CLUSTAL format seed alignment for MF_01671

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

IOLG_AGRFC       -----MTVRIGVVGTGAIGRDHARRINKVLGGAKIVALSDVNRASAEAVKNDIAPDAVL-
IOLG_PARDP       -----MTLKIGVIGTGAIGQDHTRRINQVLAGARVAALNDVNRANAEACQRDHAPEARI-
IOLG_RHOS4       -----MTLRIGIIGTGAIGTDHARRINRVLSGAEVTAVTDVNRDSAEACVAGVAPGAQI-
IOLG_RHOS1       -----MTLRIGIIGTGAIGTDHARRINRVLSGAEVTAVTDVNRDNAEACVAGVAPGAQI-
IOLG_ACICJ       -----MTLRIGVIGTGAIGRDHMRRINQTLSGAKVTAVSDVNIESVRTARADLAPEAEV-
IOLG_BURCM       -----MTLQIGVIGCGAIGQDHIRRLTRTLSGARVVAVNDIDPQQARDAVTKYGLDAEI-
IOLG_BURA4       -----MTLQIGVIGCGAIGQDHIRRLTRKLSGARVVAVNDIDPQQARDAVTKYGLDAEI-
IOLG_BURCA       -----MTLQIGVIGCGAIGQDHIRRLTRTLSGARVVAVNDIDPQQARDAVTKYGLDAEI-
IOLG_BURCH       -----MTLQIGVIGCGAIGQDHIRRLTRTLSGARVVAVNDIDPQQARDAVTKYGLDAEI-
IOLG_BURCC       -----MTLQIGVIGCGAIGQDHIRRLTRTLSGARVVAVNDIDPQQARDAVTKYGLDAEI-
IOLG_BURL3       -----MTLQIGVIGCGAIGQDHIRRLTRTLSGARVVAVNDIDPQQARDAVTKYGLDAEI-
IOLG_BURVG       -----MTLQIGVIGCGAIGQDHIRRLTRTLSGARVVAVNDIDPQQARDAVTKYGLDAEI-
IOLG_BURM1       -----MTLQIGVIGCGAIGQDHIRRLMRTLSGARVVAVNDIDPQQARDAVTHYAPDAEI-
IOLG_RALSO       -----MTLQIGVIGCGAIGQDHIRRLTRTLSGARVVAVTDIDPTQAHAAVANHGLNAEV-
IOLG_DELAS       -----MTLQIGVIGCGAIGQDHVRRMYQTLSGARVVAVTDIDAQQVREVMARHGPDIEA-
IOLG_PSE14       -----MALKLGVIGTGAIGQDHIRRCSKTLVGSQVVAVTDINLEQAAKVVRELDIGAEV-
IOLG_PSESM       -----MALKLGVIGTGAIGQDHIRRCSKTLVGSQVVAVTDINLEQAANVVRDLGIGAEV-
IOLG_PSEU2       -----MALKLGVIGTGAIGQDHIRRCSKTLVGSQVVAVTDINLEQAAKVVRDLDLGAEV-
IOLG_PSEF5       -----MSLQLGVIGTGAIGQDHIRRCSQTLQGCRVVAVTDIDPQQAARVLAGLTLEAEV-
IOLG_SERP5       -----MTLNIGVIGTGAIGRDHIRRCSKVLQGSRIVAVNDINRDNAAKVVSDLKLDAKV-
IOLG_YERE8       -----MSLNIGVIGTGAIGQDHIRRCSKVLQGSRIVAVTDINRESATKVIRDLGIEANV-
IOLG_KLEP7       -----MSLKLGVIGAGAIGKEHIRRCTQVLQGATVVAVSDINADNARAAVALPGVQAEV-
IOLG_GLUDA       -----MTLGIGVIGTGAIGQDHIRRVSRALSGGRIVALNDINADNARRAAQEWAPDAVI-
IOLG_BACVZ       -----MNLRIGVIGTGAIGKEHINRITNKLSGAEITAVTDVNQEAAQQTVQDFNLNASV-
IOLG_BACSU       -----MSLRIGVIGTGAIGKEHINRITNKLSGAEIVAVTDVNQEAAQKVVEQYQLNATV-
IOLG_BACLD       -----MKLRIGVIGTGAIGKEHINRITNKLAGGEIVAVTDVNQEAAQQVVTDYSLNAKV-
IOLG_BACHD       -----MTLRFGVIGTGAIGREHMKRIENKLSGGKIVAVTDMNQEAAKQVVTQMKLEADV-
IOLG_BACSK       -----MTVRVGVIGTGAIGQDHIRRLECKLSGAKVTAVTDVNQDLARKVANTYAKQATV-
IOLG_SALPB       -----MTLKAGIVGIGMIGSDHLRRLANTVSGVEVVAVCDIVAGRAQAALDKYAIEAKD-
IOLG_SALTY       -----MTLKAGIVGIGMIGSDHLRRLANTVSGVEVVAVCDIVAGRAQAALDKYAIEAKD-
IOLG_LACPL       -MAEAHVTKVGIVGIGFIGSDHLHRLTKTVANVDVTAVCDIVPGKAQKALDQQGLTATT-
IOLG_LACCA       -----MVVKVGVIGTGAMGRAHIDRLTNVLTGAEVVAVTDIDHEAAEAAVRDFHLNAKV-
IOLG3_SACEN      -----MTVRVGVIGTGMIGQDHIRRLTRVVTGAEIVAVTDIDADRAASVAG--GVGART-
IOLG_ACIC1       -MATDRSVRIGLIGAGAIGEDHARRLSTVIRGADVVAVHDVDP-SRAKTVATRFRDARV-
IOLG2_PAEAT      -----MPIRVGVIGAGVMGADHIRNLSTTIGGAKVTFVADLDAGRAAAAAPPS---ARI-
IOLG_RUBXD       MRGDSERIAVGVVGTGGMGGMHAENLHFRVPGARLVAVADLDTRRAGGVAERSG--AEV-
IOLG1_SACEN      -----MTVRVGVVGTGVMGADHVRTLTGGVAGARVVAVSDADQGRGRAVAAEAGDEVVF-
IOLG2_SACEN      -----MTMNIGVIGCGLMGADHIRTLTTAVSGARVAAVNDADEGRAAGAAAEAEGARV--
IOLG1_PAEAT      ---MTKTLRVAVIGAGRMGADHIKRLSTRIHGAEVAAVVDVDLARAQAAIEGIDRAV---
IOLG_ARTS2       ---MTETLRVAVIGAGRMGADHIQRLSKRIHGAEVAAVVDVDLARAQAAVEGIPGAV---
IOLG_RENSM       -------MNVAVIGAGRMGADHVRRLHESINNATVAAVVDIDLDRAKAATEG-TGAL---
IOLG_CORGL       ---MSKSLRVGVVGAGAMGADHIDRINNRTSGAHISAIIEPDAARAAAAAEDAPGAQ---
