARLGKK
IOLC_CLOPE       MRYIEFDEKRKFDIVPVGRVAIDFNPTDIHKPLSESRNFNKYLGGSPANIAVGLARLGKK
IOLC_CLOP1       MRYIEFDEKRKFDIVPVGRVAIDFNPTDIHKPLSESRNFNKYLGGSPANIAVGLARLGKK
IOLC_CLOTE       MNYIKFDEKKPLDVIPIGRVTIDFNPNEINRPLEESRTFTKYLGGSPGNIAVGLARLGKK
IOLC_BACAN       MNPLIFKENRPFDLIAVGRLCVDLNANETQRPMEETRTFTKYVGGSPANIAIGAARLGLQ
IOLC_BACHK       MNPLIFKGNRPFDLIAVGRLCVDLNANETQRPMEETRTFTKYVGGSPANIAIGAARLGLQ
IOLC1_BACCZ      MNPLIFKENRPFDLIAVGRLCVDLNANETQRPMEETRTFTKYVGGSPANIAIGAARLGLQ
IOLC_BACAH       MNPLIFKEDRPLDLIAVGRLCVDLNANETQRPMEETKTFTKYVGGSPANIAIGASRLGLQ
IOLC2_BACCZ      MNPLIFKEDCPLDLIAVGRLCVDLNANETQRPMEATRTFTKYVGGSPANIAIGATRLGLQ
IOLC_GEOKA       MSFLPFDQQKPLDFIAVGRLCIDLNANEIHRPMEETMTFTKYVGGSPANIAIGMARLGMK
IOLC_GEOTN       MNLLPFDEQKPLDFIAVGRLCIDLNANEIHRPMEETVTFTKYVGGSPANIAIGMARLGMK
IOLC_BACSU       -MKYTFNEEKAFDIVAIGRACIDLNAVEYNRPMEETMTFSKYVGGSPANIAIGSAKLGLK
IOLC_BACLD       -MKYTFNEEKEFDIVAIGRACIDLNAVEYNRPMEQTMTFSKYVGGSPANIAIGSSKLGLK
IOLC_BACVZ       -MKYTFNEEKEFDIVAIGRACIDLNAAEYNRPMEETMTFSKYVGGSPANIAIGSAKLGLK
IOLC_BACSK       -MGIQFQEGKQFDVIALGRACIDLNAAEYNRPMEETRSFTKYVGGSPANIAIGSAKLGLK
IOLC_ALKHC       -MTYELSTDREFDLIAIGRACIDLNAVEYNRPMEETMTFSKYVGGSPANIVIGSSKLGLK
IOLC_LISMO       -MNLKKHSERKFDLITVGRACIDLNAVEYNRPMEETMTFSKYVGGSPANIAIGTAKLGLK
IOLC_LISMF       -MNLNKHSERKFDLITVGRACIDLNAVEYNRPMEETMTFSKYVGGSPANIAIGTAKLGLK
IOLC_LISIN       -MNLNKHSERKFDLITVGRACIDLNAVEYNRPMEETMTFSKYVGGSPANIAIGTAKLGLK
IOLC_LACCA       -------MPQKFDLIAIGRAAVDLNAVEYNRPLEDTKTFAKFVGGSPANIAIGSAKLGQK
IOLC_PHOPR       MTKIALQQDRPLDAIVLGRAGVDLYAREANTDMADISGFNKFVGGSAANIAVAISKLGGK
IOLC_MYCH7       -------MKKEFDFILIGRITIDFNPTDYYNNLENSSLFKKYIGGSAANIAIGLSRLKNK
IOLC_MYCHJ       -------MKKEFDFILIGRITIDFNPTDYYNNLENSSLFKKYIGGSAANIAIGLSRLKNK
IOLC_MYCH2       -------MKKEFDFILIGRITIDFNPMDYYNNLENSSLFKKYIGGSAANIAIGLSRLKNK
                            :: : :**  :*: . :    :     * *::***..**.:. ::*  :

