CLUSTAL format seed alignment for MF_01672

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

IOLE_BACSU       ----MGKNEILWGIAPIGWRNDDMPEIGAGNTLQHLLSDIVVARFQGTEVGGFFP-EPAI
IOLE_BACLD       ----MGKTQILWGIAPIGWRNDDIPEIGAGNTLQHLLSDIVVAGFQGTEVGGFFP-EPAI
IOLE_BACVZ       ----MGKQDILWGIAPIGWRNDDMPEIGAGNTLQHLLSDIVVAGFQGTEVGGFFP-EPSV
IOLE_ALKHC       ----MADQKILWGIAPIGWRNDDIPEIGAGNTLSHLLSDIVVARFQGTEVGGFFP-DAKT
IOLE_BACSK       ----MANRKIRWGIAPIGWRNDDIPEIGAENTLSHLLGDIVVARFEGTEAGGFFP-EPQI
IOLE_LACPL       -MSSKAEKDIKWGIAPIGWRNDDIPSIGKDNNLQQLLSDIVVAGFQGTEVGGFFP-GPEK
IOLE_SALPB       --MYNVKKSIKLGIAPIGWRNDDIPEIGKENTYKQILSDAALTGFSGTEVGGCYPQDPAE
IOLE_SALTY       --MYNVKKSIKLGIAPIGWRNDDIPEIGKENTYKQILSDAALTGFSGTEVGGCYPQDPAE
IOLE_CLOBA       ---MFNSDKVKIGICPIGWTNDDMPDLGKENTFEQAISEMALAGFKGTEIGNKYPKDVKV
IOLE_CLOBB       ---MFNNDKVKIGICPIGWTNDDMPDLGKENTFEQAVSEMALAGFKGTEIGNKYPKDVKV
IOLE_CLOB8       ---MLNTEKVKLGICPIGWTNDDMPDLGKENTFEQAVSEMALAGFKGTEVGNKYPKDVNV
IOLE_CLOP1       ---MFNSN-VKLGIAPIAWTNDDMPDLGKENTFEQCISEMALAGFKGSEVGNKYPRDVKV
IOLE_CLOPE       ---MFNSN-VKLGIAPIAWTNDDMPDLGKENTFEQCISEMALAGFKGSEVGNKYPRDVEV
IOLE_CLOTE       ---MFNKDKVKIGIAPIAWTNDDMPELGAENTFEQCISEMALSGFKGTEVGNKYPRDTKV
IOLE_BACAH       ---MFKENTIKLGIAPIAWTNDDMPELGAENTFEQCISEMALAGFNGSEVGNKYPRNTVV
IOLE1_BACCZ      ---MFKENTVKLGIAPIAWTNDDMPELGAGNTFEQCISEMALAGFNGSEVGNKYPRNTVV
IOLE_BACAN       ---MFKENTIKLGIAPIAWTNDDMPELGAENTFEQCISEMALAGFNGSEVGNKYPRNTVV
IOLE_BACHK       ---MFKENTIKLGIAPIAWTNDDMPELGAENTFEQCISEMALAGFNGSEVGNKYPRNTVV
IOLE2_BACCZ      ---MFKENTIKLGIAPIAWTNDDMPELGAENTFEQCISEMALAGFNGSEVGNKYPRNTVV
IOLE_GEOTN       ---MFKENKVKLGIAPIGWTNDDMPELGGEITFEQCISEMALAGFVGCEVGNKYPRDTKI
IOLE_LACCB       ----MLKVTIELGIAPIGWTNDDMPELGKEVTFEQAIDEMTLAGYKGTEVGNKYPKDPKT
IOLE_HAES1       ----MKAENVKLGIAPIGWTNDDLPEIGKENTFEQCVSEMALAGFTGSEVGSKYPRDIDV
IOLE_HISS2       ----MKAENVKLGIAPIGWTNDDLPEIGKENTFEQCVSEMALAGFTGSEVGSKYPRDIDV