IOLG_CORGB       ---MSKSLRVGVVGAGAMGADHIDRINNRTSGAHISAIIEPDAARAAAAAENAPGAQ---
IOLG_LEIXX       -MTTTPDLRVGVGGAGQMGADHIQRITRVISGATVSAIVEPDAGRAAAAAA-APGSR---
IOLG_MYCGI       ----MTDLRIAVLGVGVMGADHVARITSRISGARVAVVNDHLVEKAEQLAASIPGCS---
IOLG2_MYCVP      ----MSELRVAVLGVGVMGADHVARITSRISGARVSVVNDYVTEKAEQIASEVDGCR---
IOLG1_MYCVP      ----MSEIGVAVLGVGLMGADHVARIASRISGARVAVVNDQVTEKAERLAATITGCR---
IOLG_MYCS2       ----MSDLRVAVLGVGVMGADHVERLSTRIAGVKVAVVNDFIETRAEEIAAGVPGCR---
IOLG_RHOJR       -MSGSNDLRIAVLGVGMMGADHVARITERIKGATVAVVNDYFIEKAEQIAAGIPGCR---
IOLG_KINRD       -------MRVAVLGVGMMGQDHARRLATLTKGAQLVAVSDVDAARTDAVAAEL-GVR---
IOLG4_SACEN      --MSNRELRVGLVGAGLMGSDHATRIHRRISGASLVAVGDPDLERAERAAAGIEGCQ---
IOLG_STRAW       ---MSQLLGVAVLGAGHMGADHIRRLDSVVSGARVAAVADPAKERAEEAVAGLDG---VL
IOLG_STRCO       ---MSELLGVAVLGAGHMGADHIRRVDQVVSGARVAAVADPDAERAKEAVGGIGGTGRIT
                           .: * * :*  *         .  :  : :                    

IOLG_AGRFC       -FATGEELIASPDVEAVLVTSWGATHEQYVLAAIAAGKPCFCEKPLATTAEGARRIVDAE
IOLG_PARDP       -FDDPHALIRDAEVDAILVCSWGQTHEEYVLAAIAAGKPCFCEKPLATTAEGARRIVEAE
IOLG_RHOS4       -LGSAEEVIAAS--DAVLVCSWGTAHETQVLAAIAAGKPCFCEKPLATEAYGARRIVEAE
IOLG_RHOS1       -LGSAEEVIAAS--DAVLVCSWGAAHEAQVLAAIAAGKPCFCEKPLATEAYGARRIVEAE
IOLG_ACICJ       -VGSGEEVAASAGVDAVVVTSWGATHEQYVLAAIAAGKPVFCEKPLSTTAAGAGRIVEAE
IOLG_BURCM       -YGDGHEVVAAADVQAVLVTSWGPTHEAFVLDAIAHGKPVFCEKPLAVTAQGCMRIVEAE
IOLG_BURA4       -YGDGHEVVAAADVQAVLVTSWGPTHEAFVLDAIAHGKPVFCEKPLAVTAQGCMRIVEAE
IOLG_BURCA       -YGDGHEVVAAADVQAVLVTSWGPTHEAFVLDAIAHGKPVFCEKPLAVTAEGCMRIVEAE
IOLG_BURCH       -YGDGHEVVAAADVQAVLVTSWGPTHEAFVLDAIAHGKPVFCEKPLAVTAEGCMRIVEAE
IOLG_BURCC       -YADGHEVVAAAEVQAVLVTSWGPTHEAFVLDAIAHGKPVFCEKPLAVTADGCMRIVEAE
IOLG_BURL3       -YGDGHEVVAAADVQAVLVTSWGPTHEAFVLDAIAHGKPVFCEKPLAVTAEGCMRIVEAE
IOLG_BURVG       -YGDGHDVVAAADVQALLVTSWGPTHEAFVLDAIAHGKPVFCEKPLAVTADGCMRIVEAE
IOLG_BURM1       -YADGRDLIAAADVQAVLVTSWGPTHEAFVLDAIAHGKPVFCEKPLAVTADGCMRIVEAE
IOLG_RALSO       -YANGGDLIEAPDVQAVLVTSWGPTHEEFVLKAIAQGKPVFCEKPLAVTADGCMRIVAAE
IOLG_DELAS       -FDSGPALIAAPQVQAVLVTSWGPTHEELVLAAIAQGKPVFCEKPLAVTAAGCLRIVQAE
IOLG_PSE14       -YADGHALIAAPDVEAVLVCSWGPSHEEYVLAAIAAGKPVFCEKPLAVTAEGCRHIVEAE
IOLG_PSESM       -YADGHALIAAPDVEAVLVCSWGPSHEEYVLAAIAAGKPVFCEKPLAVTAEGCRHIVEAE
IOLG_PSEU2       -YADGHALIAAPDVEAVLVCSWGPSHEEYVLAAIAAGKPVFCEKPLAVTAEGCRHIVEAE
IOLG_PSEF5       -YPDGHALIQAPEVQALLVTSWGPSHEEFVLAAIAAGKPVFCEKPLAVTAAGCRRIVEAE
IOLG_SERP5       -YDNGHDLVKAADVQAVLVTSWGPSHEEFVLAAIAAGKPVFCEKPLAVTAQGCKNIVEAE
IOLG_YERE8       -YADGYEVINAKEVEAVLVTSWGPSHEEFVLAAVAAGKYVFCEKPLAVTAEGCKRIVEAE
IOLG_KLEP7       -YADGHDVINASDVDAILVTSWDPTHEEYTLAAIAAGKPVFCEKPLAMTAEGCRRIVDAE
IOLG_GLUDA       -CDTARDLVARPDVQAVMVTSWGGTHAEYVLDAIAAGKPVFCEKPLATNAADCLRIMEAE
IOLG_BACVZ       -YPDDDSLLAAENVDAVLVTSWGPAHESSVLKAIQHGKHVFCEKPLATTAEGCMRIVEEE
IOLG_BACSU       -YPNDDSLLADENVDAVLVTSWGPAHESSVLKAIKAQKYVFCEKPLATTAEGCMRIVEEE
IOLG_BACLD       -YPDDDSLIAAENVDAVLVTSWGPAHESSVLKAIKANKFVFCEKPLATTAEGCMRIVNEE
IOLG_BACHD       -YPDDRSLVAADNVDAVLVTSWGPAHEANVLAAIEAGKYVFVEKPLATTAEGCMKIIKAE
IOLG_BACSK       -YANDRELIAARDVDAVLVASWGPAHEASVLAALEAGKRVFCEKPLATTADGCMRIVEAE
IOLG_SALPB       -YNDYHDLINDKDVEVVIITASNEAHADVAVAALNANKYVFCEKPLAVTAADCQRVIEAE
IOLG_SALTY       -YNDYHDLINDKDVEVVIITASNEAHADVAVAALNANKYVFCEKPLAVTAADCQRVIEAE
IOLG_LACPL       -YEDYHDLVNDPNVEVVVCTANNEAHYEIVMAALKAGKFTFCEKPLALDAKQCMDIIDSE
IOLG_LACCA       -YPDDTSLLQDPDIDAVFVVSFGGAHEATVLKALDTDKFIFTEKPLATTLEGAKRIVDKE
