CLUSTAL format seed alignment for MF_01677

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

MTNB_BACSU      -----------MA-AKQERWRELAEVKRELAERDWFPATSGNLSIKVTDEPLTFLVTASG
MTNB_BACVZ      -----------MA-AKEERWRELAEVKRELAERDWFPATSGNLSIKVSDGPLTFLVTASG
MTNB_BACP2      -----------MADEKNKRWQELADVKRELAQRDWFYGTSGNLSIKVSDDPITFLVTASG
MTNB_GEOKA      -----------MS-IVVKKWKELAEVKAELAARDWFFATSGNLSIKVTDDPLTFLVTASG
MTNB_GEOTN      -----------MS-IMLKKWNELAEVKAELAARDWFFATSGNLSLKVTDAPLTFLVTASG
MTNB_EXIS2      -----------MT--FLTRYEELRAIKQEFAARDWFPGTSGNLAIRTNSSPTEFLVTASG
MTNB_BACAH      -----------MK-QLFRQWYDLSEIKKELTTRNWFPATSGNISIKVSHEPLTFLITASG
MTNB_BACAN      -----------MK-QLFRQWYDLSEIKKELTTRNWFPATSGNISIKVSHEPLTFLITASG
MTNB_BACCZ      -----------MK-QLFRQWYDLSEIKKELTTRNWFPATSGNISIKVSHEPLTFLITASG
MTNB_BACHK      -----------MK-QLFRQWYDLSEIKKELTTRNWFPATSGNISIKVSHEPLTFLITASG
MTNB_BACC1      -----------MK-QLFRQWYDLSEIKKELTTRNWFPATSGNISIKVSHEPLTFLITASG
MTNB_BACCR      -----------MK-QLFRQWYDLSEIKKELTTRNWFPATSGNISIKVSHEPLTFLITASG
MTNB_BACMK      -----------MK-QLFRQWYDLSEIKKELTTRNWFPATSGNISIKVSHDPLTFLITASG
MTNB_BACCN      -----------MK-QLFRKWHTLSELKKELTNRNWFPATSGNISIKVSHEPLTFLISASG
MTNB_SULSY      ------MPERLYQEEKQKAVNVLNDLKIKLYNKGFFPATSGNLSYKLHDDPLIFAVTTSG
MTNB_GLUDA      ---------MISTDPWAGAVQDIIAAGRRMDRFGWVPATAGNISRRLPD--GRIAITRSG
MTNB_GLUOX      ------MQNLKVDESWGNACRQIVQAGQRMDQRGWVPATAGNLSCRLPD--GRIAITRSG
MTNB_GRABC      ----MTGTVTSVRQPPEWAAVTIVAAGQRMDARGWVPATAGNISVRLPD--DTIAITSSG
MTNB_ACICJ      --MTLAAGPAEAGDVLASRARELVAIGARMDARGWVPASAGNLSARCTA--DSIAITRSG
MTNB_ALCBS      -----MPERPYSTTVFRDAARALAATGQRIYANGWSPATSSNYSQRLNT--DFAAVTQSG
MTNB_AQUAE      -------MNVELFKKFSEKVEEIIEAGRILHSRGWVPATSGNISAKVSE--EYIAITASG
MTNB_METCA      ----------MHDTEFETRAAELIEAGRFIDGRGWVPATSGNFSARLGD--GRIAITVSG
MTNB_HAHCH      ---------MFDLHKFSLRAQEIIEAGGFLYGAGWSPATSSNYSARIDD--ANIAITVSG
MTNB_MARHV      ---------MFDVTRYATAAQSIVEAGRFLYERGWSPATSSNYSARIDG--DHVAITVSG
MTNB_PSE14      ------------MSR-EQLSVEIIEAGRFLYGRGWSPATSSNYSARLSA--TEALLTVSG
MTNB_PSEU2      ------------MSR-EQLSLEIIEAGRFLYGRGWSPATSSNYSARLSA--SEALLTVSG
MTNB_PSESM      ------------MSR-EQLSQEIIEAGRFLYGRGWSPATSSNYSVRLSA--SEALLTVSG
MTNB_PSEPF      ----------MSLTR-EQLAQQIVDAGRFLYGRGWSPATSSNYSTRLSP--SEALLTVSG
MTNB_PSEAB      ----------MNDNR-EQLTQQIIDAGRFLYGRGWSPATSSNYSARLDE--QRALLTVSG
MTNB_PSEAE      ----------MNDNR-EQLTQQIIDAGRFLYGRGWSPATSSNYSARLDE--QRALLTVSG
MTNB_PSEA7      ----------MNDNR-EQLTQQIIDAGRFLYGRGWSPATSSNYSARLDE--GRALLTVSG
MTNB_BRASB      ---MSARQPAIADTALVTAIDAVIEAGRRSAERGWVPATSGNFSVRVDA--ERIAVTRSG
MTNB_PARL1      ---------MVPRLDFAEAAKGVIAMARFAGARGWVPATSGNFSVRMNE--LSAALTATG
MTNB_SORC5      -----MSVRGTSFASFSSVAAELIELSRFCHERGWTPATSGNFSARLGD--GSLAITASG
MTNB_XANAC      MNATTAP-LPYSAARLHELAHLLIANIRELAHAGWTPATSSNFSHRLDE--QHAAITVSG
MTNB_XANC5      MNATTAP-LPYSTTRLHELAHLLIANIRELAHAGWTPATSSNFSHRLDE--QHAAITVSG
MTNB_XANOP      MNATTAP-LPYSAARLHELAHVLIANIRELAHAGWTPATSSNFSHRLDE--QHAAITVSG
MTNB_XANOR      MNATTAP-LPYSAARLHELAHVLIANIRELAHAGWTPATSSNFSHRLDE--QHAAITVSG
MTNB_XANOM      MNATTAP-LPYSAARLHELAHVLIANIRELAHAGWTPATSSNFSHRLDE--QHAAITVSG
MTNB_XANC8      MNATTAP-LPYSAARLHELAQLLIGNIRELAQAGWTPATSSNFSHRLDE--QHAAITVSG
