CLUSTAL format seed alignment for MF_01678

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

MTNA_POSPM        ------------------MPG--------LTSIRTSE-GKIEIVNQLLLPHTTEFIEIST
MTNA_CRYNJ        --------------MVAAAPSNKERLPDMMTSIRLDQSGRVEIIDQLLLPHSVVWMPVST
MTNA_ANOGA        --------------------------MTLEAIKYKS--GQLQILDQLLLPAESKYIPVAG
MTNA_DROGR        --------------------------MSLQSIKYKR--GSLEILDQLLLPVVSKYLPVRG
MTNA_HUMAN        --------------------------MTLEAIRYSR--GSLQILDQLLLPKQSRYEAVGS
MTNA_XENTR        --------------------------MSLESVRYSR--GSLQVLNQLLLPHKSEYEPVTG
MTNA_NEMVE        --------------------------MSLEAIKYKK--GRLEILNQLLLPHESTYEVVSD
MTNA_TRIAD        ----------------------MTEQQSLEAIRYDHDHGQLKILNQLLLPSEYVYENVEG
MTNA_MONBE        -------------------------MATLEAIKYDG--EKLLVLDQIKLPLETHYDEVLS
MTNA_NAEGR        --------------------MSSSVGATLEAIKYTR--GSLEILDQLLIPKSFIYEVVDT
MTNA_ORYSJ        ----------------------MGELGALQSIVYHR--GSLRLLDQRKLPLEVDYIDVKC
MTNA_OSTLU        -------------------------MSSLEAIRYAR--GNLELLDQLALPLETKYIDVRD
MTNA2_TRYCC       --------------------MARAHNATLESIQYAR--GTLRLLDQRKLPLETVFDEILT
MTNA_CALS8        ----------------------------MKHFEFE--NDKLIVLDQRKLPFEKEYFVCST
MTNA_SULSY        ----------------------MRKLKDIKPLELK--DDVLYVINQLKLPHELVWEKLET
MTNA_CALS4        -------------------------MKEIKTMEFR--DGVLYLIDQRKLPLSYEFFECRT
MTNA_NATTJ        -------------------------MVSVKPLKFE--DDELLLLDQRKLPGKEEYFTCKT
MTNA_METJA        ------------------------MTKDLRPIIWDDDKKELILIDQRKLPNKLEYFICKT
MTNA_METST        ---------------------------MIRTLYWENNR--LFLLDQTKLPHTIEYVECRT
MTNA_AERPE        --------MRDIDPSLRREIESLERFLKVKPLYFDFDEGVFVWLDTRLIPFREVYRRTSD
MTNA_ARCFU        ----------------------------MRSIFWDD---GLKLIDQTKLPEKLEVIECRN
MTNA_METAC        -------------------MMFTSESDLMRTIDWNEESNSVVLVDQTLLPQEYKVIECKT
MTNA_SULAC        -------MHFPLIPMVKLEEIKQIFKPKLLPIIWNK--TKLTLLDQSRLPFEKIYVDVTK
A8MBP9_CALMQ      -------------MRISIDEVKRIYKPKVKPIEWRD--NRLIILDQSKVPFETIYVELHT
MTNA_METPB        ------------------MKIDGRPYRTIFPEAG---GNAVTVIDQTRLPFAFELKRLAS
MTNA_RHORT        ------------------MNVKGTPTRTIWPARE---GGAVWIIDQTRLPHEFVTQRLND
MTNA_SINMW        ------------------MKVGDRHYHTIWLNED---GRSVDIIDQRWLPHEFRVVTLKT
M9RDG3_9RHOB      ------------------MKVDGTHYRSLWWDAK---KDALQIIDQRWLPHEFRTQSVVT
MTNA_GLUOX        ------------------MKINGISYRSLWRPSDD--ASSIRIFDQTRFPWNVEILELRD
MTNA_DESOH        -----------------MTATDPAPTRPIWLAD-D--KKRVQIIDQRMLPHNLVIVDLTT
MTNA_DESAL        ------------------MNVNGKWYRAIWPNEHD--PETVEIIDQRKLPHRFEIVGLTT
E4U607_OCEP5      ------------------MNVGGEHYRTIWLKPGD--DRVVQIIDQRPLPHAFVIEDLAS
K9Z7E6_CYAAP      ------------------MDVNGKPYRTIWLKSDN--PEIVQVIDQRFLPHQFVIEDLVT
F5Y6P1_TREAZ      ------------------MNVNGKRYRTIWLKESD--PSIVQIINQQVLPFKFEILDLKT
MTNA_DECAR        ------------------MNIDGIPTRTLRAHPD---RRAIDIIDQTRLPHALHWVRVAT
