CLUSTAL format seed alignment for MF_01676

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

AHPD_MYCBP      -MSIEKLKAALPEYAKDIKLNLSSITRSS---VLDQEQLWGTLLASAAATRNPQVLADIG
AHPD_MYCTA      -MSIEKLKAALPEYAKDIKLNLSSITRSS---VLDQEQLWGTLLASAAATRNPQVLADIG
AHPD_MYCTU      -MSIEKLKAALPEYAKDIKLNLSSITRSS---VLDQEQLWGTLLASAAATRNPQVLADIG
AHPD_MYCBO      -MSIEKLKAALPEYAKDIKLNLSSITRSS---VLDQEQLWGTLLASAAATRNPQVLADIG
AHPD_MYCMM      -MSIENLKAALPEYAKDLKLNLGSISRTT---VLDEEQLWGTLLASAAATRNAQVLAEIG
AHPD_MYCUA      -MSIENLKAALPEYAKDLKLNLGSISRTT---VLDEEQLWGTLLASAAATRNAQVLAEIG
AHPD_MYCA1      -MSVENLKEALPEYAKDLKLNLGSITRTT---ELNEEQLWGTLLASAAATRNTQVLTEIG
AHPD_MYCPA      -MSVENLKEALPEYAKDLKLNLGSITRTT---ELNEEQLWGTLLASAAATRNTQVLTEIG
AHPD_NOCFA      -MSIENLKNSLPEYAKDLKLNLSSIARST---VLNEQQLWGTLLASAAATRSATTLREIA
AHPD_MYCA9      -MSIENLKEALPEYAKDLKLNLGTVARGT---VLSQSQLWGTLVATAAATRNEQVFKEIR
AHPD_MYCS2      -MSIDNIKSALPEYAKDLKLNLGSIANTT---ELTEQQLWGALVATAAATKNARLLREIS
AHPD_CORDI      -MSLDNLKSGLPEYAKDLKLNLGSLARST---ELTEQQLWGTFLAVAAATRNEAVFSEIS
AHPD_GLUDA      -MSIETLKERLPDYAKDLKLNLSSLANDI---TLSPQQLAGTFVASAIASRNADVTRAIV
AHPD_GRABC      -MSIENLKNALPEYAKDLKLNLGSLANED---VLNQQQKAGTFIASALASRSNLVTSAIL
AHPD_FRAAA      -MTVARLRELLPDYARDLRLNLGSVTSQS---NLSAQQLWGTVLAAAIASRGRTVLVELE
AHPD_FRASN      -MGVARLRELLPDYAKDLRLNLGSVTSQS---QLNNQQLWGTVLTSAIASRGATTLTELE
AHPD_STRAW      -MALDELKAAVPDYAKDLRLNLGSVIGNS---DLPQQQLWGTVLACAIASRSPRVLRELE
AHPD_STRGG      -MALDELKSAIPDFAKDLKLNLGSVIGNS---DLPQQQLWGTVLACAIASRSPKVLRELE
AHPD_STRCO      -MSLDSLKSAVPDYAKDLKLNLGSVIGNS---DLPAQQLWGTVLATAIASRSPIVLRELE
AHPD_STRVD      -MSLDSLKSRIPDYAKDLKLNLGSVIGNS---GLPAQQLWGTVLSTAIASRSAIVLRELE
AHPD_AZOC5      -MSIEALKTQLPAFAKDVKLNLSALPRED---SLTEQQLYGLLVACGYTTRNGTVAQALE
AHPD_METS4      -MTLDALLQSLPPYAKDVRLNFSSLGREE---TLTAQQRDGLLVACGLASRNPDLARALE
AHPD_BRASB      -MSIEQLKEQIPDFAKDVRLNLSSMASDE---SLSPQAKYGLFVACAIATRNPTVTAALE
AHPD_BRASO      -MSIEQLKDQIPDFAKDVRLNLSSMASDE---TLSPQAKYGLFVACAIATRNPMVMAAFE