MTNB_XANCP      MNATTAP-LPYSAARLHELAQLLIGNIRELAQAGWTPATSSNFSHRLDE--QHAAITVSG
MTNB_XANCB      MNATTAP-LPYSAARLHELAQLLIGNIRELAQAGWTPATSSNFSHRLDE--QHAAITVSG
MTNB_STRMK      --MDTTT-FPYDTARLGELAQLLIDNVRELAQAGWTPATSSNFSHRLDD--RHAAITVSG
MTNB_XYLF2      MNATCTPSLPYDASRLRELAHLLIGTISEFAQAGWTPATSSNFSHRLDE--HHVAITVSG
MTNB_XYLFT      MNATCTPSLPYDASRLRELAHLLIGTISEFAQAGWTPATSSNFSHRLDE--HHVAITVSG
MTNB_XYLFM      MNATSTPSLPYDTNRLRELAHLLIGTISEFAQAGWTPATSSNFSHRLDE--HHVAITVSG
MTNB_XYLFA      MNATSTPSLPYDANRLRELAHLLIGTIGEFAQAGWTPATSSNFSHRLDE--HHVAITVSG
MTNB_CITK8      -------------MTDNLQLTQLVETCRWIGAKGWAPATGGNMSVRQDD--AFCWLSESG
MTNB_ENT38      -------------MTDNLQLTHLVDACRWIGAKGWAPATGGNMSIRQND--AFCWLSESG
MTNB_CROS8      -------------MSKESQLEALVAACHWIGAKGWAPATGGNMSLREDA--RWCWLSESG
MTNB_CROSK      -----------------------MAACHWIGAKGWAPATGGNMSLREDA--RWCWLSESG
MTNB_KLEP7      --------------MWQERLAQLVTTCHWIGAKGWAPATGGNMSVRQDD--TWCWLSESG
MTNB_YERP3      -------------MTENRQLGALLAACHWIGEKGWCPATGGNMSLRLDL--AHCLITESG
MTNB_YERPG      -------------MTENRQLGALLAACHWIGEKGWCPATGGNMSLRLDL--AHCLITESG
MTNB_YERPP      -------------MTENRQLGALLAACHWIGEKGWCPATGGNMSLRLDL--AHCLITESG
MTNB_YERPS      -------------MTENRQLGALLAACHWIGEKGWCPATGGNMSLRLDL--AHCLITESG
MTNB_YERPY      -------------MTENRQLGALLAACHWIGEKGWCPATGGNMSLRLDL--AHCLITESG
MTNB_YERPB      -------------MTENRQLGALLAACHWIGEKGWCPATGGNMSLRLDL--AHCLITESG
MTNB_YERE8      -------------MTENVQLGALLAACHWIGEKGWCPATGGNMSLRLDS--AQCLVTESG
MTNB_SERP5      -------------MTENQQLKALLSACHWIGEKGWCPATGGNMSLRLDD--QHCLVTESG
MTNB_PECAS      -------------MTENQQLTALVAACHWIGEKGWCPATGGNMSVRLDD--AQCLITESG
MTNB_SODGM      -----------------MQLAELVAACRWIGAKGWSPATGGNMSQRRDV--HSCYITESG
MTNB_PSET1      ------------MQNNNTAISQLIEAGKWVSQKEWIPATGGNFSARTES--GFV-ITASG
MTNB_SYNP2      -----------MSLENQTQKERLCAVIRQLHTQGKSPATSTNYSFLDED--QVIFVSRSG
MTNB_LEPBA      -------------MDLITSLQEITKLSHLYYERQWMYATAGNLSTRDGSSRDQFWITASG
MTNB_LEPBP      -------------MDLITSLQEITKLSHLYYERQWMYATAGNLSTRDGSSRDQFWITASG
MTNB_LEPBJ      -------------MSVKKQLEKLSILGATYHKNGWMPGTAGNLSVRILGESG-FWVSGSG
MTNB_LEPBL      -------------MSVKKQLEKLSILGATYHKNGWMPGTAGNLSVRILGESG-FWVSGSG
MTNB_LEPIC      -------------MSVKKQLERLSELGAYYHKNGWMPGTAGNLSIRIPEESG-FWVSGSG
MTNB_LEPIN      -------------MSVKKQLERLSELGAYYHKNGWMPGTAGNLSIRIPEESG-FWVSGSG
MTNB_MICAN      ---------------MSDPRLSLVAAARKFYQLGWMLGTAGNLSAKV--DDHSFWITASG
                                                     .:. * :           :: :*

MTNB_BACSU      KDKRKETVEDFLLVDQNGEPAES------GHSLKPSAETLLHTHLYNK-TNAGCCLHVHT
MTNB_BACVZ      KDKRKETDEDFLLIDEYGKPAET------GHSLKPSAETLLHTYLYQK-TDAGCCLHVHT
MTNB_BACP2      KDKRKETDEDFVLVNAAGNPVDP------DVPLRPSAETQLHTYVYER-TNAGCCLHVHT
MTNB_GEOKA      KDKRKQTDEDFLLVDAAGKPAE-------ETNLKPSAETLLHAEIYGR-TNAGCVLHVHT
MTNB_GEOTN      KDKRKQTSEDFLLIDADGKPVE-------DTHLKPSAETLLHVEVYRR-TNAGCVLHVHT
MTNB_EXIS2      KDKRQDTPDDFVHVDATGQLIG-------EQNGRPSAETLLHVEVFNR-TTAGCSLHVHT
MTNB_BACAH      KDKTKTTPDDFLLVDHLGVPVL-------ETELRPSAETILHTHIYNN-TNAGCVLHVHT
MTNB_BACAN      KDKTKTTPDDFLLVDHLGVPVL-------ETELRPSAETILHTHIYNN-TNAGCVLHVHT
MTNB_BACCZ      KDKTKTTPDDFLLVDHLGVPVL-------ETELRPSAETILHTHIYNN-TNAGCVLHIHT
MTNB_BACHK      KDKTKTTPDDFLLVDHLGVPVL-------ETELRPSAETILHTHIYNN-TNAGCVLHVHT