MTNA_SULDN        ------------------MQGN---YKALWLNDDLF-DECLEVIDQRLLPFIYDTRHLTT
B9XAE7_PEDPL      ----------------MNVTVRGRTNHYRTVAFDTA-KNSVLLIEQRLLPHQFEVIGTRD
M4YU26_THEXX      ------------------MKARMENGETKDIKAVWFEDGKCRMIDQRELPLKLVIVDFDD
M1Z5A0_9FIRM      --------------MNRLLKLTQQWKADNLLMPIWVEENHLCMIDQRKLPHKTEILEITQ
MTNA_CHLTE        -----------------------------MIDAISFKNGTFRYLDQRFLPLQEIHVETKN
MTNA_SYNP6        ---------------------------MSPFQSLLWTGSQLRLLDQRSLPQETQYRYYDT
MTNA_SYNS9        ---------------------------MTLPRSLRWTGDHLDLLDQRCLPHTVVYRQLTH
MTNA2_PSELT       ---------------------------MSTFRSIEWKKDKLVLLDQRYLPEKTLYLELKT
MTNA_HUNT2        ------------------------------MKPLEYCNGVLKLLDQTLLPGEQKIVELKN
MTNA_DEHM1        ------------------------------MKAIEWRDNRLIILDQTLLPLEEKYLELND
MTNA_BACSU        -----------------------MTHSFAVPRSVEWKETAITILNQQKLPDETEYLELTT
MTNA_BACCN        -----------------------MNTTVAVPRAIIWKGDSITILNQTKLPHVAEYKTLTS
MTNA_EXIS2        --------------------------MSQFVQSIIYENRTVTILDQTRLPEEEHYEIIHD
MTNA_HELMI        ------------------------------MDTMRWQDDHLLLLDQTKLPLTEEYIECWD
MTNA_CARHZ        ------------------------------MDTMYWKDNTLFLLDQTKLPIEVKYVKLKT
MTNA_DESAP        ----------------------------MPVEALYWKDGRLYVLDQTRLPEETVYVTCSS
MTNA_DESHY        ------------------------------MKALEWMGDSLKILDQTRLPVEIKYRMAAT
MTNA_SYNWW        -----------------------------MIRNLYYEEQALMILNQNCLPEELVYERCER
MTNA_DESAG        ---------------------------METHIRYSRQDRTLILLDQRVLPTVEEDFYCND
MTNA_DESVH        ---------------------------MERHIRYDAASRSLILLDQRYLPTREEDFVCRN
MTNA_PELCD        ----------------------------MSIKPIEYRDGVVRMIDQRLLPTQELWLEYRD
MTNA_SOLUE        -----------------------------MVETIEWTPGGVVMIDQTRLPLHEEYVTCRN
MTNA_SYNAS        --------------------------MSASFTTIAWRNDAVLLLDQQALPGEERYLTCTR
MTNA_SYNFM        -------------------------MPQQWLPPIYWDGDAVAILDQRLLPQREAVIRCTS
MTNA_RHOFT        --------------------MNRQDHGPAAVQTLRWREGRLEMIDQRVLPARFEYLPFTS
MTNA_MAGMM        -------------------------MSIFDVAVWDEAEHCARMLDQRRLPNEVVNLYYRS
MTNA_ANADF        -----------------------MNPQPLRPVIYDEGRDVVRVLDQRRLPSEEVWLDLAS
MTNA_SORC5        ----------------------------------------MFLLEQRELPERERYLTLTD
MTNA_CHLAA        ----------------------------MELRTVWWENDAVCLIDQRKLPHTMEVVRCTD
MTNA_HERA2        --------------------------MADVLKTVWWD-EVPCLIDQRLLPATLDIVRCED
MTNA_ROSS1        --------------------------MSSAFRTVWWEAGQVCLIDQRLLPNETRIVRCAA
MTNA_SYNY3        ---------------------MTQSTNFDDVYPVQWRDDQVILIDQTRLPLEYKEVAIAD
MTNA_CROS5        ---------------------------MNTIYPVIWSNNKVLLIDQTSLPSRYTLVEISR
MTNA_GLOVI        ---------------------MTFSAVQSEIRPVQWNGHTCVLIDQTVLPGIYRTIEIRT
MTNA_PYRHO        -----------------MEIRYTPKELTKLPRTVEYKNKSVYMINQRLLPKEFKVEKFSK
MTNA_THET8        -------------------------MDRVLPFRFAEEEGVFWLLDQRRLPQEEVYVPVRT
MTNA_HAHCH        -------------------MSQSS------VSAIRWANNQLILLDQRKLPLQEAYVNCVT