IOLG3_SACEN      -MPSGADVIGSADVDAVLVTSWGPTHAEHVLAAIEAGKAVFCEKPLATEVEDCLRIVEAE
IOLG_ACIC1       -IPDGNSLIGDPDVDAVVVASAAPTHEAYVLAAIAARKPVFCEKPLATTAAGCLRIVEAE
IOLG2_PAEAT      -TTDPTELINSSDVDAVVVASHDSTHAGLVLECFEAMTPVLCEKPLAPTLLESLEVVAAD
IOLG_RUBXD       -FEDGFDLIRSDRVEAVVIASPDPTHAPLVLECLKNEKPVLCEKPLADSADAARKVVEAE
IOLG1_SACEN      -HADPVDLIGDAGVDAVVVASPDHTHEALATACVEAGKPVLCEKPLAATAADCLRIVAHE
IOLG2_SACEN      -HSDPFGLIDDAEVDAVVVASADETHEEFALACVRAGKPVLCEKPLATTSEACLRVVEAE
IOLG1_PAEAT      ALASADEALNNGDVNAVLIATPGFLHEEILYKALEKDFPILCEKPLTPDAGSAWKVVQAE
IOLG_ARTS2       ALADADEALNNGDVNAVLIATPGFLHEDILLKALARDIPILCEKPLTPDAESAWKIVQAE
IOLG_RENSM       AVASLAEAFAVEGVNAVLIATPGFLHEEALYQALQRDVPILCEKPMTPDAASAWRVVQAE
IOLG_CORGL       AFTRIEDAIAADAVDAVLIAVPGQFHEPVLVPALEAGLPILCEKPLTPDSESSLRIVELE
IOLG_CORGB       AFTRIEDAIAADAVDAVLIAVPGQFHEPVLVPALEAGLPILCEKPLTPDSESSLRIVELE
IOLG_LEIXX       AFASLDDALDASALEAVVIATPGQFHELVLVPALAAGLPVLCEKPLTPDSAEALRVLELE
IOLG_MYCGI       AVADPLDAIADADVDAVVLATPGGTHEEQLLACLDQRKPVMCEKPLTTDVSTSLEIARRE
IOLG2_MYCVP      AVVDPLDAIADPEVDAVVLATPGSTHEKQLLACLDHRKPVMCEKPLTTDVFTSLEIARRE
IOLG1_MYCVP      AIADPLDAIADRDVDAVVLATPGPTHEKQLLACLEHRKPVLCEKPLTTDVETSLEVVRRE
IOLG_MYCS2       VVSDPLEAIADPDVDAVVLATPGPTHDKQLLACLEQRKPVLCEKPLTTDVDSALDVVRRE
IOLG_RHOJR       VIGDPLDAIADPDVDAVVLATPGPTHEKQLLACLEHGKPVMCEKPLTTDVATSLEIVKRE
IOLG_KINRD       AVHDPAAAIADPEVDAVVIATPGFTHEGLVLEAIAAGKPTLCEKPLTTSPETARAVVEAE
IOLG4_SACEN      VETDPLKVIEASDVDAVVLATPGRTHEPLLLAAIERGIPVLCEKPLTPDSKSSLRVVEAE
IOLG_STRAW       VHTEVAAALDAPGVEAVLIASPGPAHEEALLAAFARGLPVLCEKPMVPDSAGALRIVEAE
IOLG_STRCO       VHTDVEAALDAPGVEAVLIASPGEAHEEALLAAFARGLPVLCEKPMAPNSAGALRVVEAE
                               :.:.       *      ..      : ***:      .  :   :

IOLG_AGRFC       VAH----GKRLVQVGFMRRYDAGYVALKQAVDN-RIGAPIMVHAAHRNPSVPEQYVTPMA
IOLG_PARDP       EAA----GKRLVQVGFMRRYDPGYVALKKAVAE-VTGAPLMVHAAHRNPRVGENYLTPMA
IOLG_RHOS4       EAM----GRRLVQVGFMRRYDRGYVALKETVRT-RLGPPLMIHAAHRNPSVPGRYRTPMA
IOLG_RHOS1       GAM----GRRLVQVGFMRRYDRGYIALKETVRT-RLGPPLMIHAAHRNPTVPGRYRTPMA
IOLG_ACICJ       TAF----GRRLVQVGFMRRYDAGYRMLKAVVEN-EIGRPLMVHAAHRNPSVPEQYITPMA
IOLG_BURCM       VAH----GRRLVQVGFMRPYDEGYRALKHVIDSGEIGAPLMLHCAHRNQSVGERYTTDMA
IOLG_BURA4       VAH----GRRLVQVGFMRPYDEGYRALKHVIDSGGIGAPLMLHCAHRNQSVGERYTTDMA
IOLG_BURCA       VAH----GKRLVQVGFMRPYDEGYRALKRVIDSGQIGAPLMLHCAHRNQSVGERYTTDMA
IOLG_BURCH       VAH----GKRLVQVGFMRPYDEGYRALKRVIDSGQIGAPLMLHCAHRNQSVGERYTTDMA
IOLG_BURCC       VAH----GKRLVQVGFMRPYDEGYRALKRVIDSGQIGAPLMLHCAHRNQSVGERYTTDMA
IOLG_BURL3       VAH----GKRLVQVGFMRPYDEGYRALKRVIDSGEIGAPLMLHCAHRNQSVGERYTTDMA
IOLG_BURVG       VAH----GKRLVQVGFMRPYDEGYRALKRVIDSGEIGAPLMLHCAHRNQSVGERYTTDMA
IOLG_BURM1       LAH----GTRLVQVGFMRPYDEGYRALKRVIDSGQIGAPLMLHCAHRNQSVGERYTTDMA
IOLG_RALSO       QAH----GSRLVQVGFMRPYDAGYRALKQVIDSGTIGAPLMLHCAHRNPSVGDRYMTDMA
IOLG_DELAS       MAH----GQRLVQVGFMRPYDAGYRALRQVIASGQIGAPLMVHCAHRNPCVADGYTTGMA
IOLG_PSE14       IAS----GRRLVQVGFMRPYDQGYRALKSVIDSGRIGEPLMLHCAHRNPRVGENYKTDMA
IOLG_PSESM       IAS----GRRLVQVGFMRPYDQGYRALKSVIDSGQIGEPLMLHCAHRNPRVGENYKTDMA
IOLG_PSEU2       IAS----GRRLVQVGFMRPYDQGYRALKAAIDSGQIGEPLMLHCAHRNPSVGENYKTDMA
IOLG_PSEF5       IAQ----GRRLVQVGFMRPYDAGYQALKAVVDSGRIGEPLMLHCAHRNPRVGENYKTDMA
IOLG_SERP5       AKH----GKRLVQVGFMRPYDQGYRALKQVLTSGQIGEPLMLHCAHRNPTVGEAYTTDMA
IOLG_YERE8       AAQ----GKRLVQVGFMRPYDQGYRALKDVITSGKIGEPLMLHCAHRNPRVGDNYTTSMA