AHPD_RHOP5      -MTIEVLKERIPDFAKDVRLNLSSMASDE---TLGEQTKYGLLVATAIATRNVEVIAAIE
AHPD_RHOPB      -MSIDALKERIPDFAKDVRLNLSSMASDE---TLAPQTKYGLFVAAAVATRNPDVIAAMQ
AHPD_BRUA1      -MSIDDLKSKIPDFAKDVRLNLSSMASDE---TLTPQQKYGLFVACGIASRNADVRKALV
AHPD_BRUA2      -MSIDDLKSKIPDFAKDVRLNLSSMASDE---TLTPQQKYGLFVACGIASRNADVRKALV
AHPD_BRUAB      -MSIDDLKSKIPDFAKDVRLNLSSMASDE---TLTPQQKYGLFVACGIASRNADVRKALV
AHPD_BRUC2      -MSIDDLKSKIPDFAKDVRLNLSSMASNE---TLTPQQKYGLFVACGIASRNADVRKALV
AHPD_BRUSU      -MSIDDLKSKIPDFAKDVRLNLSSMASNE---TLTPQQKYGLFVACGIASRNADVRKALV
AHPD_BRUME      -MSIDDLKSKIPDFAKDVRLNLSSMASDE---TLTPQQKYGLFVACGIASRNADVRKALV
AHPD_BRUSI      -MSIDDLKSKIPDFAKDVRLNLSSMASDE---TLTPQQKYGLFVACGIASRNADVRKALV
AHPD_OCHA4      -MSIDDLKSKIPDFAKDVRLNLSSMASDE---TLTPQQKYGLFVACGIASRNADVRKALV
AHPD_BRADU      MSPIEQIYDKIPDFAKDVRINLTSLMADE---TLSPRRKYGVLVASAVATRNSALIAAVE
AHPD_BEII9      -MSIDSLKDKLPDFAKDVRLNLSNIANDD---TLGEQTKYGLMLACAVATRNAEVLKAFD
AHPD_SPHWW      -MSLKEFADALPDYAKDIRLNVGSLLGDQ---TLTEQRKYGLLLACAHGSGYKPIVEATE
AHPD_KORVE      -MNLEALLDTVPAYARDLKLNFSAVVRQN--TELTEQQLWGTVVACAAASRNRTLLDAIV
AHPD_SOLUE      -MELEQLLNSVPEYAKDLKLNMGGVLRQ---TELTEQQAWGTAVACAIAARNPQLRESVL
AHPD_COXBN      --MLQTYKDQLPDYAKDLKLNLTQVLSESPSSELSNQQITGVALAVAYATRNRQLIELIF
AHPD_COXBR      --MLQTYKDQLPDYAKDLKLNLTQVLSESPSSELSNQQITGVALAVAYATRNRQLIELIF
AHPD_COXBU      --MLQTYKDQLPDYAKDLKLNLTQVLSESPSSELSNQQITGVALAVAYATRNRQLIELIF
AHPD_ANADE      MAALDAIREALPEPARDIKLNLQAVLQPG---PLTPAQRWGVAVATAAAARNERLLAAIL
AHPD_ANASK      MATLDAIREALPEPARDIKLNLQAVLQPG---TLTPAQRWGVAVATAAAARNERLLAAVL
AHPD_ANADF      MSPVDRLREALPDAARDVRLNLQAVLQGG---ALTEGQRWGVAVASAAAARQPALLSAVL
AHPD_HYPNA      -MSLETLKTLIPDYAKDIRLNIGSLANET---ILSEQQKYGCYLASAHAVGEAQTLRAIE
AHPD_MARMM      -MSIDALKNELPEYAKDLKLNLSSLGRET---ELDDQKKWGTFLASAHAVGEPKTLAAIK
AHPD_CAUVC      -MSIEALRARLPDYAHDLGTNLALLVDDP---ALDPEARWGCFVASACAVGEPQTLRAID
                   :      :*  *:*:  *.  :        *      *  :: .             