IOLE_SERP5       ----MNKDNVKLAIAPIGWTNDDMPDLGKENTFQQCVSEMALAGFTGSEVGSKYPRDPAV
IOLE_YERE8       ----MNKDRVKLAIAPIGWTNDDMPDLGKENTFQQCISEMALAGFIGSEVGSKYPRDPNV
IOLE_KLEP7       ----MNKDNVKLAIAPIGWTNDDMPELGSENTFQQIVSEMALAGFTGSEVGSKYPRDPAV
IOLE_MYCH2       MNKIWKLKNVKVGVAPILWTNDDMPELGGDISFDRAISEMAQAGYQGTEIGNKFPKDAKI
IOLE_MYCH7       MNKIWKLKNVKVGVAPILWTNDDMPELGGDISFDRAISEMAQAGYQGTEIGNKFPKDAKI
IOLE_MYCHJ       MNKIWKLKNVKVGVAPILWTNDDMPELGGDISFDQAISEMAEAGYQGTEIGNKFPKDEKI
IOLE_GEOKA       --MEKTVNPFRIGIAPISWVNDDIPGLGDHYTQDQVLSEMAELGYVATEMGRLFSQDPPS
                          .  .:.** * ***:* :*   . .: :.: .   : . * *  :.     

IOLE_BACSU       LNKELKLRNLRIAGKWFSSFILRDG-LGEAAKTFTLHCEYLQQVNADVAVVSEQTYSVQS
IOLE_BACLD       LNKELELRNLRIAGKWFSSYIIRDG-IEEAAKEFAAHCQYLKDVHADVAVVSEQTYSVQG
IOLE_BACVZ       LNKELALRNLRIAGKWFSSFIIQDG-IEKMAEQFTEHCDYLQKVGADVAIVSEQTYSVQG
IOLE_ALKHC       LNKELELRNLKIAGQWFSSYLIRDP-FESVSKEFHAHCAYLEEVGASVAVVSEQTYSIQQ
IOLE_BACSK       LNKELQLRNLKVAGKWFSSYIIRDG-IASAAQAFDTHCQFLQAIGAEMAIVSEQTYSIQG
IOLE_LACPL       LNYELKLRNLEIAGQWFSSYIIRDG-IEKASEAFEKHCQYLKAINAPVAVVSEQTYTIQR
IOLE_SALPB       LNKELMLRGLEIPGQWFSSFIIRDG-IASAMNAFEQHCAYLQAIHAYVAVVSEQTYSIQG
IOLE_SALTY       LNKELMLRGLEIPGQWFSSFIIRDG-IASAMNAFEQHCAYLQAIHAYVAVVSEQTYSIQG
IOLE_CLOBA       LKKALEMRNLQIASAWFSSFLTTKP-YEETEKEFIAYRDFLHAMGSKVIVVSEQGHSIQG
IOLE_CLOBB       LKRALEMRNLQIASAWFSSFLTTKP-YEETEKEFIAHRDFLHAMGSKVIVVSEQGHSIQG
IOLE_CLOB8       LKKALDLRNLQIASAWFSSFLTTKP-YEETEKEFIAHRDFLHEMGAKVIVVSEQGHSIQG
IOLE_CLOP1       LKKALELRDMEIASAWFSAFLTTKP-YEETEKAFIEHRDFLNAMGAKVIVVSEQGHSIQG
IOLE_CLOPE       LKKALELRDMEIASAWFSAFLTTKP-YEETEKAFIEHRDFLNAMGAKVIVVSEQGHSIQG
IOLE_CLOTE       LKRALELRDMQIASAWFSAFLTTKP-YEETEKAFIKHRDFLYEMRSKVIVISEQGHSIQG
IOLE_BACAH       LKKSLELRNLEIASAWFSTFLTTKP-LEETVEEFIKHRDFLHDMGAKVIVVSEQGHSIQG
IOLE1_BACCZ      LKKSLALRNLEIASAWFSTFLTTKP-LEETVEEFIKHRDFLHDMGAKVIVVSEQGHSIQG