MTNA_MARHV        -------------------MAGRSSNRSIGTVAMRWHGDRLELLDQRLLPAEEHWIVADG
MTNA_HALHL        ----------------------MNTASHDTVRALEWRDEGLYLLDQRLLPDQEQYLCCAD
MTNA_NITOC        -----------------------MSAEHDQIRAVAWTGAGVRLLDQRRLPQEEIYWTIAC
MTNA_XYLFA        ----------------MHHPLPPDDTLYDQVRPILWTGHFLKLLDQRKLPFVVEYVECHS
MTNA_METCA        ---------------MSDHSF----SAVSAVQALKWSDGGLEVLDQRLLPGDVVYQIFDT
MTNA_PSEE4        --------------------MREQLMAAETVTGIEWHDGALHLLDQRLLPLEQCWLTCTD
MTNA_ALCBS        --------------------------MAVNSAAIRWLGDHLQLLDQRCLPTETLWLDICD
MTNA_SERP5        --------------------MQALNT-----TSLTLSDNRLLILDQQALPQEKQWRSCDS
MTNA_YERE8        --------------------MQTLNTLDLQTTSLKIVDGKLWILDQQTLPQRQEWLSADT
MTNA_KLEP7        --------------------MQTLQT-----TSLRVSENQLFILDQQALPQETRWLAADN
E3IVW2_FRAIE      -----MSVPRPGGPSATRRSRAADRTAPAL-RPVAWAGGSIRLLDQTLLPDRLADLEIHR
F8B5D9_FRADG      -------------------------MTPVG-RPVSWTGNGIRLLDQTTLPARVVHHEVTD
MTNAB_NOCFA       -------------------------MRPIDDSSLTWDDGALVTVDQRGLPHEARPLRLRT
M3C5J9_STRMB      ---------------------------------------MIVLLDQRRLPAEEVELVCTD
E2Q5D5_STRC2      ----------MADQYARDGVDDSPRMLPVLRWEEPPDGAVVVLLDQTRLPADEVELVCTD
MTNA_RHOBA        ---------------------MNEAETIRYHAAHNGRPAELDLLDQTKLPGTLTRLVCTT
MTNA_LEPIC        -------------------------MQESGLKPILWKNKELILLDQRVLPGTTSYITAKT
MTNA_LEPBP        -------------------------MSQPEFLPIQWKSTFLSLLDQRVLPGKKEFLQIQT
MTNA_UNCRE        --------------------MASALEAIKYDRG------RLFIIDQLQLPHVTKFIPIDS
MTNA_ARTOC        ----------------------MSLQSIRYKRG------MLQVLDQLQVPHVERYIPVST
MTNA_YARLI        ----------------------MSLEAIRYDEKN----HTLTILDQLRLPHESEYVPINN
MTNA_VERA1        ---------------------MSTLQAVKYSRG------NLEVLDQLRLPHEFHYDNVST
MTNA_SCHPO        ----------------------MSLQAIIYNED------KLLVLDQLLLPYERKYISVSN
MTNA_SCHJY        ----------------------MSLQAIVYEDN------KLSVLDQLLLPHEHKYIPIKS
MTNA_ASHGO        ----------------------MSLQAIQFQRGD-KSQVSVRVLDQLLLPYVSRYIPIQT
MTNA_CANGA        ---------------------MNALRAIDFKRDD-PNNVSVSVLDQLLLPYTTKYIPIYT
MTNA_KLULA        ----------------------MSLKAIVFDRV--LGKCSVKILDQLLLPYQTQYLTINT
MTNA_PICST        -----------------MASTAKTLQAIKFDKE----NISLQILDQLLLPYTTHYLDIKT
MTNA_PICGU        ---------------------MTTLEAIKFDRT----NVTLQILDQLLIPYSTEYLNIEG
MTNA_KOMPG        ----------------------MSLQAIKFDRQ----KTRLDILDQLLIPYQTKYIQVSN
MTNA_THAPS        -----------------MTDPANTLRSLIFDVDSATNKATLSVLDQLRLPDETMYTKIVN
MTNA_CAEEL        MTSKINKIVNGPIPDSFLFDESKRLDSLKFDGT------NLEVLDQLLLPHEFKYIPVEG
MTNA_CAEBR        MAPKINKIVNGPIPDSFLADETKRLDSLKFDGQ------RLEVLDQLLLPHEFKYIPVND
                                                             .:   .*          

MTNA_POSPM        IEQAHDAIKSMKIRGAPAIASLAALTIASHLSRALQA----DPSPDFLTSPLTLQEHVEG
MTNA_CRYNJ        PEEAFDAIKTMRIRGAPAIASLAALTLRSYLSSSSSP----VSSS---SSSSDVISWVGQ