AHPD_MYCBP      AEATDH-LSAAARHAALGAAAIMGMNNVFYRGRGFLEG-RYDDLRPGLRMNIIANPGIPK
AHPD_MYCTA      AEATDH-LSAAARHAALGAAAIMGMNNVFYRGRGFLEG-RYDDLRPGLRMNIIANPGIPK
AHPD_MYCTU      AEATDH-LSAAARHAALGAAAIMGMNNVFYRGRGFLEG-RYDDLRPGLRMNIIANPGIPK
AHPD_MYCBO      AEATDH-LSAAARHAALGAAAIMGMNNVFYRGRGFLEG-RYDDLRPGLRMNIIANPGIPK
AHPD_MYCMM      AEAADN-LSAQAYQAALGAVSIMGMNNVFYRGRGFLEG-QYDDLRAGLRMNIIANPGVDK
AHPD_MYCUA      AEAADN-LSAQAYQAALGAVSIMGMNNVFYRGRGFLEG-QYDDLRAGLRMNIIANPGVDK
AHPD_MYCA1      AEAADT-LSAEAYHAALGAASVMAMNNVFYRGRGFLDG-KYDDLRAGLRMNIIGNPGVEK
AHPD_MYCPA      AEAADT-LSAEAYHAALGAASVMAMNNVFYRGRGFLDG-KYDDLRAGLRMNIIGNPGVEK
AHPD_NOCFA      EEAADV-LSAEAYNAALGAASIMGMNNVFYRGKAFLGG-RYDDLRAGLRMQIIGNPGVDK
AHPD_MYCA9      EEAAGI-LTPEALDAALGAASIMAMTNVFYRGRGFLDG-AYDDLRPGLRMNIIGNPGVDK
AHPD_MYCS2      EDALDI-LSEEAYNAALGAAAIMGMNNVFYRTKGQLDG-KYDDLRAGLRMNIIGNPGVAK
AHPD_CORDI      EEASEH-LSEEAINAALGAASIMAMNNVAYRAKGWLGD-DYAQVKMGLRMNIIAKPGVDK
AHPD_GLUDA      AEYESV-LSPQALTAAKAAAAIMGLNNIYYRFVHMVEG-DYAHMPARLRMNVIGRPGVEK
AHPD_GRABC      AEFGPQ-LSAEALAAAKAAAAIMGMNNVYYRFVHLVGG-DYANLPARLRMNVMAKPGVDK
AHPD_FRAAA      PEALDH-LSAEAATAARTAAALMAMNNVYYRSLHLLEDEEYSRLRAGLRMNALANPGVDK
AHPD_FRASN      AEALEH-LSPEAAKAARTAAALMAMNNVYYRTLHLLEDKEYSRMRAGLRMNAIANPGVDK
AHPD_STRAW      PQAKAN-LSPEAYTAAKSAAAIMAMNNVFYRTRHLLSDPEYGTLRAGLRMNVIGNPGVEK
AHPD_STRGG      PEAKAN-LSAEAYTAAKSAAAIMAMNNVFYRTRHLLSDPEYGTLRAGLRMNVIGNPGVEK
AHPD_STRCO      PEAKAN-LSPEAYSAAKSAAAVMAMNNVFYRTRHLLSDHEYGTLRAGLRMNVIGNPGVDK
AHPD_STRVD      PEAKAN-LSPEAYTAAKAAAAVMAMNNVFYRTRHLLSDHEYGNLRAGLRMNVIGNPGVDK
AHPD_AZOC5      AEAAPH-LSPAALDAAKAAASIMAMNNVYYRFTHLASNKAYETLPAKLRMSVIGNPGVDK
AHPD_METS4      AEAAPR-LSPAALAAAKAAATVMAMNNVYYRFTHLASNPAYATRPAKLRMSSIGNPGVAR
AHPD_BRASB      AVAAAH-LSAAALTAAKTAAALMAMNNVYYRFVHLATNKEYATMPARLRMNAIANPGVDK
AHPD_BRASO      AVAAAQ-LSATALAAAKSAAAIMAMNNVYYRFVHLASNKEYATMPARLRMNVIANPGVDK
AHPD_RHOP5      AEAAGK-LSPAALGAAKSAAAIMAMNNVYYRFVHLASNKDYATMPARLRMNVIANPGVDK
AHPD_RHOPB      AVARDN-VAPAVIAAAKSAAAIMAMNNVYYRFVHLASNKDYATMPARLRMNVIANPGVDK
AHPD_BRUA1      AEAAGK-VDASVIQAAKAAASIMGMNNVYYRFVHLASNKDYRTMPARLRMNVISNPGVDK
AHPD_BRUA2      AEAAGK-VDASVIQAAKAAASIMGMNNVYYRFVHLASNKDYRTMPARLRMNVISNPGVDK
AHPD_BRUAB      AEAAGK-VDASVIQAAKAAASIMGMNNVYYRFVHLASNKDYRTMPARLRMNVISNPGVDK
AHPD_BRUC2      AEAAGK-VDASVIQAAKAAASIMGMNNVYYRFVHLASNKDYRTMPARLRMNVISNPGVDK
