CLUSTAL format seed alignment for MF_01670

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

IOLA1_BACCZ      --MITTEIKRVKNHINGEWVESTGTEVEAVPNPATGKIIAYVPLSPKEDVEKAVEAAKAA
IOLA1_BACAH      --MITTEIKRVKNHINGEWVESTGTEVEAVPNPATGKIIAYVPLSPKEDVEKAVEAAKAA
IOLA_BACC1       --MITTEIKRVKNHINGEWVESTGTEVEAVPNPATGKIIAYVPLSPKEDVEKAVEAAKAA
IOLA1_BACAN      --MITTEIKRVKNHINGEWVESTGTEVEAVPNPATGKIIAYVPLSPKEDVEKAVEAAKAA
IOLA1_BACHK      --MITTEIKRVKNHINGEWVESTGTEVEAVPNPATGKIIAYVPLSPKEDVEKAVEAAKAA
IOLA_BACCR       --MITTEIKRVKNHINGEWVESTGTEVEAVPNPATGKIIAYVPLSPKEDVEKAVEAAKAA
IOLA1_BACMK      --MITTEIKRVKNHINGEWVESTGTEVEAVPNPATGKIIAYVPLSPKEDVEKAVEAAKAA
IOLA_BACCN       --MITTEIKRVKNHINGEWVESTGTEVEAVPNPATGKIIAYVPLSPKEDVERAVEAAKNA
IOLA1_BACLD      --MITTNAKKMMNHIDGEWVNSLGAESEEVVNPANGNVIAYAPLSVRADVDRAVQAAKHA
IOLA1_OCEIH      --MISSETKHMQNYINGKWVDAKSGKQEVIPNPATGETIATVTISDVEDVDMAVAAAKEV
IOLA2_BACSK      --MTTTKVKTVKNWIDGAWVEASTADTEVVPNPATGEAIAYVPLSGERDVEQAVASAKRA
IOLA1_GEOKA      MSITKPETTVLKNYIGGQWVASSGTETLEVPNPATGEVLARVPISTKEDVDQAVQAAKKA
IOLA2_BACAN      -MTVQTA-QIVKNYIGGEWVESISTKMEAVYNPATGEVIAQVPLSTKVDVEQAVLAANEA
IOLA2_BACHK      -MTVQTA-QIVKNYIGGEWVESISTKMEAVYNPATGEVIAQVPLSTKVDVEQAVLAANEA
IOLA2_BACAH      -MTVQTA-QIVKNYIGGEWVESISTKMEAVYNPATGEVIAQVPLSTKGDVEQAVLAANEA
IOLA2_BACCZ      -MTVQTAPQIVKNYIGGEWVESISTKMEAVYNPATGEVIAQVPLSTKVDVEQAVSAANEA
IOLA3_BACCZ      -MTVQTA-QIVKNYIGGEWVESISTKMEAVYNPATGEVIAQVPLSTKVDVEQAVLAANEA
IOLA2_OCEIH      --MTQTTVKNVKNYIGGEWIESRTEKTEDVFNPATGEVIAQVPISTTEDVHHAIEVANEA
IOLA_BACP2       --MTKTDVQMLKNYIGGQWIEAETSQTEAVYNPATGKIIAEVPLSTKKDVERAVQAAQEA
IOLA2_GEOKA      ---MTTGVQTLKNYIGGQWVESRSGKTEAVPNPATGEVLAYVPISSREELDEAVRAAKEA
IOLA1_GEOTN      ---MTTGVQTLKNYIGGQWVESRSAKTEAVPNPATGEVLAYVPISTREDLDRAVAAAKEA
IOLA_BACHD       -MANLATGEKLKNFIGGQWVESDSGKTEAVPNPATGEILAHVPISNREDLDRAVSVAKEA
IOLA3_GEOKA      ----MTETKTLKNFIGGQWVASTSGKEEVVPNPATGEVLAKVPLSSREELDAAVAAAKEA
IOLA2_GEOTN      ----MTETKTLKNFIGGQWVASTSGKEEIVPNPATGEVLAKVPISSREELDAAVAAAKEA
IOLA2_BACMK      ----MKNVQTLKNYIGGQWIESTSKQVEDVPNPATGEIIARVPLSTKEDLDRAVATAKEA
IOLA_BACSU       ----MAEIRKLKNYINGEWVESKTDQYEDVVNPATKEVLCQVPISTKEDIDYAAQTAAEA
IOLA_BACNA       ----MAEIRKLKNYINGEWVESKTDQYEDVVNPATKEVLCQVPISTKEDIDYAAQTAAEA
IOLA2_BACLD      ----MAEIRKLRNYINGEWVESKTDKYEDVVNPATKEVLCQVPISTREDIEYAAQTAAEA
IOLA_BACVZ       ----MAEIRKLKNYINGEWVESKTDQYEDVINPATKEVMCQVPISTREDVEYAVRSASEA
IOLA_LISIN       ----MADVRKLKNYINGEWVESKADKYEDVINPATGEVLCQVPISTRAELDQAAVIAEQA
IOLA_LISMF       ----MADVRKLKNYINGEWVESRADKYEDVINPATGEVLCQVPISTRAELDQAAVIAEQA
IOLA_LISMO       ----MADVRKLKNYIDGEWVESKTDKYEDVINPATGEVLCQVPISTRAELDQAAVIAEQA
IOLA1_BACSK      MGETTVEVRKVKNYINGKWIESSTSLYEDVVNPATKEVICQVPLSTKADVEYAVEAAKTA
IOLA_LACCA       MDTTKQNVKTLKNFINGKWVDAKTETFENVYNPATGDVLARVPHSTSEDVADAVTAAKEA
                           : * *.* *: :       : ***. . :. .. *   ::  *   *  .