MTNA_ANOGA        VKDGWSAIHKMQVRGAPAIAIVGCLSLVVEIY-----------DKQY-ETKAALANEIGE
MTNA_DROGR        VEDGWKVINKMQVRGAPAIAIVGCLSLAVEIY-----------PEEF-ETKKSLRQEIEG
MTNA_HUMAN        VHQAWEAIRAMKVRGAPAIALVGCLSLAVELQ-----------AGAGGPGLAALVAFVRD
MTNA_XENTR        VQQGADAIRTMKVRGAPAIAIVGVLSLAVELT-----------SRTC-QDVPSFIAFVQE
MTNA_NEMVE        TEDGWKAIREMKVRGAPAIAIVGALSLAAEIY-----------SKPF-ASSEELAEFVKQ
MTNA_TRIAD        IEDGWQAIRQMKVRGAPAIAIVGMLSLAVELR-----------SKSF-TEMNEFDKFIRD
MTNA_MONBE        IQDGWDAIREMRVRGAPAIAIVAALTIAVVMK-----------RSTF-ATAAELAAFVRT
MTNA_NAEGR        TEKAFHAIRDMKVRGAPAIAIVAVLTLAVEANQLL------QSNDALLADASAIAKLFNE
MTNA_ORYSJ        SGDGWNAIRDMVVRGAPAIAIAAALALAVEVS----------GLEDFTGTPAEAAVFVSE
MTNA_OSTLU        CNACWRCIKDMNVRGAPAIAIAAALALAVELE----------AKRGTLTTCEAAEAFVRE
MTNA2_TRYCC       VDDIWTAIKEMRVRGAPAIAVSAALAIAVAAGNEL------KKKDGACNSVDGTRRFLLE
MTNA_CALS8        YQDVYIAIKDMIIRGAPLIGIVAAYGVVLGFK---------EIIEK--N-MDSAK--IYE
MTNA_SULSY        LADYEKAIKDMIVRGAPLIGIVGAYGFYTGIK---------E------G-IDYIQ--VYE
MTNA_CALS4        YQDVDFAIKDMVVRGAPAIGAAAAYGVVLAAQ---------QFMKE--E-KENFLKNMEN
MTNA_NATTJ        YQDVHFAIKEMVCRGAPLIGAVGAYGVALACR---------EFINE--S-QEKFQQETKR
MTNA_METJA        YEDVAYAIKDMVVRGAPAIGVSAAYGLALAEI---------NGDD------------IYK
MTNA_METST        YTDVIDGIKTMKVRGAPAIGVSAAYGMALGEL---------AGED------------MDV
MTNA_AERPE        YRRVARAIVDMEIRGAPAIGVAAAYALALAAA---------EAASR--G-GEGFIEALSE
MTNA_ARCFU        VEELADAIKKLAVRGAPALEAAGAYGIALAAR---------EREFA--D-VDELKEHLKK
MTNA_METAC        LSSLCEAIKSLRIRGAPALGAAGGFGIALAAS---------LSGAK--D-LESMTRDLKV
MTNA_SULAC        VEEVSDAIRTMKVRGAPAIGITAGYGMVLAIQ---------DSIS-----LEKAISDLTK
A8MBP9_CALMQ      PQDVADAIRSMKVRGAPAIGITAAYGMLLSLL---------SSMSKVSD-LNDALRVLEN
MTNA_METPB        LDDAAVAIRTMVVRGAPLIGVTAAYGLALAMR---------EDASE---------AGIER
MTNA_RHORT        LGAVAHAIRAMLVRGAPLIGATAAYGVALGMA---------EDPSD---------EGLTR
MTNA_SINMW        IADIAVAIRDMWVRGAPLIGVTAAYGVAIAMA---------EDPSD---------THLDS
M9RDG3_9RHOB      LQDFADAIIQMRVRGAPLIGATAAYGMALAMF---------IDPSD---------AHMAQ
MTNA_GLUOX        VGAVADAITSMQVRGAPLIGAVAAYGLVFALQ---------DDASD---------EALEK
MTNA_DESOH        VDQVIEAIGEMMVRGAPLIGVTGAFGVFIAVQ---------NALER-----GDFEAQVRK
MTNA_DESAL        VKKTIQAIRDMYVRGAPLIGATGAWGVYLAVV---------NMKDA-----ENPLQYLKE
E4U607_OCEP5      SDAMARAIKEMHLRGAGLIGAAAGWGMYLAAL---------EAPQAS---MEAFLGYLQA
K9Z7E6_CYAAP      LEDVCDAIASMHVRGAGVIGASGAYGMYIASL---------EAKRNN---ISDIQSFLIN
F5Y6P1_TREAZ      VEDIRRAIKDMYIRGAGLIGAAAAYGMYLAAL---------EADE------SNFDQQLQA
MTNA_DECAR        LEEAAHAIRAMQVRGAPLIGATAAYGLAIALD---------FEASD---------RRLAE
MTNA_SULDN        TEEVVTAIKNMTVRGAGVIGSVAAFGIYIAAM---------EVEGD--------YELLKE
B9XAE7_PEDPL      FKETAKAITDMIVRGAGAIGATAAYGLAQGAR---------AFRGKD---LKKFERHVEI
M4YU26_THEXX      YKAVAEAIRNMTTRGAPSIGASAAYAMCLAAI---------QKAD------------IDE
M1Z5A0_9FIRM      VDQLAKGIKDMAIRGSGAIGIAGVYGMLLASR---------ISGGK--------KEDVIL