MTNB_BACC1      KDKTKTTPDDFLLVDHLGVPVL-------ETELRPSAETILHTHIYNN-TNAGCVLHVHT
MTNB_BACCR      KDKTKTTPDDFLLVDHVGVPVL-------ETELRPSAETILHTHIYNN-TNAGCVLHVHT
MTNB_BACMK      KDKTKTTPDDFLLVNHQGIPVL-------ETELRPSAETILHTHIYNN-TNAGCVLHVHT
MTNB_BACCN      KDKTKTTPDDFLLVDHQGNPVL-------ETELRPSAETILHTHIYNH-TNAGCVLHVHT
MTNB_SULSY      KDKGTVTHEDVIFVDKDGKPVE-------KTKMKPSAETMVHSYIYQK-TDAGCVIHVHT
MTNB_GLUDA      GHKGHLTADGVIEVTADGRAVR--------AGDRPSAETLLHCHVYEASPDVGAVLHGHS
MTNB_GLUOX      GHKGFLTDSDVIEITPDGVPVD--------PANRASAETLLHTQLYAHDPAIGAVLHGHS
MTNB_GRABC      NHKGFLKTSDIMVVDQAGKPLT--------PGLKPSAETLLHCQIYRLDNQAGAVVHGHS
MTNB_ACICJ      VHKGRLEAADIIEVWLDGTPLR--------AGDRPSAETQLHCQVYERLPAAGAVLHGHS
MTNB_ALCBS      KDKGLLRETDIMAVNMDGQPAS--------SG-KPSAETLLHTQLYRFDGNIQAVLHTHS
MTNB_AQUAE      KHKGKLTPEDILLIDYEGRPVG---------GGKPSAETLLHTTVYKLFPEVNAVVHTHS
MTNB_METCA      RHKGRLRPEDIMLVDAAGRSLD---------GRKPSAETLLHTGIYRRYPEAHAVLHPHS
MTNB_HAHCH      KHKGRLQAQDIMVVDLQGRAVA--------SQMKSSAETLLHTVIYDLKPNVGAVLHTHS
MTNB_MARHV      RHKGQLGAGDVMVVDLHGQAVQ--------SDCRSSAETLLHTVIYQLYPEVGAVLHTHS
MTNB_PSE14      KHKGQLGPDDVLATDMAGNSLE--------PGKKPSAETLLHTQLYSSRPQVGAVLHTHS
MTNB_PSEU2      KHKGQLGPDDVLATDLAGNSLE--------PGKKPSAETLLHTQLYSCRPQVGAVLHTHS
MTNB_PSESM      KHKGQLGPDDVLATDLAGNSLE--------PGKKPSAETLLHTQLYLCRPQVGAVLHTHS
MTNB_PSEPF      KHKGQLGLDDVLATDLSGNSLE--------PGKKPSAETLLHTQLYSWRPEIGAVLHTHS
MTNB_PSEAB      KHKGQLGFDDVLATDLAGNSLE--------PGKKPSAETLLHTQLYAWNPAIGAVLHTHS
MTNB_PSEAE      KHKGQLGFDDVLATDLAGNSLE--------PGKKPSAETLLHTQLYAWNPAIGAVLHTHS
MTNB_PSEA7      RHKGQLGFDDVLATDLAGNSLE--------PGKKPSAETLLHTQLYAWSPAIGAVLHTHS
MTNB_BRASB      VDKGRLTPNDVL----CQQLSQP-------LVAGSSAEAELHRRLYADDAEIGAVFHTHA
MTNB_PARL1      ANKAELDENGVI----EAEIAGA-------KHPRASAEAPLHLARYRAAPGIGAISHMHS
MTNB_SORC5      RPKGALGVSDIVVVNADGRLTGP-------SPARPSAETALHCQLYRHSSEIGAVAHTHS
MTNB_XANAC      RDKGRLVEEDIMVVDFDGLAVG--------RPLRPSAETLLHTQLYRRFPEIGCVLHTHS
MTNB_XANC5      RDKGRLVEENIMVVDFDGLAVG--------RPLRPSAETLLHTQLYRRFPEIGCVLHTHS
MTNB_XANOP      RDKGRLVEEDIMVVDFDGLAVG--------RPLRPSAETLLHTQLYRRFPEICCVLHTHS
MTNB_XANOR      RDKGRLVEEDIMVVDFDGLAVG--------RPLRPSAETLLHTQLYRRFPEICCVLHTHS
MTNB_XANOM      RDKGRLVEEDIMVVDFDCLAVG--------RPLRPSAETLLHTQLYRRFPEICCVLHTHS
MTNB_XANC8      RDKGRLVEEDIMVVDFDGQPVG--------RPLRPSAETLLHTQLYRRFPEIGCVLHTHS
MTNB_XANCP      RDKGRLVEEDIMVVDFDGQPVG--------RPLRPSAETLLHTQLYRRFPEIGCVLHTHS
MTNB_XANCB      RDKGRLVEEDIMVVDFDGQPVG--------RPLRPSAETLLHTQLYRRFPEIGCVLHTHS
MTNB_STRMK      KDKGRLIEDDIMVVDFDGKAVG--------RPLRPSAETLLHTQLYRRFPEIGCVLHTHS
MTNB_XYLF2      RDKRCLREEDIMAVDLDGNAVG--------HPHTPSAETLLHTQLYRRFPEIGCVLHTHS
MTNB_XYLFT      RDKRCLREEDIMAVDLDGNAVG--------HPHTPSAETLLHTQLYRRFPEIGCVLHTHS
MTNB_XYLFM      RDKRCLREEDIIAVDLDGNAVG--------HPHTPSAETLLHTQLYRRFPEIGCVLHTHS
MTNB_XYLFA      RDKRCLTEEDIMAVDLEGNAVG--------HPHTPSAETLLHTQLYRRFPEIGCVLHTHS
MTNB_CITK8      KDKGNLTTDDFLQVEIATSHAP--------SGRKPSAETGLHTLIYHLFPQANAVLHVHT
MTNB_ENT38      KDKGSLTIDDFLQVDIASNRAP--------SGRKPSAETGLHTLIYRLFPEANAVLHVHT
MTNB_CROS8      KDKGSLTTDDFLQVDIATNLAP--------SGRKPSAETGLHTLIYRLFPEANCVLHVHT
MTNB_CROSK      KDKGSLTTDDFLQVEIATNLAP--------SGRKPSAETGLHTLIYRLFPEANCVLHVHT