IOLA1_BACCZ      YETWSKVPVPNRSRQLYKYLQLLQENKEELAKIITLENGKTLTDATGEVQRGIEAVELAT
IOLA1_BACAH      YETWSKVPVPNRSRQLYKYLQLLQENKEELAKIITLENGKTLTDATGEVQRGIEAVELAT
IOLA_BACC1       YETWSKVPVPNRSRQLYKYLQLLQENKEELAKIITLENGKTLTDATGEVQRGIEAVELAT
IOLA1_BACAN      YETWSKVPVPNRSRQLYKYLQLLQENKEELAKIITLENGKTLTDATGEVQRGIEAVELAT
IOLA1_BACHK      YETWSKVPVPNRSRQLYKYLQLLQENKEELAKIITLENGKTLTDATGEVQRGIEAVELAT
IOLA_BACCR       FETWSKVPVPNRSRNLYKYLQLLQENKDELAKIITLENGKTLTDATGEVQRGIEAVELAT
IOLA1_BACMK      YKTWSKVPVPNRSRQLYKYLQLLQENKEELAKIITLENGKTLTDATGEVQRGIEAVELAT
IOLA_BACCN       YETWSKVPVPNRSRMLYKYLQLLQENKDELSKIITLENGKTLKDASGEVQRGIEAVELAT
IOLA1_BACLD      YQTWSLVPVPNRARLLYKYLQLLQEQKEQLADIITTENGKTLKDARGEVQRGIEVVELAT
IOLA1_OCEIH      FPEWSDIPVPNRTRYLLDYWKLLQDNKEELAKIITLENGKSLRDAQGEVQRGIEVVELAT
IOLA2_BACSK      YETWKTVPVPERTRYMFAYLEQLKKNREQLAQLITLENGKTIKDARGEVQRGIECVELAT
IOLA1_GEOKA      FATWKDVPVPKRARIMFSFHHLLNQHHEELAELVVQENGKAYKEAYGEIQRGIECVEFAA
IOLA2_BACAN      FKSWSKTAVPRRARILFKYQQLLVDNWEELAKLITIENGKSYNEAYGEVLRGIECVEFAA
IOLA2_BACHK      FKSWSKTAVPKRARILFKYQQLLVDNWEELAKLITIENGKSYNEAYGEVLRGIECVEFAA
IOLA2_BACAH      FKSWSKTAVPKRARILFKYQQLLVDNWEELAKLITIENGKSYNEAYGEVLRGIECVEFAA
IOLA2_BACCZ      FKSWSKTAVPKRARILFKYQQLLVDNWEELAKLITIENGKSYNEAYGEVLRGIECVEFAA
IOLA3_BACCZ      FKSWSKTAVPKRARILFKYQQLLVDNWEDLAKLITIENGKSYNEAYGEVLRGIECVEFAA
IOLA2_OCEIH      FKTWKEVPVPKRARILFKYQQLLVEHWEELAKLITLENGKNYAEAYGEVQRGIENVEFAT
IOLA_BACP2       FTTWSKTPVPRRARILFKYQQLLVDKWDELAELVTMENGKSITEAKGEVQRGIECVEFAA
IOLA2_GEOKA      FKTWRKTPVPRRARILFKYQQLLVEHWEELARLVTLENGKSYNEAYGEVQRGIECVEFAA
IOLA1_GEOTN      FKTWSKTPVPRRARILFKYQQLLVEHWEELARLVTLENGKSYNEAYGEIQRGIECVEFAA
IOLA_BACHD       FKTWGKTPVPRRARVLFKYQQLLVENWEELARLVTLENGKSYKEAYGEVQRGIECVEFAA
IOLA3_GEOKA      FREWRKVPVPRRARILFRYQQLLVEHWDELARLVTLENGKVYEDAYGEVQRGIECVEFAA
IOLA2_GEOTN      FREWRKVPVPRRARILFRYQQLLVEHWEELARLVTLENGKVYEDAYGEVQRGIECVEFAA
IOLA2_BACMK      FKTWRKVAVPRRARILFRYQQLLIENWEGLAKLVTLENGKSYKEAYGEVQRGIECVEFAA
IOLA_BACSU       FKTWSKVAVPRRARILFNFQQLLSQHKEELAHLITIENGKNTKEALGEVGRGIENVEFAA
IOLA_BACNA       FETWSKVAVPRRARILFNFQQLLSQHKEELAHLITIENGKNTKEALGEVGRGIENVEFAA
IOLA2_BACLD      FKTWSKVAVPRRARILFNFQQLLTQHKEELAHLITIENGKNTKEALGEVGRGIENVEFAA
IOLA_BACVZ       FQTWSKTAVPRRARILFNYQQLLQQNKEELARLITLENGKNTTEALGEVGRGIENVEFAA
IOLA_LISIN       FEKWSQVAVPRRARVLFSFQQLLIQHKEELARLITLENGKNLSEARGEVQRGIENVEFAA
IOLA_LISMF       FEKWSQVAVPRRARVLFSFQQLLIQHKEKLARLITLENGKNLSEARGEVQRGIENVEFAA
IOLA_LISMO       FEKWSQVAVPRRARVLFGFQQLLIQHKEELARLITLENGKNLSEARGEVQRGIENVEFAA
IOLA1_BACSK      FAKWSKVAVPRRARILFNYQQLLQRDKEELARLITIENGKNLTEARGEVQRGIENVEFAA
IOLA_LACCA       FKIWQKVSIPKRAKILFKYQQLLVEHQEELGRIVTEENGKSLDEAVAEVGRGIENVEFAA
                 :  *   .:*.*:: :  : . *  . : *. ::. ****   :* .*: **** **:*:

IOLA1_BACCZ      STPNLMMGQALPNIASGIDGSIWRYPIGVVAGITPFNFPMMIPLWMFPLAIACGNTFVLK
IOLA1_BACAH      STPNLMMGQALPNIASGIDGSIWRYPIGVVAGITPFNFPMMIPLWMFPLAIACGNTFVLK
IOLA_BACC1       STPNLMMGQALPNIASGIDGSIWRYPIGVVAGITPFNFPMMIPLWMFPLAIACGNTFVLK
IOLA1_BACAN      SAPNLMMGQALPNIASGIDGSIWRYPIGVVAGITPFNFPMMIPLWMFPLAIACGNTFVLK
IOLA1_BACHK      SAPNLMMGQALPNIASGIDGSIWRYPIGVVAGITPFNFPMMIPLWMFPLAIACGNTFVLK
IOLA_BACCR       STPNLMMGQALPNIASGIDGSIWRYPIGVVAGITPFNFPMMIPLWMFPLAIACGNTFVLK
IOLA1_BACMK      SAPNLMMGQALPNIASGIDGSIWRYPIGVVAGITPFNFPMMIPLWMFPLAIACGNTFVLK
IOLA_BACCN       SAPNLMMGQALPNIAGGIDGSIWRYPLGVVAGITPFNFPMMIPLWMFPLAIACGNTFVLK
IOLA1_BACLD      ATPTLMMGESLPAIAGGIDGSIWRYPLGVVAGITPFNFPMMVPLWMFPLAIACGNTFVLK
IOLA1_OCEIH      STPSMMMGDALPSIAKGIDGSIWRYPLGVVAGITPFNFPMMVPLWMFPLAIACGNTFVLK
IOLA2_BACSK      STPTMMMGDALPDIASGIDGSIWRYPLGVVAGITPFNFPMMVPLWMFPLAIAAGNTFVLK
IOLA1_GEOKA      GAPTLLMGESLSNIAEEIDSEMFRYPLGVVAGITPFNFPMMVPLWMFPLAIVCGNTFVLK
IOLA2_BACAN      GAPTLMMGKQLPDIATGIESGMYRYPIGVIGGITPFNFPMMVPCWMFPLAIACGNTFVLK
IOLA2_BACHK      GAPTLMMGKQLPDIATGIESGMYRYPIGVIGGITPFNFPMMVPCWMFPLAIACGNTFVLK
IOLA2_BACAH      GAPTLMMGKQLPDIATGIESGMYRYPIGVIGGITPFNFPMMVPCWMFPLAIACGNTFVLK
IOLA2_BACCZ      GAPTLMMGKQLPDIATGIESGMYRYPIGVIGGITPFNFPMMVPCWMFPLAIACGNTFVLK
IOLA3_BACCZ      GAPTLMMGKQLPDIATGIESGMYRYPIGVIGGITPFNFPMMVPCWMFPLAIACGNTFVLK
IOLA2_OCEIH      GAPSLMMGEQLASIATELESGVYRYPIGVIGGITPFNFPMMVPCWMFPMAIATGNTFVMK
IOLA_BACP2       GAPTLMMGKQLPDIASGLESGMYRYPIGVIGGITPFNFPMMVPCWMFPLAIACGNTFVLK
IOLA2_GEOKA      GAPTLMMGRQLPDIATGIESGMYRYPIGVVGGITPFNFPMMVPCWMFPLAIACGNTFVLK
IOLA1_GEOTN      GAPTLMMGRQLPSIATGIESGMYRYPIGVVGGITPFNFPMMVPCWMFPLAIACGNTFVLK
IOLA_BACHD       GAPSLMMGKQLPDIATNIESGMYRYPIGVVGGITPFNFPMMVPCWMFPLAIACGNTFVLK
IOLA3_GEOKA      GIPTLMMGQQLPDIATDIESGMYRYPLGVVAGITPFNFPMMVPCWMFPLAIACGNTFVLK
IOLA2_GEOTN      GIPTLMMGQQLPDIATGIESGMYRYPLGVVAGITPFNFPMMVPCWMFPLAIACGNTFVLK
IOLA2_BACMK      GAPTLMMGEQLPDIATGVESGMYRYPIGVIAGITPFNFPMMVPCWMFPLAIACGNTFVLK
IOLA_BACSU       GAPSLMMGDSLASIATDVEAANYRYPIGVVGGIAPFNFPMMVPCWMFPMAIALGNTFILK
IOLA_BACNA       GAPSLMMGDSLASIATDVEAANYRYPIGVVGGIAPFNFPMMVPCWMFPMAIALGNTFILK
IOLA2_BACLD      GAPSLMMGDSLATIATDVEAANYRYPIGVVGGIAPFNFPMMVPCWMFPMAIALGNTFILK
IOLA_BACVZ       GAPSLMMGDSLASIATDVEAANYRYPIGVVGGIAPFNFPMMVPCWMFPMAISLGNTFILK
IOLA_LISIN       GAPTLMMGDSLASIATDVEAANYRYPVGVVGGIAPFNFPMMVPCWMFPMAIALGNSFILK
IOLA_LISMF       GAPTLMMGDSLASIATDVEAANYRYPVGVVGGIAPFNFPMMVPCWMFPMAIALGNSFILK
IOLA_LISMO       GAPTLMMGDSLASIATDVEAANYRYPVGVVGGIAPFNFPMMVPCWMFPMAIALGNSFILK
IOLA1_BACSK      GAPSLMMGDSLPMIATDVEASNYRYPIGVVGGIAPFNFPMMVPCWMFPMAIALGNAFLLK
IOLA_LACCA       GVPTLMMGDSLSSVATDVEATNYRYPIGVVGGITPFNFPMMVPCWMFPMAVATGNTFILK
                 . *.::**  *. :*  ::.  :***:**:.**:*******:* ****:*:  **:*::*