IOLE_BACAN       LKKSLELRNLEIASAWFSTFLTTKP-IEETVEEFIKHRDFLHGMGAKVIVVSEQGHSIQG
IOLE_BACHK       LKKSLELRNLEIASAWFSTFLTTKP-IEETVEEFIKHRDFLHGMGAKVIVVSEQGHSIQG
IOLE2_BACCZ      LKKSLELRNLEIASAWFSAFLTTKP-LEETVQAFIKHRDFLHDMGAKVIVVSEQGHSIQG
IOLE_GEOTN       LKKALSLRGLSIASAWFSAFLTSKP-FEETAEAFKAHRDFLYEMGAKVIVVSEQGNSIQG
IOLE_LACCB       LKHFLDLRHLKIASAWFSAFLTTKP-YEETEAAFIKHRDFLHAMGAKVIVVAEQGHSVQG
IOLE_HAES1       LKRKLDLRGIQICNAWFSTFFVDGK-KEETIKGFIEHRDFLHAMGAKVIGCSEQSRSIQG
IOLE_HISS2       LKRKLDLRGIQICNAWFSTFFVDGK-KEETIKGFIEHRDFLHAMGAKVIGCSEQSRSIQG
IOLE_SERP5       LKPMLDIRGIQICNAWFSTFFADGL-KEKTIDEFINHMNFLHAMGAKVIGCSEQSKSIQG
IOLE_YERE8       LKPMLELRGMQICNAWFSTFFADGQ-RARTIDEFTNHMNFLHAMGAKVIGCSEQSKSIQG
IOLE_KLEP7       LKPMLDIRGIQICNAWFSTFFANGQ-REKTIDEFVNHMNFLHAMGAKVIGCSEQSGSIQG
IOLE_MYCH2       LLRELKKYNLEIASAWFSGYIISD--FEKNFQDFQKHCLFLKALGAKVVVFSEQTYSIQG
IOLE_MYCH7       LLRELKKYNLEIASAWFSGYIISD--FEKNFQDFQKHCLFLKALGAKVVVFSEQTYSIQG
IOLE_MYCHJ       LLRELKKYNLEIASAWFSGYIISD--FEKNFQDFQKHCLFLKALGAKVVVFSEQTYSIQG
IOLE_GEOKA       LRAKLNQYGIELASKFIGVLFSDRSRLEEELKTFRSWAEYLHDMGCKYAIVCEMGGSMHW
                 *   *    : : . ::.  :            *     :*  : .     .*   ::: 

IOLE_BACSU       LE--KNVFTEKPHFTDDEWERLCEGLNHLGEIAAQHGLKLVYHHHLGTGVQTAEEVDRLM
IOLE_BACLD       LD--KNVFKEKPYFTDEEWQRLFEGLNHLGEIAGRYGLKLVYHHHLGTGVQTEEEVDRLM
IOLE_BACVZ       LD--IDVFKEKPHFSDEEWDTLCQGLNRLGKIAGEYGLDLTFHHHLGTGVQTAEEVDRLM
IOLE_ALKHC       SE--QNIFTEKPMFTDSEWLTLCEGLNELGKIAQQYGLTLVYHHHMGTGVQTLAEVDRLM
IOLE_BACSK       LE--ANIFRDKPTFSKEEWKCLYEGLEELGAIAHSYGLTLAFHPHLGTGVQTKAEVDQLM
IOLE_LACPL       SDT-ANIFKDKPYFTDKEWDEVCKGLNHYGEIAAKYGLKVAYHHHMGTGIQTKEETDRLM
IOLE_SALPB       IID-KCVYTEKPNFSDSEWQLLCEGLNALGKIANAHGLKLAFHHHMGTGVQTLPEVDRLM
IOLE_SALTY       IID-KCVYTEKPNFSDSEWQLLCEGLNALGKIANAHGLKLAFHHHMGTGVQTLPEVDRLM
IOLE_CLOBA       QME-TPIFDGKYHFNEEEWNLLANGLNKLGQLAADKGMKIVYHHHMGTGVQTTEEIDKLM