MTNB_KLEP7      RDKGSLTTEDFLQVEIATNQAP--------SGRKPSAETGLHTLVYRLFPEANVVLHVHT
MTNB_YERP3      KDKGSLAAEDFLLVETANNHVP--------SGRTPSAETGLHTLLYRLYPEIQAVLHTHS
MTNB_YERPG      KDKGSLAAEDFLLVETANNHVP--------SGRTPSAETGLHTLLYRLYPEIQAVLHTHS
MTNB_YERPP      KDKGSLAAEDFLLVETANNHVP--------SGRTPSAETGLHTLLYRLYPEIQAVLHTHS
MTNB_YERPS      KDKGSLAAEDFLLVETANNHVP--------SGRTPSAETGLHTLLYRLYPEIQAVLHTHS
MTNB_YERPY      KDKGSLAAEDFLLVETANNHVP--------SGRTPSAETGLHTLLYRLYPEIQAVLHTHS
MTNB_YERPB      KDKGSLAAEDFLLVETANNHVP--------SGRTPSAETGLHTLLYRLYPEIQAVLHTHS
MTNB_YERE8      KDKGSLTADDFLLVETANNHVP--------SGRTPSAETGLHTLLYRLYPEINAVLHTHS
MTNB_SERP5      KDKGSLTETDFLLVETASNHVP--------SGRTPSAETGLHTLIYRLYPQIGAVLHTHS
MTNB_PECAS      KDKGSLQTEDFLLVDIATNHVP--------SGRTPSAETGLHTLLYRREPTIGAVLHTHS
MTNB_SODGM      LDKGHLDAGDFLTVDIQTGAAQ--------PGRRPSAETGLHTFLYRRFPEVGCVLHTHS
MTNB_PSET1      QDKGKLTSEQFLQLDLQGKPLA--------GTKKRSAETQLHLSLYQLIPEAQCVLHTHS
MTNB_SYNP2      VDKSQFQPEDFIAVDTMGLPLPP------DEGIKPSAETLIHCFIYQNFPGITCVLHTHS
MTNB_LEPBA      KHKGELKDTDFVCVSVADGTL-----LKASDGLKPSAETSIHQVLYSQMPDIGCCLHVHT
MTNB_LEPBP      KHKGELKDTDFVCVSVADGTL-----LKASDGLKPSAETSIHQVLYSQMPDIGCCLHVHT
MTNB_LEPBJ      LDKNTLNKRNFLYVDLKSGRLSPSKNTKVEKGLKPSAETSIHRAVYCALDDIGCGLHVHT
MTNB_LEPBL      LDKNTLNKRNFLYVDLKSGRLSPSKNTKVEKGLKPSAETSIHRAVYCALDDIGCGLHVHT
MTNB_LEPIC      LDKDLLNKRNFLYVDLESGKPVDSKNVKATKGLKPSAETSIHRAVYRALDEVGCGLHVHT
MTNB_LEPIN      LDKNLLNKRNFLYVDLESGKPVDSKNIKATKGLKPSAETSIHRAVYRALDGVGCGLHVHT
MTNB_MICAN      KSKGKLTEQDFVRVELTGKVR-----ELAHRDNRPSAETSIHQVIYCLFPQAQACYHVHS
                  *       .:                       ***: :*   :          * *:

MTNB_BACSU      VNNNVISELYGDQ----KKITFKGQEIIKAL-GLWEENAEVTVPIIENPAHIPTLAALFA
MTNB_BACVZ      VNNNVISELYGDE----KQITFQGQEMIKAL-GLWEENASVTVPIIDNPAHIPALAENFA
MTNB_BACP2      IDNNVISELYGDK----GEIRFKGNEIIKAL-GYWEEDAEVSLPIIENPAHIPHLAAQFA
MTNB_GEOKA      VDNNLISELYAQN----GEAVFSGQEIIKAF-GIWEENAAVRIPIIDNYADIPTLAREFA
MTNB_GEOTN      VDNNIISDVYAQN----REAVFSGQEIIKAF-GIWEENAEVRIPIIDNYADIPTLANEFA
MTNB_EXIS2      VDNNVISELYGDR----GEIRFRSQEIIKAL-GRWEEDAEVIVPIITNHADIPTLAADFA
MTNB_BACAH      TDNNVITNLYSD------AVTLQNQEIIKAL-DIWEEGATIHIPIIENHAHIPTLGENFR
MTNB_BACAN      TDNNVITNLYSD------AVTLQNQEIIKAL-DIWEEGATIHIPIIENHAHIPTLGENFR
MTNB_BACCZ      TDNNVITNLYSD------AVTLQNQEIIKAL-DIWEEGATIHIPIIENHAHIPTLGENFR
MTNB_BACHK      TDNNVITNLYSD------AVTLQNQEIIKAL-DIWEEGATIHIPIIENHSHIPTLGENFR
MTNB_BACC1      TDNNVITNLYSD------AVTLQNQEIIKAL-DIWEEGATINIPIIENHAHIPTLGENFR
MTNB_BACCR      TDNNVITNLYSD------AVTLQNQEIIKAL-DIWEEGATIHIPIIENHAHIPTLGENFR
MTNB_BACMK      TDNNVITNLYSD------AVTLQNQEIIKAL-DIWEEGATINIPIIENDAHIPTLGEKFR
MTNB_BACCN      TDNNVITNLYEK------EVMIRNQEIIKAL-NIWEEGATIHIPIIENYAHIPLLGEAFK
MTNB_SULSY      PANNFISYVYFED----GKVKIKDLEMIKAL-DIWKENAEIEVPIVDNFFDLKKLAEEAG
MTNB_GLUDA      VASTVLSMM-----EQGDAILLSGYEVLKVFEGQQTHDTTVRLPVFDNDQDIARLSGVVA
MTNB_GLUOX      VAATILSMD-----EPSDAITLAGYEVLKVFEGQTTHDTSLELPLFHNDQDIARLATVVA
MTNB_GRABC      VAATVLSMAPGKNDAPPDFIRLEGYEVLKAF-GVKTHQITLDLPILDNDQDMERLASIAE
MTNB_ACICJ      VAATALTLA-----DNSPGIVLEGYEILKAFPGIATHETRIVLPVFDNDQDMRRLAAAIA
MTNB_ALCBS      HASTVLTMH-----WPANSITLEGYELLKALQGITSHNSRLTIPVFENTQDIAALAAKVD
MTNB_AQUAE      PNATVISIVEKK-----DFVELEDYELLKAFPDIHTHEVKIKIPIFPNEQNIPLLAKEVE