IOLA1_BACCZ      TSERTPLLAERLVELFYEAGFPKGVLNLVQGGKDVVNSILENKDIQAVSFVGSEPVARYV
IOLA1_BACAH      TSERTPLLAERLVELFYEAGFPKGVLNLVQGGKDVVNSILENKDIQAVSFVGSEPVARYV
IOLA_BACC1       TSERTPLLAERLVELFYEAGFPKGVLNLVQGGKDVVNSILENKDIQAVSFVGSEPVARYV
IOLA1_BACAN      TSERTPLLAERLVELFYEAGFPKGVLNLVQGGKDVVNSILENKDIQAVSFVGSEPVARYV
IOLA1_BACHK      TSERTPLLAERLVELFYEAGFPKGVLNLVQGGKDVVNSILENKDIQAVSFVGSEPVARYV
IOLA_BACCR       TSERTPLLAERLVELFYEAGFPKGVLNLVQGGKDVVNSILENKDIQAVSFVGSEPVARYV
IOLA1_BACMK      TSERTPLLAERLVELFYEAGFPKGVLNLVQGGKDVVNSILENKDIQAVSFVGSEPVARYV
IOLA_BACCN       TSERTPLLAERLVELFYEAGFPKGVLNLVQGGKEVVNSILENKEIQAVSFVGSEPVARYV
IOLA1_BACLD      PSERTPILAGKLVELFYEAGFPKGVLNLVHGGKDVVNGILENDDIKAVSFVGSEPVAKYV
IOLA1_OCEIH      TSERTPILAERLVELFYEAGFPKGVLNLVHGGKEVVNRFLTHPDIEAVSFVGSEPVAKHV
IOLA2_BACSK      TSERTPLLAEQLVSLMHEVGLPRGVLNLVNGGKAVVNGLLNHPDVEAISFVGSEPVARYV
IOLA1_GEOKA      PSERTPILANKLAELFTEAGAPPGVLNVVHGAHEVVNALIDHEDIRAISFVGSQPVAKYV
IOLA2_BACAN      PSERTPLLAARLAELAEEAGLPKGVLNIVNGAHDVVNGLLEHKLVKAISFVGSQPVAEYV
IOLA2_BACHK      PSERTPLLAARLAELAEEAGLPKGVLNIVNGAHDVVNGLLEHKLVKAISFVGSQPVAEYV
IOLA2_BACAH      PSERTPLLAARLAELAEEAGLPKGVLNIVNGAHDVVNGLLEHKLVKAISFVGSQPVAEYV
IOLA2_BACCZ      PSERTPLLAARLAELAEEAGLPKGVLNIVNGAHDVVNGLLEHKLVKAISFVGSQPVAEYV
IOLA3_BACCZ      PSERTPLLAAKLVELAEEAGLPKGVLNIVNGAHDVVNGLLEHKLVKAISFVGSQPVAEYV
IOLA2_OCEIH      PSERTPLLANRLAELLEEAGLPNGVFNIVHGAHDVVNGLLDHKKVAAISFVGSQPVAEYV
IOLA_BACP2       PSERTPILAARLAELFEEAGLPKGVLNIVNGAHDVVNGLLEHQKVKAISFVGSQPVAEYV
IOLA2_GEOKA      PSERTPMLANRLAELFKEAGLPDGVLNIVHGAHDVVNGLLEHPDVKAISFVGSQPVGEYV
IOLA1_GEOTN      PSERTPMLANRLAELFKEAGLPDGVLNIVHGAHDVVNGLLEHPDVKAISFVGSQPVGEYV
IOLA_BACHD       PSERTPLLANRLAELFTEAGLPEGVLNIVHGAHDVVNGLLEHPDVKAISFVGSQPVAEYV
IOLA3_GEOKA      PSERTPMLANRLAELFTEAGLPPGVLNIVHGAHEVVGGILEHKDIKAVSFVGSQPVAEYV
IOLA2_GEOTN      PSERTPLLANRLAELFTEAGLPAGVLNIVHGAHEVVNGILEHKDIKAVSFVGSQPVAEYV
IOLA2_BACMK      PSERTPLLANRIAELFKEAGLPDGVLNIVHGAHDVVNGILDNEDVKAVSFVGSQPVAEYI
IOLA_BACSU       PSERTPLLTEKLVELFEKAGLPKGVFNVVYGAHDVVNGILEHPEIKAISFVGSKPVGEYV
IOLA_BACNA       PSERTPLLTEKLVELFEKAGLPKGVFNVVYGAHDVVNGILEHPEIKAISFVGSKPVGEYV
IOLA2_BACLD      PSERTPLLTEKLVELFEKAGLPKGVFNVVYGAHDVVNGILEHPEIKAISFVGSKPVGEYV
IOLA_BACVZ       PSERTPLLTEKLAELFEQAGLPKGVFNVVHGAHDVVNGVLEHPDIKAISFVGSKPVGEYV
IOLA_LISIN       PSERTPLLMEKLVELFSEAGLPKGVFNVVYGAHDVVNGILENETIKAVSFVGSKPVGEYV
IOLA_LISMF       PSERTPLLMEKLVELFSEAGLPKGVFNVVYGAHDVVNGILENEIIKAVSFVGSKPVGEYV
IOLA_LISMO       PSERTPLLMEKLVELFSEAGLPKGVFNVVYGAHDVVNGILENEIIKAVSFVGSKPVGEYV
IOLA1_BACSK      PSERTPLLTEKLADLLTEAGVPDGVFNVVYGAHDVVNGMLEHPDIKAISFVGSKPVGEYV
IOLA_LACCA       PSEKTPLTSQRLVELFQEAGLPDGVLNIVNGAVDVVNGILDHPDIKAISFVGSERVGEYV
                 .**:**:   ::..*  :.* * **:*:* *.  **. .: :  : *:*****: *..::