IOLC_CLOBA       VGFIGKVSKDQFGKFVVDYFNNEGIDTSQIKYAENGESLGLTFTEIASPTESSILMYRNG
IOLC_CLOBB       VGFIGKVSKDQFGKFVVDYFDNEGIDTSQIKYAENGESLGLTFTEIASPTESSILMYRNG
IOLC_CLOB8       IGFIGKVSKDQFGEFVVNYFDNEGIDTSQIKYSKNGENLGLTFTEIASPTESSILMYRQG
IOLC_CLOPE       VGFIGKVSDDRFGEFVVNYFKKEGIDVSEISKAKNGESLGLTFTEILSPTESSILMYRNG
IOLC_CLOP1       VGFIGKVSDDRFGEFVVNYFKKEGIDVSEISKAKNGESLGLTFTEILSPTESSILMYRNG
IOLC_CLOTE       VGFLSTVSDDQFGNFVVNYLKNEGIDISQINRAKNGEKLGLTFTEILSPKESSILMYRKG
IOLC_BACAN       TGFIGKVSDDQMGRFITGYLKDNKINTDQIPIDCTGAVTGLAFTEIKSPEDCSILMYRDN
IOLC_BACHK       TGFIGKVSDDQMGRFITGYLKDNKINTDQIPIDCTGAVTGLAFTEIKSPEDCSILMYRDN
IOLC1_BACCZ      TGFIGKVSDDQMGRFITGYLKDNKINTDQIRIDCTGAVTGLAFTEIKSPEDCSILMYRDN
IOLC_BACAH       TGFIGKVSDDQMGRFITGYLKDNKINTDQIHIDCTGAVTGLAFTEIKSPEDCSILMYRDN
IOLC2_BACCZ      TGFIGKVSDDQMGRFITRYLQDNNINTDQICIDRTGAVTGLAFTEIKSPEDCSILMYRDN
IOLC_GEOKA       TGFIGRVADDQMGRFIVRYLKNNGIDTSHVITDKSGSVTGLAFTEIKSPTDCSILMYRDN
IOLC_GEOTN       TGFIGRVADDQMGRFIVQYLKNNGIDTSHVITDKSGSVTGLAFTEIKSPTDCSILMYRDN
IOLC_BACSU       AGFIGKIPDDQHGRFIESYMRKTGVDTTQMIVDQDGHKAGLAFTEILSPEECSILMYRDD
IOLC_BACLD       TGFIGKIPDDQHGRFIETYMRNTGVDTSQMAVDKDGHKAGLAFTEILSPEECSILMYRDD
IOLC_BACVZ       AGFIGKIPDDQHGRFIVSYMQGKGVDTSQMTVDREGRKAGLAFTEILSPEECSILMYRDD
IOLC_BACSK       VGFVGKIPDDQHGRFISSYMREAGVDTSQLVIDREGHKAGLTFTEILSPEECSILMYREK
IOLC_ALKHC       AGFIGKIADDQHGRFIESYMRGVGVDTSNLVVDQEGHKTGLAFTEIKSPEECSILMYRQD
IOLC_LISMO       VGFIGKISDDQHGRFIEKYMRDLAINTDGMVKDTEGRKVGLAFTEIKSPDECSILMYREN
IOLC_LISMF       VGFIGKISADQHGRFIEKYMRDLSINTDGMVKDTEGRKVGLAFTEIKSPDECSILMYREN
IOLC_LISIN       VGFIGKISDDQHGRFIEKYMRDLNINTDGMVKDTAGRKVGLAFTEIKSPEECSILMYREN
IOLC_LACCA       VGFIGKVSDDQLGHYVTQYMASVGIDTSNMVKDDTGHKIGLTFTEIISPEESDILMYRNE
IOLC_PHOPR       VGFIGCVADDAFGGYVRGYMTEQGINLDGMMTDNSGSRTSVAFTEMK-PNDCTVLIYRNK
IOLC_MYCH7       VGFFGSVSDDQFGNFVLNVFENEKIDISHIKKTKD-HKLGLTFTEMLSEEKSTILMYRDN
IOLC_MYCHJ       VGFFGSVSDDQFGNFVLNVFENEKIDISRIKKTKD-HKLGLTFTEMLSEEKSTILMYRDN
IOLC_MYCH2       VGFFGSVSDDQFGNFVLNVFEKEKIDISHIKKTKD-HKLGLTFTEMLSEEKSTILMYRDN