MTNB_METCA      PASTLLSRLVS------GAVILEDYELLKALAGIDTHATRIVVPVFPNDQDIPRLALKIE
MTNB_HAHCH      VTATVLSRALRP----NTEIVFEDYELQKAFRGVYTHEGRCVVPIFDNTQDIEALSALSV
MTNB_MARHV      VKATVLSRLIPA----GQALELEGYELQKAFNGVQTHEGKLIVPVFDNTQDIPALAEETR
MTNB_PSE14      VNATVLSRLTAA----DH-LVFEDYELQKAFHGVVTHQSQVVVPIFDNDQDIARLAAKVQ
MTNB_PSEU2      VNATVLSRLTTA----DH-LVFEDYELQKAFSGVVTHESQVVVPIFDNDQDIARLAAKVQ
MTNB_PSESM      VNATVLSRLTAS----DH-LVFEDYELQKAFNGVLTHESQVVVPIFDNDQDIARLAANVQ
MTNB_PSEPF      VNATVLSRLTPQ----DF-IEFEDYELQKAFSGVSTHESRVRVPIFDNDQDIARLAAKVQ
MTNB_PSEAB      VNATVLSRLVRG----DR-LVLQDYELQKAFAGVTTHEGQVEVPIFDNDQDIARLASRVQ
MTNB_PSEAE      VNATVLSRLVRG----DR-LVLQDYELQKAFAGVTTHEGQVEVPIFDNDQDIARLASRVQ
MTNB_PSEA7      VNATVLSRLVRG----DR-LVLQDYELQKAFAGVTTHEGQVEVPIFDNDQDIARLAGRVQ
MTNB_BRASB      VSATVLAQLHRG----ERLLTLSGWELQKALAGIRSHETVVEVPVVANDQDVVALANEVA
MTNB_PARL1      MAATVLSRRHAG----TGAVRLEGWELMKAFAGVTTHDMSIDIPIVPNDQDTDRLAALVE
MTNB_SORC5      RAATVLSRRCAQ----EGYVTLSGYEVAKALSGMTTHTATVLLPVFVNTQDIRRLAEDVD
MTNB_XANAC      PMQTIASRLYAG----SGVIRLEGYELLKAFDGNTTHETAMEVPVFANTQDMQVLAAQVD
MTNB_XANC5      PVQTIASRLYAG----SGVIRLEGYELLKAFDGNTTHETAVEVPVFANTQDMQVLAAQVD
MTNB_XANOP      PVQTIASRLYAG----SDVIRLEGYELLKAFEGNTTHETAVEVPVFANTQDMQVLAAQVD
MTNB_XANOR      PVQTIASRLYAG----SDVIRLEGYELLKAFEGNTTHETAVEVPVFANTQDMQVLAAQVD
MTNB_XANOM      PVQTIASRLYAG----SDVIRLEGYELLKAFEGNTTHETAVEVPVFANTQDMQVLAAQVD
MTNB_XANC8      PVQTIASRLYAG----SGVIRLEGYELLKAFEGNTTHETAVDVPVFANTQDMQVLAAQVE
MTNB_XANCP      PVQTIASRLYAG----SGVIRLEGYELLKAFEGNTTHETAVDVPVFANTQDMQVLAAQVE
MTNB_XANCB      PVQTIASRLYAG----SGVIRLEGYELLKAFEGNTTHETAVDVLVFANTQDMQVLAAQVE
MTNB_STRMK      PVQTIASRLYAP----QGHVHLEGYELLKAFAGNSTHEMAIDVPVFANTQDMNVLSKQVD
MTNB_XYLF2      LTQTVASRVYAG----AGHISLKDYELLKAFAGHSTHETTLDVPVFCNTQNMNILAAQVD
MTNB_XYLFT      LTQTVASRVYAG----AGHISLKDYELLKAFAGHSTHETTLDVPVFCNTQNMNILAAQVD
MTNB_XYLFM      LTQTVASRVYAG----AGHISLKDYELLKAFEGHSTHETTLDVPVFCNTQNMNILAAQVD
MTNB_XYLFA      LTQTVASRVYAG----AGHISLKDYELLKAFEGHSTHETTLDVPVFCNTQNMNILAAQVD
MTNB_CITK8      ANATVLSRIVKT-----PELYISGFEMQKSLSGQTTHLDTVCVPVFDNDQDIDALASRIA
MTNB_ENT38      VNATVLSRLVKE-----TELRISGFEMQKSLTGQSTHLDTVTIPVFDNDQDIDALASRIA
MTNB_CROS8      VNATVLSRVEKS-----DALHLSGYEMQKSLAGQITHLDDVPVAIFDNDQDIDALAERIA
MTNB_CROSK      VNATVLSRVEKS-----DALHLSGYEMQKSLAGQITHLDDVPVAIFDNDQDIDALAERIA
MTNB_KLEP7      VNATVLSRIEKS-----DTLALQGYEMQKTLSGQHSHLDTVPIAIFDNDQDIDALAARIA
MTNB_YERP3      VNATVLSRVERS-----NALVLQGYEMQKSLSGQRSHLDAVVIPIFDNDQDIPALAQRVA
MTNB_YERPG      VNATVLSRVERS-----NALVLQGYEMQKSLSGQRSHLDAVVIPIFDNDQDIPALAQRVA
MTNB_YERPP      VNATVLSRVERS-----NALVLQGYEMQKSLSGQRSHLDAVVIPIFDNDQDIPALAQRVA
MTNB_YERPS      VNATVLSRVERS-----NALVLQGYEMQKSLSGQRSHLDAVVIPIFDNDQDIPVLAQRVA
MTNB_YERPY      VNATVLSRVERS-----NALVLQGYEMQKSLSGQRSHLDAVVIPIFDNDQDIPVLAQRVA
MTNB_YERPB      VNATVLSRVERS-----NALVLQGYEMQKSLSGQRSHLDAVVIPIFDNDQDIPVLAQRVA
MTNB_YERE8      VNATVLSRVERS-----NELVLHGYEMQKSLSGQRSHLDSVVIPIFDNDQDIPALAQRVA
MTNB_SERP5      VNATVLSRVERS-----DGLVLQGYEMQKSLGGQTTHLDSVVIPIFDNDQDISRLAARVA
MTNB_PECAS      VNATVLSRVEKG-----AELVLHGYEMQKSLAGQTTHLDRVVIPIFDNDQDIPALAQRVT
MTNB_SODGM      VSATVLSRAEQG-----STLRLSGYEMQKSLTGQTDHREEVAIAVFDNSQDIPALVQRIA
MTNB_PSET1      VAATVLSQITKS-----HKLDLTGYEMQKALTGFTSHLETLSIPIFNNDQDIDHLSLLVS