IOLG_KLEP7       MKA----GRRLVQVGFMRPYDEGYLALKKVIDDGDIGAPLMLRCAHRNQSVGENYTTDMA
IOLG_GLUDA       MAR----GRRLVQVGFNRRYDSGYLDLKAILDNGTIGDVLMVHAMHRNQRVGPNYKTEMA
IOLG_BACVZ       MKT----GKRLVQVGFMRRYDSGYVQLKEAIDNRVVGEPLMIHCAHRNPTVASNYSTEMA
IOLG_BACSU       IKV----GKRLVQVGFMRRYDSGYVQLKEALDNHVIGEPLMIHCAHRNPTVGDNYTTDMA
IOLG_BACLD       VKA----GKRLVQVGFMRRYDSGYVQLKEAIDNRVIGEPLMIHCAHRNPVVGDNYTTDMA
IOLG_BACHD       MNH----GKRLVQVGFMRRYDKGYVQLKKAIDDHFIGEPLMVRCAHRNPEVGESYIDDMA
IOLG_BACSK       MAH----GKRLVQVGFMRRFDSGYLQLKQALEQELVGEPLMVRCIHRNVESAESYTTDMA
IOLG_SALPB       QKN----GKRMVQIGFMRRYDKGYVQLKNIIDSGEIGQPLMVHGRHYNASTVPEYKTPQA
IOLG_SALTY       QKN----GKRMVQIGFMRRYDKGYVQLKNIIDSGEIGQPLMVHGRHYNASTVPEYKTPQA
IOLG_LACPL       KKL----GRRMLQVGFMRHYAPEYVQMKKMIDDGVIGKPLMMDQRHYNQTQPEEYDSSRS
IOLG_LACCA       LTK----SKKVIQVGFMRRYDQGIRALKEKLDTGIIGAPLVVRASHINPNVASNYSNEMA
IOLG3_SACEN      SAR----GKRLVQVGFMRRYDAGYREMKELVDAGGIGTPLMAHCVHRNPTVPETYHSAMA
IOLG_ACIC1       KAH----GRRFVRVGFMRRFDPAYLGLKAELRSGAIGHPLLAHLAHRNPAVPSTLRTTDA
IOLG2_PAEAT      ADIVAATGASLLSLGFMRRFDPGYVALRQAVQGRVQGEPLMVHCVSRNAAAGPGTTSELA
IOLG_RUBXD       VEL----GRKLVQVGFMRRYDPQHVAVKEAVASGAVGAPVLFRGWHRNADIEPGITSEWV
IOLG1_SACEN      VAK----GRRLVQAGYMRRFDPSYVDMKRALDAGSIGDPVLVHCVHRNARALHFFTPEMP
IOLG2_SACEN      MRG----GRPLVQVGFMRRFDPSYLEMKRVLDSGRIGRALMLHSVHRNAGYPPALPDSAL
IOLG1_PAEAT      QAL----GHKRIQVGFMRRFDAEYSALGAIIRNSELGELLMLHHQHRNPSTPEGFTNEML
IOLG_ARTS2       EKL----GHKRIQVGFMRRFDAEYAALGQVIRDHELGELLMLHHQHRNPTTPPGFTNEML
IOLG_RENSM       VAL----GRQRIQVGFMRQFDAGYQSLKSEIEAGAAGSLLMLHCANRNASTLADFTEPML
IOLG_CORGL       QKL----DKPHIQVGFMRRFDPEYNNLRKLVESGEAGELLMLRGLHRNPSVGESYTQSML
IOLG_CORGB       QKL----DKPHIQVGFMRRFDPEYNNLRKLVESGEAGELLMLRGLHRNPSVGENYTQSML
IOLG_LEIXX       QTL----DRPHIQLGFMRRFDDEYRALRELVVSGDAGELLFLRGVHRNPSVPESYTQSML
IOLG_MYCGI       ADL----GRPLIQVGFMRRFDDEYVRLKALLDGGELGNPLMMHCVHRNPGVPAYFDSSLI
IOLG2_MYCVP      AEL----ECPLIQVGFMRRFDDEYMRLKALLDGGELGQPLVMHCVHRNPGVPSYFDSSLI
IOLG1_MYCVP      AEL----GVRLIQVGFMRRFDDEYRALKALIDGGELGNPLVLHCVHRNPVVPGHFDSAMT
IOLG_MYCS2       AEL----GVRLIQVGFMRRFDPEYAELKTLIDAGEFGQPLVLHCVHRNAAVPPSFDSTMI
IOLG_RHOJR       AEL----GKKLIQVGFMRRFDHEYEQLKTLIDDGTFGQVLLAHCVHRNPAVPPSFDSSMI
IOLG_KINRD       RAL----GRPLVQVGFMRRFDAEYEQLRALVASRELGRPLFLHCVHRNATTPPNFNSEML
IOLG4_SACEN      VAA----GRRLVQVGFMRRFDPEYAELKRTLHAGALGRPLLMHCAHRNASAPPGFTSQMM
IOLG_STRAW       ARL----GRRLAQVGFMRRYDAEYMGLKSLLDSGRLGRPLMLHCTHRNVSSPPGFTSAML
IOLG_STRCO       ARL----GRRLAQIGFMRRYDAEYRQLKSLLDGGRLGRPLMLHCVHRNVSSPPHFTSAML
                               *: * :      :   :     *  :.      *            

IOLG_AGRFC       IHDTMIHEIDVLRWLLDDDYVSARVLFP------------RSAARS-HAKLKDPQIVILE
IOLG_PARDP       IHDTLIHEIDVLRWLLDDDYVGARVLFP------------RKSPRA-HEKLRDPQVVVLE
IOLG_RHOS4       IHDTLIHEIDVLRWLLDDEYVSAQVIFP------------RATRHT-HAGLRDPQIVLLE
IOLG_RHOS1       IHDTLIHEIDVLRWLLDDEYVSAQVIFP------------RATRHT-HAGLRDPQIVLLE
IOLG_ACICJ       IQDTLIHEIDVLRWLLDDDYVSAQVISP------------RRTRHA-HARVEDPQIVLLE
IOLG_BURCM       ITDTLIHELDVLRWLLGEDYTSAQVVYP------------KKTRHA-SAHLADPQIVLLE
IOLG_BURA4       ITDTLIHELDVLRWLLGEDYTSAQVVYP------------KKTRHA-SAHLADPQIVLLE
IOLG_BURCA       ITDTLIHELDVLRWLLGEDYASAQVVYP------------KKTRHA-SAHLADPQIVLLE
IOLG_BURCH       ITDTLIHELDVLRWLLGEDYASAQVVYP------------KKTRHA-SAHLADPQIVLLE
IOLG_BURCC       ITDTLIHELDVLRWLLGEDYASAQVVYP------------KKTHHA-SAHLADPQIVLLE
IOLG_BURL3       ITDTLIHELDVLRWLLGEDYVSTQVVYP------------KKTRHA-SSHLADPQIVLLE