IOLA1_BACCZ      YETGTKHGKRVQALAGAKNHAIVMPDCNLEKTVQGVIGSAFASSGERCMACSVVAVVDEI
IOLA1_BACAH      YETGTKHGKRVQALAGAKNHAIVMPDCNLEKTVQGVIGSAFASSGERCMACSVVAVVDEI
IOLA_BACC1       YETGTKHGKRVQALAGAKNHAIVMPDCNLEKTVQGVIGSAFASSGERCMACSVVAVVDEI
IOLA1_BACAN      YETGTKHGKRVQALAGAKNHAIVMPDCNLEKTVQGVIGSAFASSGERCMACSVVAVVDEI
IOLA1_BACHK      YETGTKHGKRVQALAGAKNHAIVMPDCNLEKTVQGVIGSAFASSGERCMACSVVAVVDEI
IOLA_BACCR       YETGTKHGKRVQALAGAKNHAIVMPDCNLEKTVQGVIGSAFASSGERCMACSVVAVVDEI
IOLA1_BACMK      YETGTKNGKRVQALAGAKNHAVVMPDCNLEKTVQGVIGSAFASSGERCMACSVVAVVDEI
IOLA_BACCN       YETGTKYGKRVQALAGAKNHAIVMPDCNLEKTVQGVIGSAFGSSGERCMACSVVAVLDEI
IOLA1_BACLD      YQTGTANGKRVQALAGAKNHAIVMPDCHLEKTVQGIIGAAFGSSGERCMACSVAAVVDDI
IOLA1_OCEIH      YQTGTAHGKRVQALAGAKNHAVVMPDCDVEKTIQGVLGAAFGSSGERCMACSVVAVVDDI
IOLA2_BACSK      YETGTANGKRVQALAGAKNHAVVLADCELDKTVQGVIGAAFASSGERCMACSVVAVVEEV
IOLA1_GEOKA      YERTAAQGKRVQALSGAKNHHIVMPDADVETAVQHVISSAFGSAGQRCMACSAVVIVGE-
IOLA2_BACAN      YKKGTENLKRVQALAGAKNHSIVLNDANLELATKQIISAAFGSAGERCMAASVVTVEEEI
IOLA2_BACHK      YKKGTENLKRVQALAGAKNHSIVLNDANLELATKQIISAAFGSAGERCMAASVVTVEEEI
IOLA2_BACAH      YKKGTENLKRVQALAGAKNHSIVLNDANLELATKQIISAAFGSAGERCMAASVVTVEEEI
IOLA2_BACCZ      YKKGTENLKRVQALAGAKNHSIVLNDANLELATKQIISAAFGSAGERCMAASVVTVEEEI
IOLA3_BACCZ      YKKGTENLKRVQALAGAKNHSIVLSDANLELATKQIISAAFGSAGERCMAASVVTVQEEI
IOLA2_OCEIH      YKRGTQNLKRVQALAGAKNHSIVLSDANLENATTQILNAAFGSAGERCMAASVVAVEEDV
IOLA_BACP2       YKKGTEHGKRVQALAGAKNHSIVLKDADLDAATKQIIGAAFGSAGERCMAAAVVAVEEEV
IOLA2_GEOKA      YKTAAAHGKRVQALTGAKNHSIVMPDADLNVAVREIINAAFGSAGERCMAASVVVAVGEI
IOLA1_GEOTN      YKTAAAHGKRVQALTGAKNHSIVMPDADLKVAVREIINAAFGSAGERCMAASVVVAVGDI
IOLA_BACHD       YKTASQHGKRVQALAGAKNHSIVMPDADLDGAVNQIVNAAYGSAGERCMAAAVVVAVGEV
IOLA3_GEOKA      YKTAAAHGKRVQALAGAKNHSIVMPDADLDMAVTNIINAAFGSAGERCMACSVVVAVGDI
IOLA2_GEOTN      YKTAAAYGKRVQALAGAKNHSIVMPDADLDMAVTNIINAAFGSAGERCMACSVVVAVGDI
IOLA2_BACMK      YKTAAANGKRVQALAGAKNHSIVLKDADLSSTVKEITSAAFGSAGERCMAAAVVVVEEDV
IOLA_BACSU       YKKGSENLKRVQSLTGAKNHTIVLNDANLEDTVTNIVGAAFGSAGERCMACAVVTVEEGI
IOLA_BACNA       YKKGSEHLKRVQSLTGAKNHTIVLNDANLEDTVTNIVGAAFGSAGERCMACAVVTVEEGI
IOLA2_BACLD      YKKGSENLKRVQSLTGAKNHTIVLNDANLEDTVTNIIGAAFGSAGERCMACAVVTVEEGI
IOLA_BACVZ       FKKGSEHLKRVQALTGAKNHTIVLNDAHLEDTVTNIIGAAFGSAGERCMACAVVTVEEGI
IOLA_LISIN       YKTGSANLKRVQALTGAKNHTIVLNDADLEDTVTNVISAAFGSAGERCMACAVVTVEEGI
IOLA_LISMF       YKTGSANLKRVQALTGAKNHTIVLNDADLEDTVTNVISAAFGSAGERCMACAVVTVEEGI
IOLA_LISMO       YKTGSANLKRVQALTGAKNHTIVLNDADLEDTVTNVISAAFGSAGERCMACAVVTVEEGI
IOLA1_BACSK      YKKASENLKRVQALTGAKNHTIVLNDADLDDAVTNIAGAAFGSAGERCMACAVVTVEEGI
IOLA_LACCA       YKRGSDHLKRVQALTGAKNHTIVLADADLDAAVKGIISSSFGSAGERCMATSVLVLQDEI
                 ::  :   ****:*:***** :*: *..:. :   : .:::.*:*:**** :. .     