AHPD_BRUSU      AEAAGK-VDASVIQAAKAAASIMGMNNVYYRFVHLASNKDYRTMPARLRMNVISNPGVDK
AHPD_BRUME      AEAAGK-VDASVIQAAKAAASIMGMNNVYYRFVHLASNKDYRTMPARLRMNVISNPGVDK
AHPD_BRUSI      AEAAGK-VDASVIQAAKAAASIMGMNNVYYRFVHLASNKDYRTMPARLRMNVISNPGVDK
AHPD_OCHA4      AEAAAK-VDASVIQAAKSAASIMGMNNVYYRFVHLATNKDYRTMPAKLRMNVIGNPGVDK
AHPD_BRADU      SAASGV-MTSVAIAAAKAAASVVVMNNVYYRFVHLASNPEYKTMPPRLRMDVIGNPGVDK
AHPD_BEII9      QECTPH-LAPAARDAALAAATIMAMNNVYYRFVHLASNKAYGTLPAKLRMNIIGNPGVPK
AHPD_SPHWW      AEVAGK-LSPEAANAARAAAAVMAMNNVYYRFVHLASNKEYGQMPAKLRMNVIGSPGIEK
AHPD_KORVE      EEAKGK-LSAQAVEAAKGAAAILSMNNIFYRFQHLAVNKKYETMRAGLRMNFLRQHGVDP
AHPD_SOLUE      GEAAKH-LNEQALFAAKAAASVMGMNNIFYRFRHLSTNPKYGAMPARLRMQVIAKHGSDP
AHPD_COXBN      QKAEAE-LDESTLQAIKAAASIMAMNNIYYRFVHLVKDSEYQRLPANLRMNIIANPGIDK
AHPD_COXBR      QKAEAE-LDESTLQAIKAAASIMAMNNIYYRFVHLVKDSEYQRLPANLRMNIIANPGIDK
AHPD_COXBU      QKAEAE-LDESTLQAIKAAASIMAMNNIYYRFVHLVKDSEYQRLPANLRMNIIANPGIDK
AHPD_ANADE      ADARAE-VEPAVVEDALAAAAVMAMNNVYYRFRHMVGKPSYSEKPARLRMNRLVKPAASK
AHPD_ANASK      ADARAE-VEPAVVEDALAAAAVMAMNNVYYRFRHMVGKASYAEKPARLRMNRLVKPAASK
AHPD_ANADF      AEARSR-GLDSAAEDGLAAAALMAMNNVYYRFRHMVGKPGYTEMPARLRMGRLAQPATSR
AHPD_HYPNA      AEARGK-LSVEALNAAKAASAIMGMNNVYYRATHLVSNTTYTTMPARLRMNVIGNPGVEK
AHPD_MARMM      AEAETR-LSDEALTAAKAASAIMGMNNVYYRFVHLSKNKEYATLPAKLRMNILANPGVDK
AHPD_CAUVC      AAATAAGLTAEANRAARKAAAMMAMTNVYFRAVHLMEGAAYQALPCRLRLNRLAHAGARG
                           .      * ::: :.*: :*         *      **:  :   .   

AHPD_MYCBP      ANFELWSFAVSAINGCSHCLVAHEHTLRTVGVDREAIFEALKAAAIVSGVAQALATIEAL
AHPD_MYCTA      ANFELWSFAVSAINGCSHCLVAHEHTLRTVGVDREAIFEALKAAAIVSGVAQALATIEAL
AHPD_MYCTU      ANFELWSFAVSAINGCSHCLVAHEHTLRTVGVDREAIFEALKAAAIVSGVAQALATIEAL
AHPD_MYCBO      ANFELWSFAVSAINGCSHCLVAHEHTLRTVGVDREAIFEALKAAAIVSGVAQALATIEAL
AHPD_MYCMM      ANFELWSFAVSSVNGCSHCVVAHEHTLREAGVGREAVLEALKAAAIVCGVAQALTAAQTL
AHPD_MYCUA      ANFELWSFAVSSVNGCSHCVVAHEHTLREAGVGREAVFEALKAAAIVCGVAQALTAAQTL
AHPD_MYCA1      ANFELWCFAVSAINGCPDCVASHEHTLREAGVSRETIQEALKAAAIISGVAQAIVTSQTL
AHPD_MYCPA      ANFELWCFAVSAINGCPDCVASHEHTLREAGVSRETIQEALKAAAIISGVAQAIVASQTL
AHPD_NOCFA      ADFELWSFAVSSINGCAHCLEAHEHTLREAGVSREVIFESLRVAAIVAGVGQAVQSTEAL
AHPD_MYCA9      SEFELWSFAVSTINGCHYCVGSHEKVLREAGLTREQVLEALKIAAIVAGVAQALATVPAL
AHPD_MYCS2      EDFELWSLAVSAINGCGHCLAAHEKTLRDADVARTTIFEAIRLASIVSGVAQALLTADTL