                  **.. :. *  * ::   :    ::   :         .::***:    .. :*:**. 

IOLC_CLOBA       IADLELDVNEIDEEYIKNTKAIVISGTALAKSPSREAALKALELAKKNDTVVIFDVDYRE
IOLC_CLOBB       IADLELDVNEIDEEYIKNTKAIVISGTALAKSPSREAALKALELAKKNDTIVIFDVDYRE
IOLC_CLOB8       IADLELNVDEIDEEYIKNTKAIVISGTALAKSPSREAALKALELAKRNNTVVIFDVDYRA
IOLC_CLOPE       IADLQLDVDDIDEDYIKNTKAIVISGTALAMSPSREAALKALRLAKKNGTVVIFDVDYRE
IOLC_CLOP1       IADLQLDVDDIDEDYIKNTKAIVISGTALAMSPSREAALKALRLAKKNGTVVIFDVDYRE
IOLC_CLOTE       IADLQLSSKEVSEDYIKSAKAIVISGTALSKSPSREAAFVALEYAKKHNTRIIFDLDYRE
IOLC_BACAN       VADLNLDPTEVSEDYIKQSKALLISGTALAKSPSREAVFLALEYARKHDVVVFFDVDYRP
IOLC_BACHK       VADLNLDPTEVSEDYIKQSKALLISGTALAKSPSREAVFLALEYARKHDVVVFFDVDYRP
IOLC1_BACCZ      VADLNLDPTEVSEDYIKQSKALLISGTALAKSPSREAVFLALEYARKHDVVVFFDVDYRP
IOLC_BACAH       VADLNLDPTEVSEDYIKQSKALLISGTALAKSPSREAVFLALEYAHKHDVVVFFDVDYRP
IOLC2_BACCZ      VADLNLDPTEVSEDYIKQSKALLISGTALAKSPSREAVFLALEYARKHDVVVFFDVDYRP
IOLC_GEOKA       VADLKLEPNDIDEDYIRRAKCLLISGTALAKSPSREAVFLALDYARRHGTVVVFDLDYRP
IOLC_GEOTN       VADLKLEPNDIHEDYIRQAKCLLISGTALAKSPSREAVFLALEYARRHGVVVFFDLDYRP
IOLC_BACSU       VADLYLEPSEVSEDYIANAKMLLVSGTALAKSPSREAVLKAVQYAKKHQVKVVFELDYRP
IOLC_BACLD       VADLYLAPSEVNEDYIAKSKMLLVSGTALAKSPSREAVLKAVQLAKKHQVKVVFELDYRP
IOLC_BACVZ       VADLYLEPSEVNEGYIANAKMLLVSGTALAKSPSREAVLKAVHIAKKHDVKVVFELDYRP
IOLC_BACSK       AADLYLSPDEIDAGYVRSAKVLLISGTALAQSPSREAALKAVSLAKAAGTKVVFELDYRP
IOLC_ALKHC       VADLYLSPEEVNEAYIRRSKLLLVSGTALSKSPSREAVLKAIRLAKRNDVKVVFELDYRP
IOLC_LISMO       VADLYLTPEEISEDYIKEARVLLISGTALAQSPSREAVLKAVSLARKNDVVVAFELDYRP
IOLC_LISMF       VADLYLTPEEISEDYIKEARVLLISGTALAQSPSREAVLKAVSLARKNDVAVAFELDYRP
IOLC_LISIN       VADLYLTPEEISEDYIKETRVLLVSGTALAQSPSREAVLKAVHLAQKNDVIVAFELDYRP
IOLC_LACCA       AADLYLNAHEVSRAYLAQTKMLVISGTGLAQSPSREAILKALLIAKELGVEVIFELDYRP
IOLC_PHOPR       ASDLTLKPEQVDPAYIAQSKMLVVTGTALSESPSREATLIAMEHARRSNTVVVLDVDYRP
IOLC_MYCH7       VADLQIDVSDIDLDYILRTKILVISGTSLAKSPSREAVLKALFLAKNNGIKVVFDIDYRP
IOLC_MYCHJ       VADLQIDVSDIDLDYILRTKILVISGTSLAKSPSREAVLKALFLAKNNGIKVVFDIDYRP