IOLA1_BACCZ      ADEFIDVLVAETKKLKVGDGFHEDNYVGPLIRESHKERVLGYINSGVADGATLLVDGRKI
IOLA1_BACAH      ADEFIDVLVAETKKLKVGDGFHEDNYVGPLIRESHKERVLGYINSGVADGATLLVDGRKI
IOLA_BACC1       ADEFIDVLVAETKKLKVGDGFHEDNYVGPLIRESHKERVLGYINSGVADGATLLVDGRKI
IOLA1_BACAN      ADEFIDVLVAETKKLKVGDGFHEDNYVGPLIRESHKERVLGYINSGVADGATLLVDGRKI
IOLA1_BACHK      ADEFIDVLVAETKKLKVGDGFHEDNYVGPLIRESHKERVLGYINSGVADGATLLVDGRKI
IOLA_BACCR       ADEFIDVLVAETKKLKVGDGFNEDNYVGPLIRESHKERVLGYINSGVADGATLLVDGRKI
IOLA1_BACMK      ADEFIDVLVAETKKLKVGDGFNEDNYVGPLIRESHKERVLGYINSGVADGATLLVDGRKI
IOLA_BACCN       ADEFIDALVSETRKLKVGDGFHEENYVGPLIRESHKERVIGYINSGVADGASLLVDGRQI
IOLA1_BACLD      ADDFMEMLVSETRKLKTGDGRSEDHFVGPLIREVHKQRVLDYIDSGIKEGAALAVDGR--
IOLA1_OCEIH      ADEFLEKLVKETKKLRVGDGMDDSNFIGPVIRESHKERVLSYIDSGVDEGAHLLVDGRKI
IOLA2_BACSK      ADAFIEKLTAETKKLTVGNGKNDEHFVGPLIRQSHKDKVVKYIEQGVEQGAELLVDGRN-
IOLA1_GEOKA      NETFVRRLKQKADELIIGNGMDPEVLLTPVIRQSHREKVLGYIQKGIEEGAVLLRDGRKE
IOLA2_BACAN      ADQLVERLVAEANKIVIGNGLDEDVFLGPVIRDNHKERTIGYIDSGVEQGATLVRDGRED
IOLA2_BACHK      ADQLVERLVAEANKIVIGNGLDEDVFLGPVIRDNHKERTIGYIDSGVEQGATLVRDGRED
IOLA2_BACAH      ADQLVERLVEEANKIVIGNGLDEDVFLGPVIRDNHKERTIGYIDSGVEQGATLVRDGRED
IOLA2_BACCZ      ADQLVGRLVEEANKIVIGNGLDEDVFLGPVIRDNHKERTIGYIDSGVEQGATLVRDGRED
IOLA3_BACCZ      ADQLVGRLVEEANKIVIGNGLDEDVFLGPVIRDNHKERTIGYIDSGVEQGATLVRDGRED
IOLA2_OCEIH      ADEFVTLLTQKANEIKIGNGLDEGVFLGPVIRDQHKERTLQYIESGEEEGANLVRDGRTD
IOLA_BACP2       ADDLIQKLVDESNELVIGNGINEEVFLGPVIREEHKERTLQYIQSGIEEGASLIRDGRKD
IOLA2_GEOKA      ADELVEKLVAAANELKIGNGLEESVFLGPVIREAHKQRTVKYIELGEKEGAILVRDGRKD
IOLA1_GEOTN      ADELVERLVAAANEIKIGNGLEESVFLGPVIREAHKQRTVNYIELGEKEGAILVRDGRKD
IOLA_BACHD       AEPLMEKLQKAVNEITIGNGLDDDVFLGPVIRESHKQKTENYIELGEKEGATLVRDGRKD
IOLA3_GEOKA      ADELVRRLKEAADRIQIGNGLDKGVFLGPVIRESHKERTIKYIEIGEKEGALLVRDGRRD
IOLA2_GEOTN      ADELVERLKKAADRIQIGNGLDQGVFLGPVIRESHKERTIKYIEIGEREGALLVRDGRRD
IOLA2_BACMK      ADELVNRLLQEANAITIGNGLEEGVFLGPVIREGHKERTLGYIQSGVEQGATLIRDGRED
IOLA_BACSU       ADEFMAKLQEKVADIKIGNGLDDGVFLGPVIREDNKKRTLSYIEKGLEEGARLVCDGR--
IOLA_BACNA       ADEFMAKLQEKVADIKIGNGLDDGVFLGPVIREDNKKRTLSYIEKGLEEGARLVCDGR--
IOLA2_BACLD      ADEFMEKLVQKASEVKIGNGLDDGVFLGPVIREDNKKRTLGYIQKGIEEGARLVCDGR--
IOLA_BACVZ       ADEFMAKLQEKAADIKIGNGLDDGVFLGPVIREDNKKRTHSYIEKGIEEGARLLCDGR--
IOLA_LISIN       ADDFLAALRTAAQNVKIGNGLDDGVFLGPVIREENQKRTIAYIEKGVEEGAKLTVDGR--
IOLA_LISMF       ADEFLAALRTAAQNVKIGNGLDDGVFLGPVIREENQKRTIAYIEKGLEEGAKLTVDGR--
IOLA_LISMO       ADEFLEALRTAAQNVKIGNGLDDGVFLGPVIREENQKRTIAYIEKGIEEGAKLTVDGR--
IOLA1_BACSK      ADAFVAKLKAKAESLVMGNGLDDGVFLGPVIREENKNRTIAYIEKGVEEGATLVCDGR--
IOLA_LACCA       ADKFMAKFTQAAKDIKIGNGLDKGVFLGPVIRKENQERTLNYIQTGVKEGAKLVLDGSA-
                  : ::  :      :  *:*      : *:**. ::.:.  **: *  :** *  **   

IOLA1_BACCZ      KEEVGEGYFVGATIFDGVNQEMKIWQDEIFAPVLSIVRVKDLEEGIKLTNQSKFANGAVI
IOLA1_BACAH      KEEVGEGYFVGATIFDGVNQEMKIWQDEIFAPVLSIVRVKDLEEGIKLTNQSKFANGAVI
IOLA_BACC1       KEEVGDGYFVGATIFDGVNQEMKIWQDEIFAPVLSIVRVKDLEEGIKLTNQSKFANGAVI
IOLA1_BACAN      KEEVGEGYFVGATIFDGVNQEMKIWQDEIFAPVLSIVRVKDLEEGIKLTNQSKFANGAVI
IOLA1_BACHK      KEEVGEGYFVGATIFDGVNQEMKIWQDEIFAPVLSIVRVKDLEEGIKLTNQSKFANGAVI