MTNA_CHLTE        HQEAIEAIKTLAVRGAPLIGASAGYTVVLGIN---------EYTGDK----AGFPEYFKN
MTNA_SYNP6        AAGVAQAIQDMVVRGAPAIGVAAAFGLVLTSQ---------QSAMTD---SADLRAQLAI
MTNA_SYNS9        WREVSEAIRSMAVRGAPAIGVAAAWGVVLA---------------------AKAGDDLDQ
MTNA2_PSELT       VDEVARAIKEMTVRGAPAIGVAAAYGMVLCVQ---------KLS--K---NDDLIRELQK
MTNA_HUNT2        YIEVADAIKNMIVRGAPAIGVTAAYGVAIASK---------AINTDSKE---EFFAELAK
MTNA_DEHM1        YHAVAEAIKTLRVRGAPSIGVAAAYGIALGAL---------GIETQYCS---EFLPLYQQ
MTNA_BACSU        KEDVFDAIVTLKVRGAPAIGITAAFGLALAAK---------DIETDNVT---EFRRRLED
MTNA_BACCN        IEDVWKSIVMLEVRGAPAIGIAAAFGLALAAQ---------KYEAINIV---EFKTKFNR
MTNA_EXIS2        LAQAIDAIKQLRVRGAPAISLFGGFVLVQEAF---------R-TTGTLA---EAKQELLE
MTNA_HELMI        HVILCDAIKKLKVRGAPAIGAAAAFGVALAAL---------NYTGEDRA---EFEADVKK
MTNA_CARHZ        YEEVAEAIVSMKVRGAPAIGAAAAYGMVLGVM---------GYRNDQ-----NLEVYLKN
MTNA_DESAP        YRDAAEAIKTMRVRGAPAIGAVGAFGLVLGAL---------ETGGDR-E---SFLARLRE
MTNA_DESHY        YEEVAEAIEKMEVRGAPAIGAAAAYGYALGAI---------GYSGEL-A---GLSAHMEK
MTNA_SYNWW        PEEVVAAIKGLKVRGAPLIGVTAAFGLAMAFS---------GYSGTG-E---ARDVYFSR
MTNA_DESAG        VADTIYALQTMVVRGAPAIGVTAAYGCCLAA-----------YEAGHPAPHAQWQKELDT
MTNA_DESVH        TDDIVTALQVMVVRGAPAIGVTAAWGCVLAA-----------YETAESG-METWRPVLDG
MTNA_PELCD        YQAVAEAILTMVVRGAPAIGVAAAYGAALGA-----------RDIEADS-FESFLAALKN
MTNA_SOLUE        YEEVATAIRDMIIRGAPAIGVAAAMGVAIGV-----------QHAGDGD----LDGQVDL
MTNA_SYNAS        FEEVLTAIRDLTVRGAPAIGVASAMGIALGA-----------LSLPDDS-PEAFCNGFEA
MTNA_SYNFM        PKQVVAAIKNMAIRGAPAVGVAGAMALALGA-----------VLIQAAD-ARTFKSKFAR
MTNA_RHOFT        AAEVAEGIRSMVVRGAPAIGCAAAYGVALES-----------VQL-RGATREAFAVGLQR
MTNA_MAGMM        AAEMADGIRDMVVRGAPAIGCACAYGVAVEA-----------KRLAKQGIPSHWPTAMAE
MTNA_ANADF        CDEVVQAIKDLTVRGAPAIGVAAAYGLALES-----------RRG-------AEPARLRE
MTNA_SORC5        SAGVAEAIRTMAVRGAPAIGIAAAYGMALAA-----------RAARDEG-ASSYVAAMRA
MTNA_CHLAA        LAAVAYAIRSMQVRGAPAIGCTAAYGMALVA------------QQSVALTPSALLTELVQ
MTNA_HERA2        LNSVIEAIRSMQVRGAPAIGITAAYGMALAA------------QRSTAQTSSKLLEKLAK
MTNA_ROSS1        VEDVAYAIRTMQIRGAPAIGCAAAYGMALAAC---------SAAHDAVGDVARIYARLAE
MTNA_SYNY3        YEAMGHAIKSMVVRGAPAIGVAAAYGMYLGA------------RRIQTTELREFVVQLEF
MTNA_CROS5        YEDMAKAIKTMIVRGAPAIGVAAAYGMYLGA------------RDIQTQDRETFLKHLDK
MTNA_GLOVI        SDQMATAIRTMIVRGAPAIGVAAAFGMVLGW------------QEAPQGDP---ITHLER
MTNA_PYRHO        VEEVAEAIKNMTVRGAPAIGAAAGFGLALYAE---------TSKAKTKE---EFLDGFEK
MTNA_THET8        AREMAQAIRDMVVRGAPAIGVSAAFGMVLAHL---------AG------------EDLEE
MTNA_HAHCH        HVEVADAIRQMVVRGAPAIGIAAAYGVALAAA---------E---FG-S--D--RDRLHR
MTNA_MARHV        ASAVAQCITDMVVRGAPAIGISAAYGVALAAR---------H---AG-G--GDWQAEIKQ
MTNA_HALHL        AASVAQAITDMVVRGAPAIGVAAGYGAALAGA---------AAWRTH-G--SGWQAGMAE
MTNA_NITOC        VSDVAQAITKMVVRGAPAIGIAAAYGVVLAAR---------ARFSEA-G--SGWKQLLEA