IOLG_BURVG       ITDTLIHELDVLRWLLGEDYASAQVVYP------------KKTRHA-SAHLADPQIVLLE
IOLG_BURM1       ITDTLIHELDVLRWLLGEDYVSAQVVYP------------KKTRHA-STHLADPQIVLLE
IOLG_RALSO       ITDTLIHELDVLRWLTGDDYVSAQVVYP------------RKTRHA-SSHLADPQIVLLE
IOLG_DELAS       ITDTLIHELDVLRWLLDDEYASAQVVYP------------KRTRHA-LPHLADPQIVLLE
IOLG_PSE14       ITDTLIHELNVLRWLLNDDYVSVQVVFP------------RKTSKA-LAHMKDPQIVMLE
IOLG_PSESM       ITDTLIHELNVLRWLLNDDYVSVQVVFP------------RKSGKA-LAHMKDPQIVMLE
IOLG_PSEU2       ITDTLIHELNVLRWLLDDDYVSVQVVFP------------RKTSKA-LAHLKDPQIVMLE
IOLG_PSEF5       ITDTLIHELDVLRWLLADDYVSVQVLFP------------RKTGKA-HAQLRDPQIVLLE
IOLG_SERP5       ITDTLIHEIDVLRWLLDDDYVSVQVVFP------------RKSAKA-FPHLKDPQIVLFE
IOLG_YERE8       ITDTLIHEIDVLRWLLDDDYVSVQVVFP------------RKAKHA-KTHLRDPQVVLFE
IOLG_KLEP7       ITNTLIHELDVLRWLLNDDYRSVQVRFP------------RSTSHT-HARLKDPQIVSFE
IOLG_GLUDA       ITDTLVHELDVHRWLLDGEYVSAQVIFP------------RRTSKA-LPHMRDPQIALLE
IOLG_BACVZ       VVDTLVHEIDVLHWLVNDDYESVQVIYP------------KKSKNA-LPHLKDPQMVIIE
IOLG_BACSU       VVDTLVHEIDVLHWLVNDDYESVQVIYP------------KKSKNA-LPHLKDPQIVVIE
IOLG_BACLD       VVDTLVHEIDALHWLINDDYESVQVIYP------------KKSKNA-LPHLRDPQIVIIE
IOLG_BACHD       IHDTLIHEIDVLHWLIDDEYESVSVSFP------------KKTKHA-LPHLRDPRVVTLE
IOLG_BACSK       ITDTLIHEIDVLHWLLNDEYQHVRVLYP------------KKTKHA-LPHLQDPQLVLLE
IOLG_SALPB       IYETLIHEIDVMHWLLNEDYKTVKVYFP------------RQSSLVTTLR--DPQLVVME
IOLG_SALTY       IYETLIHEIDVMHWLLNEDYKTVKVYFP------------RQSSLVTTLR--DPQLVVME
IOLG_LACPL       IIETAIHEIDIDHWLVNDDYANIRVFSP------------KQTRHVQNAKIQDPQIVMIE
IOLG_LACCA       ITDTLIHEIDEMHWLLDDEYTSIQITYP------------RQSAEVRNEGLHDPQLATLT
IOLG3_SACEN      AQDTAVHEIDTLRWLLDDEIVSAQVIRP------------RRTSKR-FEHLQDPQIMLFE
IOLG_ACIC1       IADSLVHEMDLVRWLFDTEIREVRAVAG------------RRNAKA-GPDLHDPLLVLVR
IOLG2_PAEAT      ITNSAIHELDIIPWLLGSPVTEVSWQAG------------KQTSRA-EPGLQDPSFMTLR
IOLG_RUBXD       VINATIHDIDSARWFIEEEIEEVYVRGM------------NTAPKL-GANVWDLQLIQFT
IOLG1_SACEN      FTSAAVHEFDVVRWLLSSEIVRVTVHRT------------RSSSRA-AARLADPRLLVLE
IOLG2_SACEN      ITGTGVHDIDIARWLLGQEIVTATAHTP------------RRSGLA-RPDFQDTRFLVLE
IOLG1_PAEAT      INDSVVHEFDAIRFFTGEEITSVQVRL------------GKPTRSA-PSGQHDPQHVLLE
IOLG_ARTS2       INDSVVHEFDAIRFFTGEEITSVQVRL------------GKATKNA-PAGQHDPQHVLVE
IOLG_RENSM       INDSVVHEFDAIRFFTGEEITSVQVQVQVQVQVQVQVQRGKRSSLA-PEGISDPQHVLIE
IOLG_CORGL       ITDSVVHEFDVIPWLAGSRVVSVEVKYP------------KTSSLA-HSGLKEPILVIME
IOLG_CORGB       ITDSVVHEFDVIPWLAGSRVVSVEVKYP------------KTSSLA-HSGLKEPILVIME
IOLG_LEIXX       ITDSVVHEFDVMPWLAGSPVASVEVKYP------------RRNDRA-PERLREPILVLIE
IOLG_MYCGI       VKDSLVHEVDITRYLFGEEIASVQIIKP------------TSNPGA-PNGVVDPQIAILR
IOLG2_MYCVP      VKDSLVHEVDVTRYLFGEEIASVQIVRP------------VSNPAA-PEGVIDPQIAILR
IOLG1_MYCVP      VRDSLVHEVDVTRFLFDEEIVSIQIVKP------------TPNSLA-REGLFDPQIAILR
IOLG_MYCS2       VKDSLVHEVDVTRFLFDEEIASVHILRP------------TPNPGA-PEGIQDPQIAIMK
IOLG_RHOJR       VKDSLVHEVDVTRFLFDEEITSVHILRP------------AANPGA-PEGLQDPQIALFS
IOLG_KINRD       ILDSVVHEVDIARFLLGEEITAITVLTP------------GRTAHA-PEGLQDPQFVLME
IOLG4_SACEN      IFDSVVHEFDTTRWLLGEEITAVSVRHP------------RSTANA-PSGMTDPQLVTIE
IOLG_STRAW       INSSVSHEIDAARWLLGQELTAVTVLRP------------RPSAHA-PEGLLDPQFVLFE
IOLG_STRCO       INSSVSHEIDAARWLLGQELSAVTVLRP------------RPSAGA-PEGLLDPQLVLFE
                    :  *:.:   ::                                     :     . 