IOLA_BACCR       NEEVGEGYFVGATIFDGVNQEMKIWQDEIFAPVLSIVRVKDLEEGIKLTNQSKFANGAVI
IOLA1_BACMK      NEEVGEGYFVGATIFDGVNQEMKIWQDEIFAPVLSIVRVKDLEEGIKLTNQSKFANGAVI
IOLA_BACCN       KEDVEGGYFVGATIFDGVNQNMKIWQDEIFAPVLSIVRVRDLEEGIQLTNQSKFANGAVI
IOLA1_BACLD      NPDVREGYFVGATIFDHVTPEMKIWQDEIFAPVLSVVRVQDLDEGIELANQSKFANGAVI
IOLA1_OCEIH      KEETPDGYYVGATIFDHVTQDMKIWQDEIFAPVLSVVRVSDLEEGIRVTNQSKFANGAVI
IOLA2_BACSK      ATSEEAGYYLGATLFDHVTPEMTIWQEELFAPVLSIVRVRDLEEAIALTNRSRFANGAVI
IOLA1_GEOKA      MDDRPEGNFLGPTIFDYVTPDMTIAKEEIFAPVLSLLRANDLDEALSYIRKSRYGNGATI
IOLA2_BACAN      TAVKGAGYFVGPTIFDHVTKEMKIWQDEIFAPVLSIVRVKSLDEAIEIANESRFANGACI
IOLA2_BACHK      TAVKGAGYFVGPTIFDHVTKEMKIWQDEIFAPVLSIVRVKSLDEAIEIANESRFANGACI
IOLA2_BACAH      TAVKGAGYFVGPTIFDHVTKEMKIWQDEIFAPVLSIVRVKSLDEAIEIANESRFANGACI
IOLA2_BACCZ      TAVKGAGYFVGPTIFDHVTKEMKIWQDEIFAPVLSIVRVKSLDEAIEIANESRFANGACI
IOLA3_BACCZ      TAVKGAGYFVGPTIFDHVTQEMKIWQDEIFAPVLSIVRVKSLDEAIEIANESRFANGACI
IOLA2_OCEIH      EAAKQEGYFVGPTIFDHVTSEMKIWQDEIFAPVLSIARVNNLEEGVDLANESRFANGACI
IOLA_BACP2       HETNGKGYFVGPTIFDHVTNQMKIWQDEIFAPVLSIVRVSSLAEAIDLSNQSKFANGACL
IOLA2_GEOKA      AAVQDNGYFIGPTIFDRVTTDMTIWKDEIFAPVLSIVRVETLDEAIEVANKSPFANGACI
IOLA1_GEOTN      AAVQGEGYFIGPTIFDRVTTDMTIWKDEIFAPVLSIVRVSTLDEAIEVANKSPFANGACI
IOLA_BACHD       NVSKD-GYFLGPTLFDNVTTEMTIWKEEIFAPVLSVVRVESLDEAIQLTNQSEFANGACL
IOLA3_GEOKA      SATSGQGYFIGPTIFDHVKPGMTIWTDEIFAPVLSVVRARDLDEAIEIANRSEFANGACI
IOLA2_GEOTN      AATSGKGYFVGPTIFDHVKPGMTIWTDEIFAPVLSVVRARDLDEAIEIANRSEFANGACI
IOLA2_BACMK      DIANSQGYFVGPTIFDNVTQEMKIWQDEIFAPVLSIVRVKDLMEAIHVANASPFANGACL
IOLA_BACSU       ENVSDDGYFVGPTIFDNVTTEMTIWKDEIFAPVLSVIRVKNLKEAIEIANKSEFANGACL
IOLA_BACNA       ENVSDDGYFVGPTIFDNVTTEMTIWKDEIFAPVLSVIRVKNLKEAIEIANKSEFANGACL
IOLA2_BACLD      ENVTDEGYFVGPTIFDNVTTDMTIWKDEIFAPVLSVIRVKNLKEAVEIANQSEFANGACL
IOLA_BACVZ       ENATEDGYFVGPTIFDNVTTDMTIWKDEIFAPVLSVIRVKNLKEAVDIANQSEFANGACL
IOLA_LISIN       ETGLSEGYFVGPTILEDVTTDMTIWKDEIFAPVLSVIRVKNLQEAVRVANQSEFANGACI
IOLA_LISMF       ETGLSEGHFVGPTILEDVTTDMTIWKDEIFAPVLSVIRVKNLQEAVRVANQSEFANGACI
IOLA_LISMO       ETGLSEGHFVGPTILEDVTTDMTIWKDEIFAPVLSVIRVKNLQEAVRVANQSEFANGACI
IOLA1_BACSK      SRVSADGYFIGPTIFENVTTDMTIWKDEIFAPVLSIIRVKNLDEGIQIANRSEFANGACL
IOLA_LACCA       EAKKHDGYFVGPTIFEDVKTDMTIWHDEMFAPVLSVIRAKDLPQAVAIANTSELANGACL
                       * ::*.*::: *.  *.*  :*:******: *.  * :.:   . *  .*** :

IOLA1_BACCZ      YTSNGKHAQTFRDNIDAGMIGVNVNVPAPMAFFAFAGNKASFFGDLGTNGTDGVQFYTRK
IOLA1_BACAH      YTSNGKHAQTFRDNIDAGMIGVNVNVPAPMAFFAFAGNKASFFGDLGTNGTDGVQFYTRK
IOLA_BACC1       YTSNGKHAQTFRDNIDAGMIGVNVNVPAPMAFFAFAGNKASFFGDLGTNGTDGVQFYTRK
IOLA1_BACAN      YTSNGKHAQTFRDNIDAGMIGVNVNVPAPMAFFAFAGNKASFFGDLGTNGTDGVQFYTRK
IOLA1_BACHK      YTSNGKHAQTFRDNIDAGMIGVNVNVPAPMAFFAFAGNKASFFGDLGTNGTDGVQFYTRK
IOLA_BACCR       YTSNGKHAQTFRDNIDAGMIGVNVNVPAPMAFFAFAGNKASFFGDLSTNGTDGVQFYTRK
IOLA1_BACMK      YTSNGKHAQTFRDNIDAGMIGVNVNVPAPMAFFAFAGNKASFFGDLGTNGTDGVQFYTRK
IOLA_BACCN       YTSSGKHAQTFRDHIDAGMIGVNVNVPAPMAFFAFAGNKASFYGDLGTNGKDGVQFYTRK
IOLA1_BACLD      YTSSGKSAQQFRDKIDAGMIGVNVNVPAPMAFFSFAGNKASFYGDLGTNGKDGVQFYTRK