MTNA_XYLFA        SEDVTQAIRALIVRGAPAIGIVAGWGAVLAAR---------EIEAVD-G--IEALRKLEP
MTNA_METCA        AAGVAEAIASMRVRGAPAIGIAAAYGVVLGAR---------AAYARD-P--AHWKRAVED
MTNA_PSEE4        VAQVAEAISEMVVRGAPAIGISAAYGLVLALR---------QRLAE--G--EGWEESLEE
MTNA_ALCBS        SQQAADAIRNMVVRGAPAIGITAAYGLALEAQ---------I---MG-N--DASWVTLQN
MTNA_SERP5        VEELVDHILTLRVRGAPLIGLSASLLLALLAE---------RGVPRK---------ELEQ
MTNA_YERE8        VELLIEHIQALRVRGAPLIGLSASLLLALLAE---------RGLPQA---------QLEQ
MTNA_KLEP7        VALLVDHIHTLRVRGAPLIGLSASLLLALLAQ---------RGLNRD---------ALQQ
E3IVW2_FRAIE      VDDLIAAIRRLAVRGAPALGIAGAYGVALAIV---------QAAREG-----WDGSTFTA
F8B5D9_FRADG      VDALVAAVRRLAVRGAPALGAAGAFGVALAAA---------QAEREN-----WDAATLTR
MTNAB_NOCFA       ADQIIDAIKTLAIRGAPAIGIAGAFAVVLATR---------AHTRDGI----VDVAAVRA
M3C5J9_STRMB      VPALVDAIQTLAVRGAPLLGVAGAYGVALAAV---------RG------------FDVEE
E2Q5D5_STRC2      VPALVRAIQSLAVRGAPLLGITGAYGVALAAA---------RG------------YDVEE
MTNA_RHOBA        IDQTHDAIQRLVVRGAPAIGIAAAYGVTLTPV---------DAESNSSL--PEAQARYRQ
MTNA_LEPIC        LEDCIFAIREMVVRGAPAIAITGAFGITLYWN---------SLVSKP------SFSELKL
MTNA_LEPBP        MEETIVAIREMAVRGAPAIAITGIFGITLGAK---------KKSGNS------NPVDVDS
MTNA_UNCRE        SEAGWHAIKAMQVRGAPAIAIVAVLSLAVEMLNLVSENMIPEDGEDVRAYIE-------Q
MTNA_ARTOC        AKEGWHVIKEMHVRGAPAIAIVAVLSLSIELTELMDHEKLSTEADEVEAYIL-------E
MTNA_YARLI        SDDGWKAIKDMVVRGAPAIAIVAILSLAVELVHGGKVSRDQTRAE-VGSFIS-------D
MTNA_VERA1        SEEAFDCIRSMRVRGAPAIAIVASLAHAVELHNGSCR---ATSSEEVISYIH-------G
MTNA_SCHPO        VEDAFAVIKKMQVRGAPAIAIVAALSVAVGLKHLSEDA-------DAKEYVI-------N
MTNA_SCHJY        VEDAYSVIKNMQVRGAPAIAIVAALAVAVSLVNVKTD--------DLRNYVI-------E
MTNA_ASHGO        VDDGFAVIRSMQVRGAPAIAIVGVLSVLVECQLLCNEDFVAVQAFYDLSSYAAFGRTMRM
MTNA_CANGA        IDDGFTVIKKMQVRGAPAIAIVGALSVLMESQLLLSEGFCKTQYYYNLNDWENIRSKIDE
MTNA_KLULA        IDDGYRSIKSMQVRGAPAIAIVGVLSTLMECQLLLQESFVKTQSFYDLTQLEKI---LNE
MTNA_PICST        IEDAFSAIRLMQVRGAPAIAIVGAFAVVVDTNAS-----LKNGGNKTVSKLF-------D
MTNA_PICGU        VDDAYDAIKSMQVRGAPAIAIVGSFAIVVE---------IKNRHISSIDELA-------A
MTNA_KOMPG        IDDGYSVIQKMQVRGAPAIAIVGSFSITCELNSVKDG--QKNNHGYDVSDLSVFKAALEK
MTNA_THAPS        VQDAWDAIRSMRIRGAPLIAVVAVLGLAVDLSSNE----LTIGELDLISGIDEVKAFVTT
MTNA_CAEEL        VSDAFAVIKSMQVRGAPLIAVVGSLGLLLEIQKAS---------ELDSESII-------Q
MTNA_CAEBR        VSDAFNVIKSMQVRGAPLIAVVGSLGLLLEFNKNS---------ELNIETIR-------E
                         :  :  **:  :                                         

MTNA_POSPM        HLSYINTARPTAVNLGAATRRLSNILEQSVRAGKD---------------ARAIAEDLIR
MTNA_CRYNJ        TIDYLQSSRPTAVNLGEAMDRIRAALKDSEAQNQT---------------AGDIIQRVKK
MTNA_ANOGA        HLQYLVTSRPTAVNLKLAADDVKGQVESLLAN--------------ETVTVDGMKQEVIK
MTNA_DROGR        KLNYLVSARPTAVNMKISADELITLANELSKN--------------DDVTVANMKQRFLD
MTNA_HUMAN        KLSFLVTARPTAVNMARAARDLADVAAREAER--------------EGATEEAVRERVIC
MTNA_XENTR        SLCHLVDARPTAVNMKKAADELNAFLAKEAEK--------------AGATTQGLAESVIQ