IOLE_CLOBB       QME-TPIFDGKHHFNEEEWNLLAHGLNKLGQLAADKEMRIVYHHHMGTGVQTTEEIDKLM
IOLE_CLOB8       EMD-TPICEGKYYFNEEEWKLLADGLNKLGRLAEDKGMKIVYHHHMGTGVQTTDEIDKLM
IOLE_CLOP1       QME-TPIFDGKYVLNEEEWKTLAEGLNKLGALAKEKGMKLVYHHHMGTVVQTTEEIDKLM
IOLE_CLOPE       QME-TPIFDGKYVLNEEEWKTLAEGLNKLGALAKEKGMKLVYHHHMGTVVQTTEEIDKLM
IOLE_CLOTE       KME-TPIFEEKPIFTEEEWKDLAKGLNKLGKLAKEKNMKVVYHHHMGTGVQTTEEIDKLM
IOLE_BACAH       LMD-VPLFKNKPVFTEEEWNKLADGLHHLGKLAQEKGLHIVYHHHMGTGVQTTAEIEKLM
IOLE1_BACCZ      LMD-VPLFKNKPVFTEEEWNKLADGLHHLGKLAQEKGLHIVYHHHMGTGVQTTAEIEKLM
IOLE_BACAN       LMD-VPLFKNKPVFTEEEWEKLADGLHHLGKLAQEKGLHIVYHHHMGTGVQTTTEIEKLM
IOLE_BACHK       LMD-VPLFKNKPVFTEEEWEKLADGLHHLGKLAQEKGLHIVYHHHMGTGVQTTTEIEKLM
IOLE2_BACCZ      LMD-VPLFKNKPVFTEEEWEKLADGLHHLGKLAQEKGLHIVYHHHMGTGVQTTAEIEKLM
IOLE_GEOTN       QME-TPLFDKKPVFTEEEWDLLIDGLNRLGDLAAEKGMNIVYHHHMGTGIQTTEEIDRLM
IOLE_LACCB       LLD-KSVFDDKPHFTDDEWERLATGLERLGDRAREVGMQIVYHHHMGTGVQTTAEIDRLM
IOLE_HAES1       QKK-AIFKE-KTIFTEAEWQLLAEGYNELAKLAAEKGMKVCLHHHMGTGIQTPAEIDKYM
IOLE_HISS2       QKK-AIFKE-KTIFTEAEWQLLAEGYNELAKLAAEKGMKVCLHHHMGTGIQTPAEIDKYM
IOLE_SERP5       TTK-GVFEE-KPYFSDEEWQRVADGYNELADIAKGKGMQVCLHHHMGTGIQTTAEIDRYM
IOLE_YERE8       TTK-AIFEE-KPYFTDTEWQRVAEGYNELAKIAATKGMQVCLHHHMGTGIQTTEEIDRYM
IOLE_KLEP7       LDK-PILGDAKPCFSDEEWQRVAEGYNTLGRLAAEKGMQVCLHHHMGTGIQTTAEIDKFM
IOLE_MYCH2       Q-N-KPLFKDKPYFTNQEFENLAQGLNKFGKWSKQHGIELVYHHHMGTGIQSLKETEKIL
IOLE_MYCH7       Q-N-KPLFKDKPYFTNQEFENLAQGLNKFGKWSKQHGIELVYHHHMGTGIQSLKETEKIL
IOLE_MYCHJ       Q-N-KPLFKDKPYFTNQEFENLAQGLNKFGKWSKQHGIELVYHHHMGTGIQSLKETEKIL
IOLE_GEOKA       DPRRAPEEKTIQRLTDSEWESLVDGLHRAAHICQELGMKLVYHFHAGTVVETAEEIDRLM
                              :.. *:  :  * .  .  .    : :  * * ** :::  * :: :

IOLE_BACSU       AGTDPAHVHLLYDTGHAYISDGDY---MGMLEKHIGRIKHVHFKDARLNVMEQCRLEGQS
IOLE_BACLD       AGTDPALVHLLYDTGHAYISDGNY---MNILEKHIDRIRHVHFKDARLKIMEKCKREGNS