IOLG_AGRFC       TAKGTIIDVEIFVNCHYGYDIQCQVVGEDGIASLPEPMSVQT----------RLGARLQN
IOLG_PARDP       TARGVVIDVEVFVNCHYGYDIQCEIVGEDGIARLPEPMGIQT----------RSGAVLGQ
IOLG_RHOS4       TAKGVRIDVEIFVNCRYGYDIQCEVVGEEGTARLPEPTAIPT----------RLGAVFGQ
IOLG_RHOS1       TAKGVRIDVEIFVNCRYGYDIQCEVVGEEGTARLPEPMAIPT----------RLGAMFGQ
IOLG_ACICJ       TKSGIRIDVEIFVNCRYGYDIQCQVVGEEGLASLPDPMAVVM----------RKDAKLQS
IOLG_BURCM       TASGVRIDVEIFVNCQYGYDIQCEVVGENGIAKLPDPPAVGL----------KHAARRSV
IOLG_BURA4       TASGVRIDVEIFVNCQYGYDIQCEVVGENGIAKLPDPPAVGL----------KHAARQSV
IOLG_BURCA       TASGVRIDVEIFVNCQYGYDIQCEVVGEQGIAKLPDPPAVGL----------KHAARQSV
IOLG_BURCH       TASGVRIDVEIFVNCQYGYDIQCEVVGEQGIAKLPDPPAVGL----------KHAARQSV
IOLG_BURCC       TASGVRIDVEIFVNCQYGYDIQCEVVGEQGIAKLPDPPAVGL----------KHAARQSV
IOLG_BURL3       TASGVRIDVEIFVNCQYGYDIQCEVVGEQGIAKLPDPPAVGL----------KHGARQSV
IOLG_BURVG       TVSGVRIDVEIFVNCQYGYDIQCEVVGENGIAKLPDPPAVGL----------KHAARQSV
IOLG_BURM1       TVSGVRIDVEIFVNCQYGYDIQCEVVGENGIAKLPDPPAVGL----------KHLARQSV
IOLG_RALSO       TAQGVRIDVEIFVNCQYGYDIQCEVVGENGIATLPDPQAVSL----------KHAARHAI
IOLG_DELAS       TVGGIRIDVEVFVNCRYGYDIQCEVVGETGIARMPDPAAVPL----------KSAAMYSI
IOLG_PSE14       TARGTRIDVEVFVNCQYGYDIQCEVVGESGIAKLPEPSQVQL----------RSEAKLSN
IOLG_PSESM       TARGTRIDVEVFVNCQYGYDIQCEVVGESGIARLPEPSQVQL----------RREAKLSN
IOLG_PSEU2       TVKGTRIDVEVFVNCQYGYDIQCEVVGETGIARLPEPSQVQL----------RSEAKLSN
IOLG_PSEF5       TARGTRIDVEIFVNCQYGYDIQCEVVGESGIARLPEPPQVQL----------RSAASLSS
IOLG_SERP5       TAKGTRIDVEIFVNCQYGYDIQCEVVGETGIAKLPEPSSVQM----------RSGAKLST
IOLG_YERE8       TAKGTRIDVEIFVNCQYGYDIQCEVVGDSGIAKLPEPSSVLL----------RSEARLSN
IOLG_KLEP7       TKKGTLIDVEVFVNCQYGYDIQCEVVGETGIARLPEPSAVQM----------RKSASLST
IOLG_GLUDA       TKRGIRIDVEIFVNCQYGYDIQCAVVGELGQANLPDPPAVPV----------KTGETLSR
IOLG_BACVZ       TKGGIVINAEIYVNCKYGYDIQCEIVGEDGIIKLPEPSSISL----------RKEGKFST
IOLG_BACSU       TKGGIVINAEIYVNCKYGYDIQCEIVGEDGIIKLPEPSSISL----------RKEGRFST
IOLG_BACLD       TKGGVVINAEIYVNCKYGYDIQCEIVGEDGIVKLPEPSSISL----------RKDGKFST
IOLG_BACHD       TKGGVLITAEVFVNCKYGYDIQCEVIREEGIASLPEVDSISF----------RKRATLGT
IOLG_BACSK       TKKGVIIQAEIFVNCKYGYDIQCEIAGEEGVISLPDVPAVRL----------CSNGRKGT
IOLG_SALPB       TTSGINIVVEVFVNCQYGYDIHCDVTGEKGMAELPTVASAAV----------RKAAKYST
IOLG_SALTY       TTSGINIVVEVFVNCQYGYDIHCDVTGEKGMAELPTVASAAV----------RKAAKYST
IOLG_LACPL       TKSGINIINEVFVRCQYGYDIKCDVIGEEGVLELPTVPQVAT----------RLNAQYST
IOLG_LACCA       TKKGTVIQVLVHVTAQYGYEVKLEVIGETGELQLPNYGLGPIL---------RSNANQQT
IOLG3_SACEN      TESGARIDVEVFVNCQYGYDIQCEVVGESGTVRLPDPARTGL----------PSAGSVRA
IOLG_ACIC1       MATDVVVDVELSLNIGYGYHIRAEIVGENGTVALASEQPIVR----------RISGEERR
IOLG2_PAEAT      TADGTLTTLELYLNAQYGYTTRCEVVSEQGTTSLQESSLLGI----------EQDGTRQA
IOLG_RUBXD       TAGGRLGSIETNVVSGYGYEVGVEIVGERGTVQVPPLSGAIV----------RRGFAASQ
IOLG1_SACEN      TAAGVTVDVEVFVNAQYGYDVRCELVGELGTVSLALPSTTVV----------RAGGAEGV
IOLG2_SACEN      TENGVLVDVEIFVNAGYGYDVRGELVGELGSISLHPPATLTT----------RYEGLEGR
IOLG1_PAEAT      TESGVLADVEIYVNAKFGYQVATQASFEEGIVSIGSDNGPYVQ----------TAGKWGG
IOLG_ARTS2       TESGVLADVEIFVNAKFGYEVATQASFEDGIVSIGGDKGPYTR----------AAGRWGG
IOLG_RENSM       TESGILADVEIFVNARYGYEVATQAVFENGVRSIGA-----------------------G
IOLG_CORGL       LENGVLVDVEMNVNIQFGYQVATEAVFEKGLARIGQPSGMQRW----------RDGEFLI
IOLG_CORGB       LENGVLVDVEMNVNIQFGYQVATEAVFEKGLARIGQPSGMQRW----------RDGEFLI
IOLG_LEIXX       LRNGVLVDVEMNVSVRFGYQVATEAVFQTGTARIGQPAGLQRW----------SDARFSI
IOLG_MYCGI       TVSGRHVDVELFVTTGVAYEVRTEVVGEHGSAIIGLDVGLIRK---------KGPGSWGG
IOLG2_MYCVP      TVSGRHVDVELFVTTGVAYEVRTEVVGERGSAMIGLDVGLIRK---------SAPGTWGG
IOLG1_MYCVP      TASGRHVDVELFVTTGVAYEVRTELVAEKGSVIIGLDVGLVRK---------SAPGTWGG