MTNA_NEMVE        KLQYLNTARPTAVNMTNAVIELTAFVADLTKC--------------SPKD---MKQKLLS
MTNA_TRIAD        SLEHLKTARPTAVNIFLACDLITKLIDNLIIL--------------GDEAVGVAKIEVIR
MTNA_MONBE        SLEHLRTSRPTAVNLFEMAGRLEALLQEQP----------------ADCTEAALRQAVLS
MTNA_NAEGR        KLDRLAESRPTAVNLFQAVGDFKNKIAQSLE---------------TNKTGTEIVQLIID
MTNA_ORYSJ        KLEYLVSSRPTAVNLSDAATKLRSLVSRTAE---------------TEKDAKAIFQAYID
MTNA_OSTLU        RFDHMYTSRPTAVNLGEAKNRIQALAKRLSE----------------SGDVSGMIEGVIE
MTNA2_TRYCC       SCDTVMTARPTAVNLSKTLIQLKRDIADVTA-----------------NTAGGLVEACAV
MTNA_CALS8        ILNYLANSRPTAVNLFWALERMKKVFEEARNLSKS-----------------QIYSLLMQ
MTNA_SULSY        RLK---QTRPTAVNLFWALDRMKSIYEKYGND----------------------LNLLLK
MTNA_CALS4        ALNVLSKSRPTAVNLTWAIGRMRGVLEKVKDLSVS-----------------DIYEALKE
MTNA_NATTJ        AISELSSARPTAVNLFWALNKMNKLLGQVMEENTAP---------------EDIYPIILN
MTNA_METJA        AYEVLKNTRPTAVNLFWALDRCLTAYKEG--------------------------KSILD
MTNA_METST        IGDEIKSARPTAVNLFWAVDKVLDLVSRG--------------------------KSAVD
MTNA_AERPE        ARREIESTRPTAYNLFWATARVYGAVSEAFRRS----------------GVDAAVRAGLE
MTNA_ARCFU        AADFLASTRPTAVNLFVGIERALNAALKGE-------------------SVEEVKELALR
MTNA_METAC        AAKALKSTRSTAVNLGWGVDRVLNAISDAF-------------------DVQGARDIALQ
MTNA_SULAC        AKKILDESRPTAVNLMWATSRMLNKAKDLVEQGNAK-------------SVKELKELLEI
A8MBP9_CALMQ      AKRIMDAARPTAVNLPWATGRMLNKAKSSISNGSVR-------------SVKELVDALKA
MTNA_METPB        AAATLAATRPTAINLRWALDRMAAVLRRAPEAER--------------------AALAFT
MTNA_RHORT        ACQTLLATRPTAVNLRWAIEAMAESLAAVPPDQR--------------------AQAAWA
MTNA_SINMW        VWEELHETRPTAINLRWALNAMREHLRALPEQER--------------------AEAAYQ
M9RDG3_9RHOB      AWEFLHNTRPTAINLRWALNRCQTALLPLPVADR--------------------AGAALA
MTNA_GLUOX        AAAFLVATRPTAINLRWAIERMVARLKAVRPTER--------------------VAAGYV
MTNA_DESOH        ECLRIKEARPTAVNLAWGVDRVCAAVFS-KTLPAD------------------CLAAALA
MTNA_DESAL        ECFKISNARPTAVNLEWAVKAMEAAILE-KSNVED------------------WIKAAWS
E4U607_OCEP5      AGEKLKKTRPTAVNLEWAVDRQLREITGRARTPAE------------------GVRVAHD
K9Z7E6_CYAAP      ASEKLKATRPTAVNLSWAVNRQLEAIIPLKDDIEA------------------IITKTLQ
F5Y6P1_TREAZ      SAEVLKKTRPTASNLARAVDIMLAKLLRSNADLLQ------------------KRENARL
MTNA_DECAR        AVALLGATRPTAVNLHWALARMENILRPLAPEAR--------------------CDAAWA
MTNA_SULDN        KALLIRESRPTAINLMWAVDKMMELLSASANLIE----------------------DARS
B9XAE7_PEDPL      VYHTLKSARPTAVDPVNAMNDVRATMNSGETVEEQ-------------------QALALA
M4YU26_THEXX      AAKHVKAARPTAFDLFYATDWMVKKLKAGADPVE--------------------------
M1Z5A0_9FIRM      AGKKLKSTRPTAVNLSKTVDNLSKFAESCSEDRF--------------------YEEFME
MTNA_CHLTE        LIAEVNASRPTAVNLFFATKKMQEVYDANFENDS----------------LEALFAKMTD
MTNA_SYNP6        AAETLKAARPTAVNLAWAVDRMLAAIANPD------------------LEAAAIHATLLA
MTNA_SYNS9        AIEGLRASRPTAVNLSWALNRMQTSAKSNG------------------WVDVHQLERLAS