MTNB_SYNP2      VAATLLSGIFAA----KQAVTFSGYEVIKGIAGQTTHETAIALPIFANDQDMKSFCQQLA
MTNB_LEPBA      IDSNLLEFGVGKEEG-SREIPIPPIEIIKAF-GIWDEKPNLTMPVFYNHTHVPTIADEIK
MTNB_LEPBP      IDSNLLEFGVGKEEG-SREIPIPPIEIIKAF-GIWDEKPNLTMPVFYNHTHVPTIADEIK
MTNB_LEPBJ      LESNLIRTNTSQHRP-VALLELPAIEILKVY-GIWKESPKVYVPVIYNFPNVQDISDCLE
MTNB_LEPBL      LESNLIRTNTSQHRP-VALLELPAIEILKVY-GIWKESPKVYVPVIYNFPNVQDISDCLE
MTNB_LEPIC      LESNLICANTSKNEP-IALFELPAIEILKAY-GIWEENPKVYVPIIYNFPNVQDISDCLE
MTNB_LEPIN      LESNLICANTSKNEP-IVLFELPAIEILKAY-GIWEENPKVYVPIIYNFPNVQDISDCLE
MTNB_MICAN      VEANLVSRFARGDK-----LSLPPLEMLKGL-GIWVENPQVFMPVFANYLDVPKIAAEIE
                   .                 :   *: *   .   .     : :. *  .   :     

MTNB_BACSU      EEISEDS-------GAVLIRNHGITAWGKTAFEAKRVLEAYEFLFSYHLKLKTLEHQLVK
MTNB_BACVZ      HHAAAGS-------GAVLIRNHGITAWGRTAFEAKRVLEAYEFLFSCHLKLLSLRPQLVK
MTNB_BACP2      KHLTEESE-----SGAVLIRNHGITVWGKTASEAKRVLEAYEFLFSYYLKLTLYQKQLVT
MTNB_GEOKA      NYIHGDA-------GAVLIQNHGITVWGRTAFEAKKHLEAWEFLFRWQVKRLLLQRAGLP
MTNB_GEOTN      KHIDGDT-------GAVLIQNHGITVWGRDAFEAKKHLEAWEFLFSWQVKRLLLQRAAVP
MTNB_EXIS2      KHIRTES-------GAVLIRNHGITVWAPTAFEAKKQLEAFEFLFSYTLKLQACRQAIY-
MTNB_BACAH      KHIQGDS-------GAVLIRNHGITVWGRDSFDAKKRLEAYEFLFQFHIKLLSIQGGVSN
MTNB_BACAN      KHIQGDS-------GAVLIRNHGITVWGRDSFDAKKRLEAYEFLFQFHIKLLSIQGGVSN
MTNB_BACCZ      KHIQGDS-------GAVLIRNHGITVWGRDSFDAKKRLEAYEFLFQFHIKLLSIQGGVSN
MTNB_BACHK      KHIQGDS-------GAVLIRNHGITVWGRDSFDAKKRLEAYEFLFQFHIKLLSIQGGVSN
MTNB_BACC1      KHIQGDS-------GAVLIRNHGITVWGRDSFDAKKRLEAYEFLFQFHIKLLSIQGGVSN
MTNB_BACCR      KHIQGDS-------GAVLIRNHGITVWGRDSFDAKKRLEAYEFLFQFHIKLLSIQGGVSN
MTNB_BACMK      KHIQGDS-------GAVLIRNHGITVWGRDSFDAKKRLEAYEFLFQFHIKLLSIQGGVSN
MTNB_BACCN      KHIQSDC-------GAVLIRNHGITVWGKDSFDAKKRLEAYEFLFQFHIKLLSIQGGVSS
MTNB_SULSY      KAINPDV-------PAVLIKTHGIYCWGRDEFEAKRHVEAFEFMFELMKNLIIFKGSKDI
MTNB_GLUDA      PYLGR-------MPAGYVIRGHGVYVWGGTMDVALARLEGLEFLLACELERRKVAR----
MTNB_GLUOX      PKLSD-------MRLGYLIRGHGVYVWGKDMFTALARLEGLEFLLACELARLQKKA----
MTNB_GRABC      PILLRG------APLGYLIRGHGVYVWGGDMAAALARLEGLEFLLACELERRRLR-----
MTNB_ACICJ      PAFAA-------PPIGYVLRGHGIYAWGEDVERCFWRLEALEFLLSCECERRRMR-----
MTNB_ALCBS      QQMRSGH-----ISHAYLIRGHGLYTWANDLPTCYRQLEALETLLAIELECRRLRGS---
MTNB_AQUAE      NYFKTS-----EDKYGFLIRGHGLYTWGRSMEEALIHTEALEFIFECELKLLSFHS----
MTNB_METCA      EYLVRH-----DGVHAYIIAGHGFYTWGKSVADALRHVEALEYLFDLETRMHGVKR----
MTNB_HAHCH      EYLKEH-----SDCPGYLIRGHGMYTWGETMAECLRHVEAMEFLLACELEMMRIKS----
MTNB_MARHV      DWFARH-----PEQPGYLIRGHGLYTWGRTMADCLRHIEAFEFLFECELETMRVRR----
MTNB_PSE14      PWLDAH-----PECAGYLIRGHGLYTWGAKMSDALRQIEAFEFLFECELKMRAVLNR---
MTNB_PSEU2      PWLDTH-----PECAGYLIRGHGLYTWGAKMSDALRQIEAFEFLFECELKMRAVMNR---
MTNB_PSESM      PWLDAH-----PECAGYLIRGHGLYTWGARMSDALRQIEAFEFLFECELKMRTVMNR---
MTNB_PSEPF      PWLEAH-----PDCVGYLIRGHGLYTWGAQMSDALRQIEAFEFLFECELKTRSVMNRQG-
MTNB_PSEAB      PWLEAH-----PYCPGYLIRGHGLYTWGARMSDALRQVEAFEFLFECELKVLSLSR----
MTNB_PSEAE      PWLEAH-----PHCPGYLIRGHGLYTWGARMSDALRQVEAFEFLFECELKVLSLSR----
MTNB_PSEA7      PWLEAH-----PDCPGYLIRGHGLYTWGARMSDALRQVEAFEFLFECELKVLSLSR----
MTNB_BRASB      ARLAAPVAAGAVRAPGYLIAGHGLYAWGHTAVDAFRHLEALDVLFTQILTLRRHAS----