IOLC_MYCH2       VADLQIDVSDIDLDYILRTKILVISGTSLAKSPSREAVLKALFLAKNNGIKVVFDIDYRP
                  :** :   ::   *:  :: ::::**.*: ****** : *:  *:     : :::*** 

IOLC_CLOBA       YNWKNKDEIAIYYSIVGKQSDIVMGSREEFDLMESLI--VKEKSTDEESAKRWLGFGNKI
IOLC_CLOBB       YNWKNKDEIAIYYSIVGKQSDIVMGSREEFDLMESLI--VKEKSTDEESAKRWLGFGNKI
IOLC_CLOB8       YNWKNSDEIAIYYSIAGKQSDIIMGSREEFDLMEKLI--TREKNSDEETAKRWLDYGNKI
IOLC_CLOPE       YNWKNKDEIAIYYSIVGKESDIIMGSREEFDLMEGLI--AKD-STDEETAKRWLDYGNKI
IOLC_CLOP1       YNWKNKDEIAIYYSIVGKESDIIMGSREEFDLMEGLI--AKD-STDEETAKRWLDYGNKI
IOLC_CLOTE       YTWNCKEEIAIYYSLAARMSDVIMGSREEFNLMEGLI--SPEESNDKETAERWIGYGNKI
IOLC_BACAN       YTWQSEAETAVYYNLAAEKSDVIIGTREEFDMMEKLL--NYEKSNDQVTAERWFSHHAKI
IOLC_BACHK       YTWQSEAETAVYYNLAAEKSDVIIGTREEFDMMEKLL--NYEKSNDQVTAERWFSHHAKI
IOLC1_BACCZ      YTWQSEAETAVYYNLAAEKSDVIIGTREEFDMMEKLL--NYEQSNDQVTAERWFSHYAKI
IOLC_BACAH       YTWQSEAETAVYYNLAAEKSDVIIGTREEFDMMEKLL--NYEQSNDQVTAERWFSHYAKI
IOLC2_BACCZ      YTWQSEAETAVYYNLAAEKSDVIIGTREEFDMMEKLL--NYEESNDQVTAERWFSHHAKI
IOLC_GEOKA       YTWQSKEETAIYYNLAAEKCDVIIGTREEFDMMERFD--GQRR-DDEQTARKWFDYNAKI
IOLC_GEOTN       YTWQSKEETAIYYNLAAEKCDVIIGTREEFDMMEQFA--VHQH-DDEKTAQKWFDYHAKI
IOLC_BACSU       YTWQSSDETAVYYSLVAEQSDIVIGTRDEFDVMEN----RTG-GSNEESVNHLFGHSADL
IOLC_BACLD       YTWTSAEETAVYYTLVAEQSDIVIGTRDEFDVMEN----KSG-GSNEESVQHLFAHSADL
IOLC_BACVZ       YTWQSAEETAVYYTLVAEQSDIVIGTRDEFDVMEN----RSG-GGNDETVRHLFAHSADL
IOLC_BACSK       YTWSSREETSVYYTLLAGMAHIVIGTREEYDIMEG----ASA-SGNEQTAKMLFAKEPEL
IOLC_ALKHC       YSWETPEETAVYYSLVAEQSDIVIGTREEFDVLEN----RTEKGDNDETIRYLFKHSPEL
IOLC_LISMO       YTWKNSEETAVYYSLVAEQADVIIGTRDEFDMMEN----QVG-GKNEATKAYLFQHQAKI
IOLC_LISMF       YTWTNTEETAVYYSLVAEQADVIIGTRDEFDMMEN----QVG-GKNEATKAHLFQHQAEI
IOLC_LISIN       YTWKNTEETAVYYSLVAEQADVIIGTRDEFDMMEN----QIG-GNNEMTIDNLFKHKAEI
IOLC_LACCA       YTWQNAEETSLYYQLVAQKADVIIGTRDEFDVLEN----HQG-RTDQETIATLFQYDANL
IOLC_PHOPR       YSWRTDVDASIYYGIAAGLSDIVIGNREEFDMMETVL--APGNTDDDATADRFLRANTQV
IOLC_MYCH7       YSWKNLDEVSLYYQIVAQNSDLIIGSYEEIQLTSRFCLENPENLIDDDYAKYWLKF-VDL
IOLC_MYCHJ       YSWKNLDEVSLYYQIVAQNSDLIIGSYEEIQLTSRFCLENPENLIDDDYAKYWLKF-VDL