AHPD_CORDI      VDFELWSLAVSTVNGCEHCTIAHEKTVRSEGLTKEQIFEAVKIAATLQGVAQAIEIEASR
AHPD_GLUDA      LDFELWSLAVSAINGCGMCVESHEKVVREGGLSAEQVQTAVRVAATVHAVAATLDGAAAL
AHPD_GRABC      VDFELWSLAVSAINGCGMCMESHEKIVRQNGLTQEQVQAAIRIAATVHAVAATLDGEAAL
AHPD_FRAAA      VDVELWSLAVSAVNGCGRCLTAHEHELRGRGVAREVIQDAIRVASVVHAVAVTVEALETS
AHPD_FRASN      VDFELWSLAASAVNGCGMCLTAHEHELRGRGVSREVIQDAIRVASVVHAVAVTIESHEQV
AHPD_STRAW      VDFELWSLAVSAVNGCGQCLDSHEQVLRKAGVDRDTIQEAFKIAAVIQAVGTTLDAEAVL
AHPD_STRGG      VDFELWSLAVSAINGCGQCLDSHEQVLRKAGVDRETIQEAVKVASVIQAVGVTLDAEAVL
AHPD_STRCO      VDFELWSFAVSAINGCGMCLDSHEQVLRKAGVDRETIQEAFKIAAVVEAVGVTLDAEAVL
AHPD_STRVD      VDFEFWSFAVSAINGCGMCLDSTKQVLRKAGVERRSSRRRSD-CRGTQAVAATLDAEAFS
AHPD_AZOC5      VDFELWSLAVSAMNGCGRCIDAHEAVLREAGLSEAQIQTAVRVGAIIASAAVALEAAGAG
AHPD_METS4      ADFELWSLAVSAINGCGRCIDAHEQVLREAGVGEEAIQAAVRVAAVVASLAVALESVRAA
AHPD_BRASB      ADFELWSLAVSAINGCGTCIDAHERVLKEAGVSAASIQTAVRFAAIIQSVAVAIEAAAVT
AHPD_BRASO      ADFELWSLAVSAINGCGTCIDAHEKVLQEAAVPAASIQTAVRFAAIIQSVAVAIEAAGVT
AHPD_RHOP5      ADFELWSLAVSAINGCGMCIDSHEKVLLQAGVSTAAIQTAVRFAAIMQSVAVSIEAGAAS
AHPD_RHOPB      ADFELWSLAVSAINGCGMCIDSHEKVLLAAGVSTAAIQTAVRFAAIIQSVAVSIEAGAAD
AHPD_BRUA1      IDFELWSLAVSAINGCGMCIDAHEDVLRKANVTAEAIQAAVRFASIIQSAAIALEAADTE
AHPD_BRUA2      IDFELWSLAVSAINGCGMCIDAHEDVLRKANVTAEAIQAAVRFASIIQSAAIALEAADTE
AHPD_BRUAB      IDFELWSLAVSAINGCGMCIDAHEDVLRKANVTAEAIQAAVRFASIIQSAAIALEAADTE
AHPD_BRUC2      VDFELWSLAVSAINGCGMCIDAHEDVLRKANVTAEAIQAAVRFASIIQSAAIALEAADTE
AHPD_BRUSU      VDFELWSLAVSAINGCGMCIDAHEDVLRKANVTAEAIQAAVRFASIIQSAAIALEAADTE
AHPD_BRUME      VDFELWSLAVSAINGCGMCIDAHEDVLRKANVTAEAIQAAVRFASIIQSAAIALEAADTE
AHPD_BRUSI      VDFELWSLAVSAINGCGMCIDAHEDVLRKANVTAEAIQAAVRFASIIQSAAIALEAADTE
AHPD_OCHA4      IDFELWSLAVSAINGCGMCIDAHEDVLRKANVTSETIQTAVRFASIIQSVAIALEAADTE
AHPD_BRADU      SDFELWSLAVSSINGCGICIDAHERTLRAAGVNSETIQTAVRFAAITQSVAIALEAAGPA
AHPD_BEII9      TDFELWSLAVSAINGCGMCIDSHEKVLLNADTTQDTIQTAVRFAAIIQSTAVALEAASLP
AHPD_SPHWW      DDFELFSLAVSAMNGCGLCIDSHEKVLRQHGVAADVIQTAARVGAVIKAAATVHATAV--
AHPD_KORVE      LDFELWALAVSAVNGCGKCIDAHERVLLQKEFSEEKILAAIRVASTIYGLAVVFDAEEPK
AHPD_SOLUE      IDFELWCLAVSAMNGCGVCVDSHENVLREKGVSEEAVLAAIRIASTIHGLAAILDVE---
AHPD_COXBN      KDFELYSLAVSAINGCGLCIDAHANTLIKAGFSKHSIQHVIRIAAVLNGLAQVSIIENKT
AHPD_COXBR      KDFELYSLAVSAINGCGLCIDAHANTLIKAGFSKHSIQHVIRIAAVLNGLAQVSIIENKT