IOLE_BACVZ       DGTDPRYVHLLYDTGHAYISDGDY---MTILNKHMDRIRHVHFKDARFDIMERCRQEGKS
IOLE_ALKHC       ENTDPTLVSLLYDTGHIYVSDNDY---MLLLTKHLDRIKHVHFKDVRSDILAKCQEQGQS
IOLE_BACSK       AHTDPSLVSLLYDTGHAYVSDGAF---LPLLDDYMDRIKHVHFKDVRSEVTDACRRDGLS
IOLE_LACPL       ANTDPKLVGLLYDTGHIAVSDGDY---MALLNAHIDRVVHVHFKDVRRSKEEECRAKGLT
IOLE_SALPB       ENTDPQFVHLLFDTGHIYVSDGDV---MPLLSKHFDRIKHVHFKDVRNEKLKACRLAKKS
IOLE_SALTY       ENTDPQFVHLLFDTGHIYVSDGDV---MPLLSKHFDRIKHVHFKDVRNEKLKACRLAKKS
IOLE_CLOBA       SVTDENLVYLLFDTGHLVYSGENP---VEILKKYVHRIKHVHLKDIRPEIVSKVKNEKLS
IOLE_CLOBB       SVTDENLVYLLFDTGHLVYSGENP---VEILKKYVQRIKHVHLKDIRPEIVSKVKNEKLS
IOLE_CLOB8       SMTDESLVYLLFDTGHLVYSGENP---IAILNKYANRIKHVHLKDIRADVLEKVKKEKMS
IOLE_CLOP1       DLTDENLVYLLFDSGHLVYSGEDA---LEVLKKYVNRVKHVHLKDIRKEKVEEVKRDKLS
IOLE_CLOPE       DLTDENLVYLLFDSGHLVYSGEDA---LEVLKKYVNRVKHVHLKDIRKKKVEEVKRDKLS
IOLE_CLOTE       EMTDPTLVYLLYDTGHLVFSGEDP---IVVLRKYINRIKHVHLKDIREDVVKIVKQKKMS
IOLE_BACAH       DITDSALVSLLFDTGHLVFSGEEP---LYILKKYLPRIKHVHLKDIRQEVVDIVKENELS
IOLE1_BACCZ      DMTNPALVSLLFDTGHLVFSGEEP---LYILKKYLPRIKHVHLKDIRQEVVDTVKENELS
IOLE_BACAN       DMTDPALVSLLFDTGHLVFSGEEP---LYILKKYLPRIKHVHLKDIRQEVVDVVKEKELS
IOLE_BACHK       DMTDPALVSLLFDTGHLVFSGEEP---LYILKKYLPRIKHVHLKDIRQEVVDVVKEKELS
IOLE2_BACCZ      DMTDPELVSLLFDTGHLVFSGEEP---LYILKKYLSRIKHVHLKDIRQEVVDAVKESDLS
IOLE_GEOTN       EETDPKKVSLLYDTGHLVFSGEDH---LHVLNKHINRIRHVHLKDVRIEVANKVREEKMS
IOLE_LACCB       TMTDPDKVSLLFDTGHLVLSGEDP---LTIFNRYQDRIKHIHFKDVRQQQADEEHKDHLS
IOLE_HAES1       EITNDD-VYLLFDSGHLYYSEGSQQVMLEVLEKYIHRVVHVHLKDVRDEVVAEVKANDLS
IOLE_HISS2       EITNDD-VYLLFDSGHLYYSEGSQQVMLEVLEKYIHRVVHVHLKDVRDEVVAEVKANDLS
IOLE_SERP5       SMVNDD-VYLLFDTGHAYYSEGSQQAMMAILEKYLPRINHVHLKDVRDEVVAEVKANKLS
IOLE_YERE8       SMVNDD-VYLLFDTGHAYYSEGSQEAMLAILEKYLPRINHVHLKDVRDEVVAEVKAKKLS
IOLE_KLEP7       SLVDER-VFLLFDTGHAWYSEGGEAPMLAILKKYLPRINHVHLKDVRPPVIDQVRRDGLS
IOLE_MYCH2       ELTDPEFVSLIFDTGHFAHAGEDI---VFCLKRLISRIRHIHLKDIRKEKINELKAKNLS