MTNB_PARL1      ERLDK-----DSICPGYLIAGHGLYVWGASAAETIRHMEAFDFLLTAQLHEESAR-----
MTNB_SORC5      AFMSA-----HPPVYGYLIAGHGLYTWGSDIASTIRHIEAIEFMLDCALLEGGLS-----
MTNB_XANAC      ALLDK------QSMWGYLIEGHGLYAWGRNMAEARRHLEAFEFLLHCELELLKLRGTR--
MTNB_XANC5      ALLDK------QSMWGYLIEGHGLYAWGRNMAEARRHLEAFEFLLHCELELLKLRGTR--
MTNB_XANOP      ALLDK------QSMWGYLIEGHGLYAWGRNMAEARRHLEAFEFLLQCELELLKLRGTRQV
MTNB_XANOR      ALLDK------QSVWGYLIEGHGLYAWGRNMAEARRHLEAFEFLLQCELELLKLRGTRQV
MTNB_XANOM      ALLDK------QSMWGYLIEGHGLYAWGRSMAEARRHLEAFEFLLQCELELLKLRGTRQV
MTNB_XANC8      ALLDK------QSMWGYLIEGHGLYAWGRNMAEARRHLEAFEFLLHCELELLKLRSPR--
MTNB_XANCP      ALLDK------QSMWGYLIEGHGLYAWGRNMAEARRHLEAFEFLLHCELELLKLRSPR--
MTNB_XANCB      ALLDK------QSMWGYLIEGHGLYAWGRNMAEARRHLEAFEFLLHCELELLKLRSPR--
MTNB_STRMK      DLLDR------QNLWGYLIDGHGLYAWGRDMAEARRHLEAFEFLFHCELELRRLHG----
MTNB_XYLF2      TLLDK------QRMWGYLINGHGMYTWGNTLADARRHLEALEFLLHCELDLLKLRGYL--
MTNB_XYLFT      TLLDK------QRMWGYLINGHGMYTWGNTLADARRHLEALEFLLHCELDLLKLRGYL--
MTNB_XYLFM      TLLDK------QRMWGYLINGHGMYTWGNTLADARRHLEALEFLLHCELDLLKLRGYL--
MTNB_XYLFA      TLLDK------QRMWGYLINGHGMYTWGNTLADARRHLEALEFLLHCELNLLKLRGYL--
MTNB_CITK8      HYAQER-----SLNYGFLLRGHGLTCWGRSVEEARRHLEGLEFLFECEMRLRQLERL---
MTNB_ENT38      HYAQER-----PFNYGFLLRGHGLTCWGRDVAEARRHLEGLEFLFECEMRLRQLEKI---
MTNB_CROS8      RHHRQF-----PLRYGFLLRGHGLTCWGSDVAVARRHLEGLEFLFECEMQRRLLERA---
MTNB_CROSK      RHHRQF-----PLRYGFLLRGHGLTCWGSDVAVARRHLEGLEFLFECEMQRRLLERA---
MTNB_KLEP7      DYAQTR-----PLRYGFLLRGHGLTCWGKDIQEARRQLEGLEFLFECELMRRRYEP----
MTNB_YERP3      AYADNR-----PLQYGFLVRGHGLYCWGNSVVEARRHLEGLEFLFQCELQRRLFDVNSNV
MTNB_YERPG      AYADNR-----PLQYGFLVRGHGLYCWGNSVVEARRHLEGLEFLFQCELQRRLFDVNSNV
MTNB_YERPP      AYADNR-----PLQYGFLVRGHGLYCWGNSVVEARRHLEGLEFLFQCELQRRLFDVNSNV
MTNB_YERPS      AYADNR-----PLQYGFLVRGHGLYCWGNSVVEARRHLEGLEFLFQCELQRRLFDVNSNV
MTNB_YERPY      AYADNR-----PLQYGFLVRGHGLYCWGNSVVEARRHLEGLEFLFQCELQRRLFDVNSNV
MTNB_YERPB      AYADNR-----PLQYGFLVRGHGLYCWGNSVVEARRHLEGLEFLFQCELQRRLFDVNSNV
MTNB_YERE8      ALADNH-----PLRYGFLVRGHGLYCWGNSVSEARRHLEGLEFLFQCELQRRLLDANFKL
MTNB_SERP5      AHAEAT-----PLQYGFLVRGHGLYCWGRQVAEARRHLEGLEFLFQCELQRRLLEAK---
MTNB_PECAS      EFASHT-----PLRYGFLVRGHGLYCWGATVKEARRHLEGLEFLFQCELQRRLLEAKA--
MTNB_SODGM      LQDALT-----PLRYGFLMCGHGLTCWGRDVREARLHLEGLEFLFECEWRRRLLEAQ---
MTNB_PSET1      DHHLHT-----PIEHGVLIRGHGLYAVGRNIDEVRRHLEVLEFLFSCELERLKITGIQAS
MTNB_SYNP2      QRQEEL------NNYGFLIAKHGLYAWGETMAIAKRHLEVWEFMLECELEQLKITPPLAA
MTNB_LEPBA      RYFISVGI---PKVPFLLIEGHGPTVWGKSIAEANKHLEAVHFLLQVMA-----------
MTNB_LEPBP      RYFISVGI---PKVPFLLIEGHGPTVWGKSIAEANKHLEAVHFLLQVMA-----------
MTNB_LEPBJ      SYLKEYK----PVVPFCIIEKHGITVWGKDTVQANRNLEATDFILKYMISSRNLSNPEGK
MTNB_LEPBL      SYLKEYK----PVVPFCIIEKHGITVWGKDTVQANRNLEATDFILKYMISSRNLSNPEGK
MTNB_LEPIC      KYLKEYR----PHVPFCIIEKHGITVWGKDAVQANRNLEATDFILKYMTSWKSFSYS-GE
MTNB_LEPIN      KYLKEYR----PHVPFCIIEKHGITVWGKDAVQANRNLEATDFILKYMTSWKSFSYS-GE
MTNB_MICAN      SRFSTFP----PEIPALLISYHGVTVWGESLETTENYLEIVEYIFRYLVAAYQVKPC---
                                 ::  **    .          *  . ::               

MTNB_BACSU      ------------------------------
MTNB_BACVZ      ------------------------------
MTNB_BACP2      ------------------------------