AHPD_COXBU      KDFELYSLAVSAINGCGLCIDAHANTLIKAGFSKHSIQHVIRIAAVLNGLAQVSIIENKT
AHPD_ANADE      LDFELFALAVSAVNGCETCVRSHEQVVVGGGVSEDQVHDAVRIAAVVHAAAVALELAGHA
AHPD_ANASK      VDFELFALAVSAVNGCETCVRSHEQVVVAGGLSEDQVHEAVRIAAVLHAAAVSLELAGYA
AHPD_ANADF      ADLELFSLAASAINGCEACVRTHEDVVVKGGIGEEAVHDAVRIAAVIHAAAVALEAGEVA
AHPD_HYPNA      VDFELWSLAVSAINGCGMCLDAHEAELRKHGVTSEQIQAAIRIGAVVNAAARVLAAEAAL
AHPD_MARMM      ADFELWSLAVSAINGCGLCIDSHEAELRKHGLTTTQVQAAVRIAATVNAIAAVLAAES--
AHPD_CAUVC      VTYDLSCVAVSAINGCGACLDSHEADLRGRGVEPTQIQAALRIAAVVSAVARTLAAEAAL
                   :: ..*.*::***  *  :    :                     . .         

AHPD_MYCBP      SPS---------------
AHPD_MYCTA      SPS---------------
AHPD_MYCTU      SPS---------------
AHPD_MYCBO      SPS---------------
AHPD_MYCMM      AAVG--------------
AHPD_MYCUA      AAVG--------------
AHPD_MYCA1      ATAG--------------
AHPD_MYCPA      ATAG--------------
AHPD_NOCFA      AAAAV-------------
AHPD_MYCA9      V-----------------
AHPD_MYCS2      AAV---------------
AHPD_CORDI      ------------------
AHPD_GLUDA      GDHPAAG-----------
AHPD_GRABC      S-----------------
AHPD_FRAAA      SGTNRVAAAD--------
AHPD_FRASN      PATA--------------
AHPD_STRAW      AE----------------
AHPD_STRGG      AE----------------
AHPD_STRCO      AAE---------------
AHPD_STRVD      ------------------
AHPD_AZOC5      FPEAAE------------
AHPD_METS4      A-----------------
AHPD_BRASB      VPLAAE------------
AHPD_BRASO      VALAAE------------
AHPD_RHOP5      LAVAAE------------
AHPD_RHOPB      LAMAAE------------
AHPD_BRUA1      ------------------
AHPD_BRUA2      ------------------
AHPD_BRUAB      ------------------
AHPD_BRUC2      ------------------
AHPD_BRUSU      ------------------
AHPD_BRUME      ------------------
AHPD_BRUSI      ------------------
AHPD_OCHA4      ------------------
AHPD_BRADU      SPQAGD------------
AHPD_BEII9      VSAAS-------------
AHPD_SPHWW      ------------------
AHPD_KORVE      GDLVGAPVNTDAYSTTTI
AHPD_SOLUE      ----ADPIA---------
AHPD_COXBN      ------------------
AHPD_COXBR      ------------------
AHPD_COXBU      ------------------
AHPD_ANADE      AAPSAAAAAG--------
AHPD_ANASK      AVPSAAAAAG--------
AHPD_ANADF      GGHEAVSAA---------
AHPD_HYPNA      AAEPA-------------
AHPD_MARMM      ------------------
AHPD_CAUVC      HPQNLEI-----------