IOLE_MYCH7       ELTDPEFVSLIFDTGHFAHAGEDI---VFCLKRLISRIRHIHLKDIRKEKINELKAKNLS
IOLE_MYCHJ       ELTDPEFVSLIFDTGHFAHAGEDI---VFCLKRLISRIRHIHLKDIRKEKINELKTKNLS
IOLE_GEOKA       ELTDPNLVHLLYDTGHALYGGYDP---VELLHRYADRIQYVHLKDVRHDVLELVRREQLD
                   .:   * *::*:**   .       :  :     *: ::*:** *       :     

IOLE_BACSU       FRQSFLKGMFTVPGDG-CIDFREVYQLLLKHSYSGWIVIEAEQDPDVANPLEYALIARNY
IOLE_BACLD       FQQAFLQGMFTVPGDG-CIDFREVYQTLLKHGYSGWIVVEAEQDPDVANPLEYALIARKY
IOLE_BACVZ       FRQSFLQGIFTVPGDG-CIDFTEVYRTLVRHDYSGWIVIEAEQDPAVANPLEYALIARKY
IOLE_ALKHC       FLQSFLAGMFTVPGDG-CIDFTKVYDVLLTHDYRGWIVVEAEQDPAKAHPLEYALKARQY
IOLE_BACSK       FQQAFLKGMFTVPGDG-CIDFTKVYRRLIRGGYDGWIVVEAEQDPNIAHPLEYALKARRY
IOLE_LACPL       FQGSFLNGMFTVPGDG-DLDFKPVYDKLIANNYKGWIVVEAEQDPSKANPLEMAQIAHRY
IOLE_SALPB       FLNSFLDGVFTVPGDG-NIDFKSVLAYLVGHQYSGWIVVEAEQDPKKYNPLEYAQKGKKH
IOLE_SALTY       FLNSFLDGVFTVPGDG-NIDFKSVLAYLVGHQYSGWIVVEAEQDPKKYNPLEYAQKGKKH
IOLE_CLOBA       FLKGVRAGAFTVPGDG-SIDFEPIFKILAENNYEGWLMIEAEQDPSIANPLEYAIKGRQY
IOLE_CLOBB       FLKGVRAGAFTVPGDG-SIDFEPIFKILAENNYEGWLMIEAEQDPSIANPLEYAIKGRQY
IOLE_CLOB8       FLMGVREGSFTVPGDG-CIDFEPIFKILDENNYEGWILVEAEQDPAIANPFEYAMKARKY
IOLE_CLOP1       FLQGVRKGAFTVPGDG-DIDFEPIFKVLDDNNYEGYLLVEAEQDPAIANPLEYAIKARKY
IOLE_CLOPE       FLQGVRKGAFTVPGDG-DIDFEPIFKVLDDNNYEGYLLVEAEQDPAIANPLEYAIKARKY
IOLE_CLOTE       FLQAVKLGAFTVPGDG-DIDFKPVFNILAENNYEGWLLVEAEQDPARANPLEYAIKARKY
IOLE_BACAH       FLQAVKNGAFTVPGDG-VIEFDEVFTILANSDYQGWFVVEAEQDPALANPFEYALKAREF
IOLE1_BACCZ      FLQAVKNGAFTVPGDG-VIGFDEVFTILANSDYQGWFVVEAEQDPALANPFEYALKARKF
IOLE_BACAN       FLQAVKNGAFTVPGDG-VIVFDEVFTILANSNYQGWFVVEAEQDPALANPFEYALKARKF
IOLE_BACHK       FLQAVKNGAFTVPGDG-VIVFDEVFTILANSNYQGWFVVEAEQDPALANPFEYALKARKF
IOLE2_BACCZ      FLQAVKNGAFTVPGDG-VIVFDEVFTILANSDYKGWFVVEAEQDPALANPFEYALKARKF
IOLE_GEOTN       FLQAVKAGVFTVPGDG-VIDFKPVFEALDAAGYEGWFVVEAEQDPAIANPFEYALKARQY