IOLC_MYCH2       YSWKNLDEVSLYYQIVAQNSDLIIGSYEEIQLTSRFCLENPENLIDDDYAKYWLKF-VDL
                 *.*    : ::** : .  ..:::*. :* :: .           :.      :    .:

IOLC_CLOBA       VVIKHGKEGSTAYTNDGKSYKIKPFPVKLLKSFGGGDAYASAFIYGILEE-WDIMDALEF
IOLC_CLOBB       VVIKHGKEGSTAYTNDRKSYKIKPFPVKLLKSFGGGDAYASAFIYGILEE-WDIMDALEF
IOLC_CLOB8       VVIKHGKEGSTAYTSDGKSYNIKPFPVKLLKSFGGGDAYASAFLYGLLEG-WSIIDSLEF
IOLC_CLOPE       VVIKHGKDGSTAYTRDGKAYRIKPFPVKLLKSFGGGDAYASAFIYGILEG-WDMMDALEF
IOLC_CLOP1       VVIKHGKDGSTAYTRDGKAYRIKPFPVKLLKSFGGGDAYASAFIYGILEG-WDMMDALEF
IOLC_CLOTE       VVIKHGKDGSTAYLHDGTSYKIKPFPVKLLKSFGGGDAYASAFIYGIMEG-WDVIDALEF
IOLC_BACAN       VVIKHGGDGSIAYTRDGQSHRGGIFKTKVLKTFGAGDSYASAFIYGLMQG-LEIPQAMRL
IOLC_BACHK       VVIKHGGDGSIAYTRDGQSHRGGIFKTKVLKTFGAGDSYASAFIYGLMQG-LEIPQAMRL
IOLC1_BACCZ      VVIKHGGDGSIAYTRDGQSHRGGIFKTKVLKTFGAGDSYASAFIYGLIQG-LEIPQAMRL
IOLC_BACAH       VVIKHGGDGSIAYTRDGQSHRGGIFKTKVLKTFGAGDSYASAFIYGLMQG-LEIPQAMRL
IOLC2_BACCZ      VVIKHGGDGSIAYTRDGQSHRGGIFKTKVLKTFGAGDSYASAFIYGLMQG-LEIPQAMRL
IOLC_GEOKA       VVIKHGKDGSIAYTKTGETFVGTIFPANIVKTFGAGDSYAAGFIYGLMND-WPIPKAMEY
IOLC_GEOTN       VVIKHGKDGSIAYTKTGETFVGTIFPANIVKTFGAGDSYAAGFIYGLMNG-WPIPKAMEY
IOLC_BACSU       VVIKHGVEGSYAYSKSGEVFRAQAYKTKVLKTFGAGDSYASAFIYGLVSG-KDIETALKY
IOLC_BACLD       VVIKHGVEGSYAYSKSGDVFRAKAYKTKVLKTFGAGDSYASAFLYGLVSG-KDIETALKY
IOLC_BACVZ       VVIKHGVDGSYAYSRSGEVFRAHAYKTKVLKTFGAGDSYASAFIYGLVSG-RDIETALKY
IOLC_BACSK       VVIKHGVDGSYAYLPSGETFRAGVYKTNVLKTFGAGDSYASAFLYGLLRG-YDIDQALRF
IOLC_ALKHC       IVIKHGVEGSFAYTKAGEAYRGYAYKTKVLKTFGAGDSYASAFLYALISG-KGIETALKY
IOLC_LISMO       VVIKHGVEGSFAYTKAGETFQAQAYKTKVLKTFGAGDSYASAFLYGLFSD-ESIETALKY
IOLC_LISMF       VVIKHGVEGSFAYTKAGETFQAKAYKTKVLKTFGAGDSYASAFLYGLFSG-ESIETALKY
IOLC_LISIN       IVIKHGVEGSFAYTKAGETFRAQAYKTKVLKTFGAGDSYASAFLYGLFSG-ENIETALKF
IOLC_LACCA       IVIKSGIQGSNAYTKAGETYHFGVFKTKVLKSFGAGDSFAAGFLYAYQHQ-LGLETALKY
IOLC_PHOPR       VIVKAGELGSKVYCKDGHKFQQGIFRVEVKKPFGSGDSFAGGLIWTLVNG-GELEDGVKH
IOLC_MYCH7       IIIKNGKKGSKLYQKD-KKLVAKIVPVKMLKGYGGGDAYASLFLDHYLKNESDLENGLAL