IOLG_MYCS2       TPSGKHVDVELFVTTGVGYEVRTELVAEKGTAMIGLDVGLIRK---------GVPGTWGG
IOLG_RHOJR       TESGRHVDVEVFVTTGVAYEVRTEIVAEKGSAFIGLDVGLVRKFGTGAGNGRSGAGMSGG
IOLG_KINRD       TASGTLVDVEIFVNTTFGYEVRTELVAERGSAMTGLGVGLVQH----------SAAGWGG
IOLG4_SACEN      TASGVLVTVEIFVNCGFGYQVRCEAVCEGGTAQVGGDSGMTTH----------VRGAWGG
IOLG_STRAW       TAGGALVDVEILVNSGFGYQVRCEAVCEAGSVRIGDAHTMVVT----------SAGGAYQ
IOLG_STRCO       TEGGAVVDVEVFVNCGFGYEVRCEAVCEAGSARIGAAHTMMVT----------AAGGARE
                    .        :    .*        : *                              

IOLG_AGRFC       DILTDWKDRFIASYDVELQDFIHAAA-K------GTASGPNSWDGYVAAISSDACVAAQE
IOLG_PARDP       PILMDWKDRFIDSYDYELADFLKAAA-R------GTAAGPTAWDGYVAAVTADACVAAQE
IOLG_RHOS4       PILMDWKDRFIDSYDVELQDFLKAAA-Q------GTAAGPSAWDGYAAAITADVCVQAQE
IOLG_RHOS1       PILMDWKDRFIDSYDVELQDFLKAAA-Q------GTAAGPSAWDGYAAAITADVCVQAQE
IOLG_ACICJ       AIMTDWKDRFIDSYDLELQDFIKAAA-R------GTASGPTAWDGYVAAVSSDACVEAQS
IOLG_BURCM       EIMTDWKERFIASYDVELQAFIDGVR-Q------GALTGPSAWDGYAAAVAADACVRAQQ
IOLG_BURA4       EIMTDWKERFIASYDVELQAFIDGVR-Q------GALTGPSAWDGYAAAVAADACVRAQQ
IOLG_BURCA       EIMTDWKERFIASYDVELQAFIDGVR-Q------GALTGPSAWDGYAAAVAADACVRAQQ
IOLG_BURCH       EIMTDWKERFIASYDVELQAFIDGVR-Q------GALTGPSAWDGYAAAVAADACVRAQQ
IOLG_BURCC       EIMTDWKERFIASYDVELQAFIDGVR-Q------GALTGPSAWDGYAAAVAADACVRAQK
IOLG_BURL3       EIMTDWKERFIASYDVELQAFIDGVR-A------HALTGPSAWDGYAAAVAADACVRAQK
IOLG_BURVG       EIMTDWKERFIASYDVELQAFIDGVR-A------GALTGPSAWDGYAAAVAADACVRAQR
IOLG_BURM1       EIMTDWKERFIASYDVELQAFIDGVR-R------QTLTGPSAWDGYAAAVAADACVRAQK
IOLG_RALSO       AILTDWKDRFIAAYDIELQAFIDGVQ-G------GALTGPSAWDGYAAAVAADACVRAQK
IOLG_DELAS       PILTDWKQRFMAAYDVELQAFIDGVR-G------QRLTGPSAWDAHAAAVAADACVLAQS
IOLG_PSE14       AILMDWKDRFIAAYDVELQDFIDGVN-A------GTIYGPSAWDGYAAAVAADACVQAQN
IOLG_PSESM       AILMDWKDRFIAAYDVELQDFIDGVK-A------GTIYGPSAWDGYAAAVAADACVLAQN
IOLG_PSEU2       AILMDWKDRFIAAYDVELQDFIDGVK-G------GTLYGPSAWDGYAAAVAADACVLAQN
IOLG_PSEF5       AILMDWKERFIAAYDVELQAFVDGVR-A------GRVGGPSAWDGLAAAVAADACIEAQQ
IOLG_SERP5       EILTDWKDRFIDAYDVELQGFINDVL-A------GKLTGPSAWDGYAAAVTADACVAAQL
IOLG_YERE8       EILTDWKDRFIDAYDVELQAFINDVL-A------EKLTGPSAWDGFAAAVTADACIAAQE
IOLG_KLEP7       AILTDWKDRFIKAYDVELQAFINDVK-A------GQLHGPSAWDGYAASVAADACIKAQG
IOLG_GLUDA       HIMNDWKYRFIDAYDAEIQDFIDRAS-T------GSPAGPDSWAGYAASVAADACVRAQE
IOLG_BACVZ       DILMDWQRRFVAAYDVEIQDFIDSIRNK------GEVSGPTAWDGYIAAVTTDACVKA-Q
IOLG_BACSU       DILMDWQRRFVAAYDVEIQDFIDSIQKK------GEVSGPTAWDGYIAAVTTDACVKA-Q
IOLG_BACLD       DILMDWQRRFVDAYDVEIQDFIDSIQQK------GEVSGPTAWDGYIAAVTTDACVKA-Q
IOLG_BACHD       NILMDWKQRFIEAYDVELQHFIDSIKQS------GEPSGPNAWDGYVAAITADAALKA-S
IOLG_BACSK       EVLQDWKKRFEAAYDVELQAFIDDGLKD------EPASGPSAWDGYVAAVTADACVKA-Q
IOLG_SALPB       DILVDWKQRFIDAYDIEFQDFFDRLNAG------LPPAGPTSWDGYLAAVTADACVKS-Q
IOLG_SALTY       DILVDWKQRFIDAYDIEFQDFFDRLNAG------LPPAGPTSWDGYLAAVTADACVKS-Q
IOLG_LACPL       AILTDWKARFESAYDIEFRDFINHVSQN------ESPVGPSAWDGYIAAVTADAALKSLA
IOLG_LACCA       AVEMSWINRFIQAYNTEVQEFIDQVAKS------EPPVGPSAWDGYIAAITAAAANRS-Q
IOLG3_SACEN      AITQDWKQRFADAFDAELQSWVDSVA-H------GAAGGPSAWDGYAATAICGATVEALH
IOLG_ACIC1       PVAQHWKTRFAAAYDAELSEWVRDVS-Q------GRVSGPSAWDGYAATLATDAAAESLR
IOLG2_PAEAT      VIPADWRPRFADAYRLQLQAWISALAGG------EAPSLAGAQDGLNASLVAQAMIQSLH
IOLG_RUBXD       RIEDGWLARFHAAYVIEMQGWVGALLRG------EAPAGPDAWDGYASLVVADACIASLR
IOLG1_SACEN      AVHADFRTRFAEAYRLQLQAWVDAAARG------EA-CGPSAWDGYAATAVAEACLRAQE
IOLG2_SACEN      PVARDFRPRFQDAYRNELQAWVTAGASG------EV-RGATAWDGYASAAVAEACLHSVA
IOLG1_PAEAT      NVTPGFEERFGAAYDVEVQAWVDAALRG-------EIGGPTAWDGYATAACCEAGVEAQK
IOLG_ARTS2       NVTPGFEERFGAAYDVEIQSWVDAALRG-------EIGGPTAWDGYATAACCEAGVEAQK