IOLA1_OCEIH      YTNSGKSAQQFRNRIDAGMIGVNVNVPAPMAFFSFAGNKASFYGDLGTNGKDGVQFYTRK
IOLA2_BACSK      YTSSGKAAQHFRNAIDAGMVGINVNVPAPMAFFSFAGNKASFFGDLGTNGRDGIQFYTRK
IOLA1_GEOKA      YTKDAKAVRKFREEADAGMLGINVGVPATMAFFPFSGWKDSFYGDLHVNGKDGVNFYTRK
IOLA2_BACAN      YTDSGASVRQFRETIESGMLGVNVGVPAPMAFFPFSGWKDSFYGDLHANGTDGVEFYTRK
IOLA2_BACHK      YTDSGASVRQFRETIESGMLGVNVGVPAPMAFFPFSGWKDSFYGDLHANGTDGVEFYTRK
IOLA2_BACAH      YTDSGASVRQFRETIESGMLGVNVGVPAPMAFFPFSGWKDSFYGDLHANGTDGVEFYTRK
IOLA2_BACCZ      YTDSGASVRQFRETIESGMLGVNVGVPAPMAFFPFSGWKDSFYGDLHANGTDGVEFYTRK
IOLA3_BACCZ      YTDSGASVRQFRETIESGMLGVNVGVPAPMAFFPFSGWKDSFYGDLHANGTDGVEFYTRK
IOLA2_OCEIH      FTRDGGSVRRFRETIDAGMLGVNIGVPAPMAFLPFSGWKDSFYGDLHANGKDGLQFYTRK
IOLA_BACP2       YTDSASSIREFRENIEAGMLGVNIGVPAPMAFFPFSGWKDSFYGDLHANGTDGVEFYTRK
IOLA2_GEOKA      YTRDGGNVRKFREEIDAGMLGVNLGVPAPMAFFPFSGWKNSFYGDLHANGMDGVEFYTRK
IOLA1_GEOTN      YTRDGGNVRKFRDEIDAGMLGVNLGVPAPMAFFPFSGWKNSFYGDLHANGMDGVEFYTRK
IOLA_BACHD       YTTNGSSVRKFREEIDAGMLGINLGVPAPMAFFPFSGWKNSFYGDLHANGTDGVEFYTRK
IOLA3_GEOKA      YTDSAKAIRQFREEIDAGMLGVNVAVPAPMAFFPFSGYKNSFYGDLHANGRDGVEFYTRK
IOLA2_GEOTN      YTDSAKAIRQFREEIDAGMLGVNVAVPAPMAFFPFSGYKNSFYGDLHANGRDGVEFYTRK
IOLA2_BACMK      YTNSAKAIREFREEIDAGMLGVNLGVPAPMAFFPFSGYKKSFYGDLHANGKDGVEFYTRK
IOLA_BACSU       FTSNSNAIRYFRENIDAGMLGINLGVPAPMAFFPFSGWKSSFFGTLHANGKDSVDFYTRK
IOLA_BACNA       FTSNSNAIRYFRENIDAGMLGINLGVPAPMAFFPFSGWKSSFFGTLHANGKDSVDFYTRK
IOLA2_BACLD      FTSNSNAIRYFRENIDAGMLGINLGVPAPMAFFPFSGWKSSFFGTLHANGKDSVDFYTRK
IOLA_BACVZ       FTSNANAIRYFRENIDAGMLGINLGVPAPMAFFPFSGWKSSFFGTLHANGKDSVDFYTRK
IOLA_LISIN       FTNNAKAIRYFREKIDAGMLGVNLGVPAPMAFFPFSGWKSSFYGTLHANGKDSVDFYTHK
IOLA_LISMF       FTNNAKAIRYFREKIDAGMLGVNLGVPAPMAFFPFSGWKSSFYGTLHANGKDSVDFYTHK
IOLA_LISMO       FTNNAKAIRYFREKIDAGMLGVNLGVPAPMAFFPFSGWKSSFYGTLHANGKDSVDFYTHK
IOLA1_BACSK      FTTNAAAVRYFRENIDAGMLGINLGVPAPMAFFPFSGWKSSFYGTLHANGKDSVDFYTRK
IOLA_LACCA       FTDSAASIRYFRENIDAGMLGINLGVPAPIAVFPFSGWKHSFFGTLHANGKDSVDFYTHK
                 :* ..   : **:  ::**:*:*: ***.:*.:.*:* * **:* * .** *.::***:*

IOLA1_BACCZ      KVVTERWF------
IOLA1_BACAH      KVVTERWF------
IOLA_BACC1       KVVTERWF------
IOLA1_BACAN      KVVTERWF------
IOLA1_BACHK      KVVTERWF------
IOLA_BACCR       KVVTERWF------
IOLA1_BACMK      KVVTERWF------
IOLA_BACCN       KVVTERWF------
IOLA1_BACLD      KVVTERWF------
IOLA1_OCEIH      KVVTERWF------
IOLA2_BACSK      KVVTERWFN-----
IOLA1_GEOKA      KMITSRFDF-----
IOLA2_BACAN      KMLTSRWEK-----
IOLA2_BACHK      KMLTSRWEK-----
IOLA2_BACAH      KMLTSRWEK-----
IOLA2_BACCZ      KMLTSRWEK-----
IOLA3_BACCZ      KMLTSRWEK-----
IOLA2_OCEIH      KVLTTKWV------
IOLA_BACP2       KMVTARYM------
IOLA2_GEOKA      KMMTSRW-------
IOLA1_GEOTN      KMLTARW-------
IOLA_BACHD       KMITARW-------
IOLA3_GEOKA      KMVTARYQ------
IOLA2_GEOTN      KMVTARH-------
IOLA2_BACMK      KMLTARY-------
IOLA_BACSU       KVVTARYPAPDFN-
IOLA_BACNA       KVVTARFPAPDFN-
IOLA2_BACLD      KVVTARYPAPDFN-
IOLA_BACVZ       KVVTARYPSPDFN-
IOLA_LISIN       KVVTARYSLKGYEE
IOLA_LISMF       KVVTARYSLKGYEE
IOLA_LISMO       KVVTARYSLKGYEE
IOLA1_BACSK      KVVTARYPKPSFD-
IOLA_LACCA       KVVTARYDQRRFK-
                 *::* :