IOLE_LACCB       FLAGVKNGMFTVPGDG-MIDFKPIWEAIQESGYDGWIIVEAEQDPAKANPFEYALKAKKY
IOLE_HAES1       FLEGVVKGTFTVPGDG-VIDFKPIFDILEKYDYKGWMVVEAEQDPAIANPLEYAIKGRQY
IOLE_HISS2       FLEGVVKGTFTVPGDG-VIDFKPIFDILEKYDYKGWMVVEAEQDPAIANPLEYAIKGRQY
IOLE_SERP5       FLDGVKKGTFTVPGDG-VIDFRPVFKLLDERGYKGWMVVEAEQDPALANPFEYAVKARRY
IOLE_YERE8       FLDGVKKGTFTVPGDG-VIDFRPVFKLLDEKGYQGWMVVEAEQDPAIANPFEYAVKARRY
IOLE_KLEP7       FLDGVKKGTFTVPGDG-VIDFRPVFKLLDDFGYKGWMVVEAEQDPALANPFEYAVKARKY
IOLE_MYCH2       FLEGVKQGIFTVPGDGDIQNYPLFFELLAKNNYQGWLIVEAEQDPRKANPLEYAKKAMDY
IOLE_MYCH7       FLEGVKQGIFTVPGDGDIQNYPLFFELLAKNNYQGWLIVEAEQDPRKANPLEYAKKAMDY
IOLE_MYCHJ       FLEGVKQGIFTVPGDGDIKNYPLFFELLAKNNYQGWLIVEAEQDPRKANPLEYAKKAMDY
IOLE_GEOKA       FRTAVLRGMFTVPGDG-CIDFVPIFAKLIEMDYNGWIIVEAEQDPAVAHPYTYAKMAKEY
                 *  ..  * *******    :  .   :    * *::::******   :*   *  .  .

IOLE_BACSU       IDQQLLDLA------
IOLE_BACLD       IDRHLLNVPATN---
IOLE_BACVZ       IDSELLDPAN-----
IOLE_ALKHC       IDEKLLTTDEMKERI
IOLE_BACSK       IDSYLLAGGEKQATI
IOLE_LACPL       IKQHLIEN-------
IOLE_SALPB       IDELLKNYL------
IOLE_SALTY       IDELLKNYL------
IOLE_CLOBA       IKEKASI--------
IOLE_CLOBB       IKEKASI--------
IOLE_CLOB8       IKEKTGF--------
IOLE_CLOP1       IKEKTNL--------
IOLE_CLOPE       IKEKTNL--------
IOLE_CLOTE       IQEKAAI--------
IOLE_BACAH       IREKAGL--------
IOLE1_BACCZ      IQEKAGL--------
IOLE_BACAN       IQEKAGL--------
IOLE_BACHK       IQEKAGL--------
IOLE2_BACCZ      IQEKAGL--------
IOLE_GEOTN       IRETCGL--------
IOLE_LACCB       LDATMNIPQSA----
IOLE_HAES1       IREVAGV--------
IOLE_HISS2       IREVAGV--------
IOLE_SERP5       IKETAGI--------
IOLE_YERE8       IKETAGI--------
IOLE_KLEP7       IRETAGI--------
IOLE_MYCH2       LRSLISW--------
IOLE_MYCH7       LRSLISW--------
IOLE_MYCHJ       LRSLISW--------
IOLE_GEOKA       IDRLVHHLLAAQKR-
                 :