MTNB_GEOKA      VG----------------------------
MTNB_GEOTN      LVD---------------------------
MTNB_EXIS2      ------------------------------
MTNB_BACAH      GANSYS------------------------
MTNB_BACAN      GANSYS------------------------
MTNB_BACCZ      GANSYS------------------------
MTNB_BACHK      GANSYS------------------------
MTNB_BACC1      GANSYS------------------------
MTNB_BACCR      GANSYS------------------------
MTNB_BACMK      GANSYS------------------------
MTNB_BACCN      GANSYS------------------------
MTNB_SULSY      W-----------------------------
MTNB_GLUDA      ------------------------------
MTNB_GLUOX      ------------------------------
MTNB_GRABC      ------------------------------
MTNB_ACICJ      ------------------------------
MTNB_ALCBS      ------------------------------
MTNB_AQUAE      ------------------------------
MTNB_METCA      ------------------------------
MTNB_HAHCH      ------------------------------
MTNB_MARHV      ------------------------------
MTNB_PSE14      ------------------------------
MTNB_PSEU2      ------------------------------
MTNB_PSESM      ------------------------------
MTNB_PSEPF      ------------------------------
MTNB_PSEAB      ------------------------------
MTNB_PSEAE      ------------------------------
MTNB_PSEA7      ------------------------------
MTNB_BRASB      ------------------------------
MTNB_PARL1      ------------------------------
MTNB_SORC5      ------------------------------
MTNB_XANAC      ------------------------------
MTNB_XANC5      ------------------------------
MTNB_XANOP      VPVPHS------------------------
MTNB_XANOR      VPVPHS------------------------
MTNB_XANOM      VPVPHS------------------------
MTNB_XANC8      ------------------------------
MTNB_XANCP      ------------------------------
MTNB_XANCB      ------------------------------
MTNB_STRMK      ------------------------------
MTNB_XYLF2      ------------------------------
MTNB_XYLFT      ------------------------------
MTNB_XYLFM      ------------------------------
MTNB_XYLFA      ------------------------------
MTNB_CITK8      ------------------------------
MTNB_ENT38      ------------------------------
MTNB_CROS8      ------------------------------
MTNB_CROSK      ------------------------------
MTNB_KLEP7      ------------------------------
MTNB_YERP3      DVKPNVDVNPNVEAK---------------
MTNB_YERPG      DVKPNVDVNPNVEAK---------------
MTNB_YERPP      DVKPNVDVNPNVEAK---------------
MTNB_YERPS      DVKPNVDVNPNVEAK---------------
MTNB_YERPY      DVKPNVDVNPNVEAK---------------
MTNB_YERPB      DVKPNVDVNPNVEAK---------------
MTNB_YERE8      GAK---------------------------
MTNB_SERP5      ------------------------------
MTNB_PECAS      ------------------------------
MTNB_SODGM      ------------------------------
MTNB_PSET1      NNNK--------------------------
MTNB_SYNP2      R-----------------------------
MTNB_LEPBA      --------------RKV-------------
MTNB_LEPBP      --------------RKV-------------
MTNB_LEPBJ      KNFPTENNTSESDRQKVYVAEFPVYPATFL
MTNB_LEPBL      KNFPTENNTSESDRQKVYVAEFPVYPATFL
MTNB_LEPIC      PRKLSVSDVLEQDRREIFSVEFPVYPATFY
MTNB_LEPIN      PRKLSVSDVLGQDRREIFSVEFPVYPATFY
MTNB_MICAN      ------------------------------