IOLC_MYCHJ       IIIKNGKKGSKLYQKD-KKLVAKIVPVKMLKGYGGGDAYASLFLDHYLKNESDLENGLAL
IOLC_MYCH2       IIIKNGKKGSKLYQKD-KKLVAKVVPVKMLKGYGGGDAYASLFLDHYLKNESDLENGLAL
                 :::* *  **  *             .:: * :*.**::*. ::         :  .:  

IOLC_CLOBA       GSASAAMLVASHSCSEDMPTVKEINEFIKEKKEQYGEMIARG-------
IOLC_CLOBB       GSASAAMLVASHSCSEDMPTVKEINEFIKEKKEQYGEMIARG-------
IOLC_CLOB8       GSASAAMLVASHSCSQDMPTVEAIRNFIKEEKEEYGDMVARA-------
IOLC_CLOPE       GSASAAMLVASHSCSEDMPTVEAIKEFIKKEKEEYGEMVARS-------
IOLC_CLOP1       GSASAAMLVASHSCSEDMPTVEAIKEFIKKEKEEYGEMVARS-------
IOLC_CLOTE       GSASAAMLVASHSCSEAMPKVEEIKQFIKEKKEEHGEMVVRG-------
IOLC_BACAN       GGASASIVISKHSCSDAMPTRAEISAFMETAEELV--------------
IOLC_BACHK       GGASASIVISKHSCSDAMPTRAEISAFMETAEELV--------------
IOLC1_BACCZ      GGASASIVISKHSCSDAMPTRAEISAFMETAEELV--------------
IOLC_BACAH       GGASASIVISKHSCSDAMPTRAEISAFMETAEELV--------------
IOLC2_BACCZ      GGASASIVISKHSCSDAMPTRAEISAFMEIAEEIV--------------
IOLC_GEOKA       GAAAASIVISSHSCSDAMPTLAQIEQFIEQHRNGSAARK----------
IOLC_GEOTN       GAAAASIVISSHSCSDAMPTLDQIEQFIQHIKAARPLQNHK--------
IOLC_BACSU       GSASASIVVSKHSSSEAMPTAEEIEQLIEAQS-----------------
IOLC_BACLD       GSASASIVVSKHSSSEAMPTVAEIEELIAAQS-----------------
IOLC_BACVZ       GSASASIVVSKHSSSEAMPAAGEIIELIEAQHSLNGK------------
IOLC_BACSK       GSASASIVVSKHSSSEAMPTLSEIKALVEEQHV----------------
IOLC_ALKHC       GSASASIVVSKHSSSDAMPSVEEIEALIEKDETITIA------------
IOLC_LISMO       GSAAASIVVSKHSSSDAMPTADEIKALIAQAE-----------------
IOLC_LISMF       GSAAASIVVSKHSSSDAMPTADEIKALIAQAE-----------------
IOLC_LISIN       GSAAASIVVSKHSSSDAMPTADEIKALIANAD-----------------
IOLC_LACCA       GSAAASIVISQLSSSEAMPNLDQLTAFIEKAEAQEVHQS----------
IOLC_PHOPR       GSAAAAINVSGNSCTEAMPTKEVLFDFIETREQDL--------------
IOLC_MYCH7       ATSAASIMVQSHS-SFDLPDYQKILEFKDNALKSDPDLVQKKEWNAFKK
IOLC_MYCHJ       ATSAASIMVQSHS-SFDLPDYQKILEFKDNALKSDPDLVQKKEWNAFKK
IOLC_MYCH2       ATSAASIMVQSHS-SFDLPDYQKILEFKDNALKSDPDLVQKKEWNAFKK
                 . ::*:: :   * :  :*    :  :