IOLG_RENSM       EVTPSFIERFAAAYDAEVQAWVDAALHG-------EIGGPSAWDGYATAACCEAGVAAQR
IOLG_CORGL       NEHTDFTTRFATAYDRQIQSWVDAVHEGT------LVAGPNAWDGYLVALSCEAGVKAL-
IOLG_CORGB       NEHTDFTTRFATAYDRQIQSWVDAVHEGT------LVAGPNAWDGYLVALSCEAGVKAF-
IOLG_LEIXX       AEHTSFTTRFARAYDAQVQAWVDAVRDGS------LVAGPNAWDGYLVALACEAGVRALS
IOLG_MYCGI       TLTPGFRERFGPAYDTEIQRWVDAVHSG------TNVCGPTAWDGYAAAAVCAAGVESLE
IOLG2_MYCVP      LIAPGFRERFGRAYDTEIQRWVDAVRAG------TNIDGPTAWDGYAAAAVCAAGVESLE
IOLG1_MYCVP      TITPSFKERFGQAYDTEIQRWVDAVRSGGTTG--IYTDGPTAWDGYAATAVCEAGVQALQ
IOLG_MYCS2       AIAPDFRVRFGTAYDIEFQRWVAAVRHGIATGSDDYTDGPTAWDGYAAAAVCAAGVESLA
IOLG_RHOJR       EITPSFKERFGQAYDVEIQRWVNAARTGAETG--NYIDGPGAWDGYAAAAVCAAGVQSLE
IOLG_KINRD       RIAADFKQRFGAAYDTEFQRWVDAVRSG------AGVDGPGVWDGYAAAAVCAAGVQSLR
IOLG4_SACEN      SVAPDFRPRFQQAFDEELQRWADAARAG-------GIDGASAWDGCAAAAACEAGVAAQT
IOLG_STRAW       EVAQDYLVRFADAYDREVREWVDATRRG-------QVTGPSAWDGYAASVVAEAGVRAQD
IOLG_STRCO       EVPQDYLVRFADAYDREVQSWVDATRRG-------LVTGPGTWDGYAAAAVAEAGVRALD
                      :  **  ::  :.  :                  .    .        .   :  

IOLG_AGRFC       TQGAAVAIDLPARPALYQ------------
IOLG_PARDP       AGGESVAIELPARPALYA------------
IOLG_RHOS4       RPGAILPVTLPARPALYA------------
IOLG_RHOS1       RPGAILPVTLPARPALYA------------
IOLG_ACICJ       RPGSIVPISLPARPPLYN------------
IOLG_BURCM       S-GAVEPIAMAERPAFYRG-----------
IOLG_BURA4       S-GAVEPIAMAERPAFYRG-----------
IOLG_BURCA       S-GAVEPIAMAERPAFYRG-----------
IOLG_BURCH       S-GAVEPIAMAERPAFYRG-----------
IOLG_BURCC       S-GAVEAIAMAERPAFYRG-----------
IOLG_BURL3       S-GAVEPIAMAERPAFYRG-----------
IOLG_BURVG       S-AAVEPIAMAERPAFYRG-----------
IOLG_BURM1       S-GAVEPIAIAERPAFYRA-----------
IOLG_RALSO       S-GAIERIEMAARPAFYRG-----------
IOLG_DELAS       S-GAVERMAAAPRPAFYQS-----------
IOLG_PSE14       S-GAVVPIALEMRPAFYD------------
IOLG_PSESM       N-GAVVPITLAMRPAFYA------------
IOLG_PSEU2       T-GAVVPITLAMRPVFYS------------
IOLG_PSEF5       S-GAIVPISLPQRPALYA------------
IOLG_SERP5       S-GEIVPVTLPPRPAFYNK-----------
IOLG_YERE8       S-GQIVPIRLPQRPDFYDK-----------
IOLG_KLEP7       T-SEPVEVTLPECPAFYKR-----------
IOLG_GLUDA       S-GRIEPIEMIAKPAFYSR-----------
IOLG_BACVZ       ESGQKEPVALQEKPAFYQSFTTVNK-----
IOLG_BACSU       ESGQKEKVELKEKPEFYQSFTTVQN-----
IOLG_BACLD       ESGQKEPVALQEKPEFYQTFTTVKK-----
IOLG_BACHD       NSGQKQFISLKEKPAFYSVKKENAHEAML-
IOLG_BACSK       ESGREESIELPKKPAFYQHSAATPEQV---
IOLG_SALPB       ETGNTEIVELPSKPDFYK------------
IOLG_SALTY       ETGNTEIVELPSKPDFYK------------
IOLG_LACPL       EDGAKQDLDFPSTPAFYTESEKVSE-----
IOLG_LACCA       KDQETVLINVAGTPTFYQNKNAIHA-----
IOLG3_SACEN      S-GQVVPVALKDRPGLYGGNNQ--------
IOLG_ACIC1       S-DTAVAAFPGDVPTLYREP----------
IOLG2_PAEAT      S-DGTTTKVSYS------------------
IOLG_RUBXD       S-GAPQKVETLEPPTLYRRDVEVTG-----
IOLG1_SACEN      D-GTPVEVELADKPALYGT-----------
IOLG2_SACEN      T-GSTAPVEIAPQPALYAPLAA--------
IOLG1_PAEAT      S-GEKVKVQLNTKPDLYK------------
IOLG_ARTS2       N-GEKVAVKLNARPALYS------------
IOLG_RENSM       S-GQRTAVVLAAKPELYR------------
IOLG_CORGL       D-GGVIPVDAAPRPDFYA------------
IOLG_CORGB       D-GGVIPVDAAPRPDFYA------------
IOLG_LEIXX       E-PGPIAFAPAERPAFYA------------
IOLG_MYCGI       T-GLPVDVQLADEVTSPSPQGVRESDGCR-
IOLG2_MYCVP      S-GLPVPVHLAER---PDRSTIRPR-----
IOLG1_MYCVP      S-GQPVAVSMVDRVSIPGA-----------
IOLG_MYCS2       G-GQPVEVKMVERASINGA-----------
IOLG_RHOJR       T-GERVAVDMVDRSSIPGAEPAERPIGPGA
IOLG_KINRD       T-GRRVEVDLGARS----------------
IOLG4_SACEN      S-GARTPVQLVERPGLYA------------
IOLG_STRAW       T-GDRMTVELAPRPDLYGQNPISR------
IOLG_STRCO       T-GVRTPVDMAPRPSLHDRA----------