MTNA2_PSELT       ADDLLRASRPTAVNLFWALDRMKKIWQGFN------------------GSLEDLKMILEK
MTNA_HUNT2        VCDIIKSTRPTAVNLFWAVDRVYSRAVSNRD-----------------KTIEEIKKLIEE
MTNA_DEHM1        VSAEIASTRPTAKNLFMAAERMDHVVASGTD-------------------VSQVKISLVE
MTNA_BACSU        IKQYLNSSRPTAINLSWALERLSHSVENA-------------------ISVNEAKTNLVH
MTNA_BACCN        DCNYLGTSRPTAVNLFWAIDRMRAAIEEV-------------------STIKIAREILEE
MTNA_EXIS2        VSAQLLATRPTAVNLRNVLDELNQLIVSA-------------------TTLKELPVRLEQ
MTNA_HELMI        AIADLGKTRPTAVNLFWALRRMEAVLEDIRT-----------------YSVKEQQERLIA
MTNA_CARHZ        VYETLKNTRPTAVNLFWALDRMWKKYLEVKN-----------------QTFEEIANALLN
MTNA_DESAP        IAGVLRDTRPTAVNLDWALERMLARAVETLG------------------EPGALRAALLA
MTNA_DESHY        VQHRLAETRPTAVNLFWALRRMEDRLRDQHEA----------------KELAEIRQALVA
MTNA_SYNWW        MKELFAATRPTAVNLFWALERMERVYRENHH-----------------LSPEELARRLCQ
MTNA_DESAG        LLEKLAQARPTAVNLRWAVERMRSVWKSMG-----------------DPDLNTLIARWLD
MTNA_DESVH        LIERIANARPTAVNLRWAVERMRAAWHSLG-----------------RADLATLITYWTN
MTNA_PELCD        VCDTLAATRPTAVNLFWALERMQAKARELA-----------------ALPLDAIKAALMD
MTNA_SOLUE        ICETLAKTRPTAVNLFWAIDRMKRLYGSMR-----------------GRPLEEIRSRLIA
MTNA_SYNAS        LCDRFAQARPTARNLFWAVERMKRCFGEHFHPDTSSECSSAAPGKEIARTLAAVRKALVA
MTNA_SYNFM        LCRQVRTARPTGRNLGWAVDRIHALVEGNR-----------------DADVPRLHELIRR
MTNA_RHOFT        GFDVLAASRPTAVNLFWALARMRAVWDANQ-----------------HRAVGDIVDCLLA
MTNA_MAGMM        GMATLRQSRPTAVNLTWALERMAPLLETTP-----------------PH---EVPQRLLQ
MTNA_ANADF        ASERLVHARPTAVNLAWAVRRMSRRLGLGP-----------------AA--------LLE
MTNA_SORC5        AGEHLASTRPTAVNLGWAVRRAIAAALQNA-----------------GRRGEERARELAE
MTNA_CHLAA        AKATLDSQRPTAVNLAWATSRMLRRAEAVA-----------------SEGVEAIKHALHA
MTNA_HERA2        AKALLDATRPTAINLAWATQRMLDVAQANH-----------------TLEVDQLRQRLLA
MTNA_ROSS1        AKALLDAQRPTAVNLSWATRRVLERAQSLN-----------------DPSPHDVAQRVLE
MTNA_SYNY3        VADQLRQTRPTAVNLFWAIDQMLNVAYHSG------------------ENVEQIKANLLS
MTNA_CROS5        IAQILRQTRPTAVNLFWAISRMLKTAYETL------------------GTVEEIKKILLE
MTNA_GLOVI        VAATLRATRPTAVNLFWAIDRMLTVARR-----------------------DPSFARLER
MTNA_PYRHO        AYEILKNTRPTAVNLFWALNRIKKLVEEHSEDP-----------------LDEIKRLIVQ
MTNA_THET8        ADRRLRASRPTAVNLFHALDRMRPFWGDLAGS--------------------------LL
MTNA_HAHCH        ALETLADSRPTAVNLFWALRRMRGLIDGA-SV-------------------ADLFPLLVE
MTNA_MARHV        AIRVLAKSRPTAVNLFWALERMEKVFHACHSL-------------------DEATDRLAA
MTNA_HALHL        DIDTLRRSRPTAVNLGWALRRMEAFAARLPED-------------------QDPAPALLA
MTNA_NITOC        DLCDLEAARPTAINLAWALARMQAIIQGLPDH-------------------RDPESALLV
MTNA_XYLFA        ALQRLHAARPTAVNLAWVLARMRRTLSAAHA---------------------DWRQAMAR
MTNA_METCA        DIAVLARSRPTAVNLFWALERMREAMAAIEG---------------------DPVPALLA
MTNA_PSEE4        DFLMLGEARPTPANLFWALNRMRERLQRLRPG-------------------DDVLAVMEA
MTNA_ALCBS        AVATLADSRPTAVNLFWALERLQRYAGDLQG--------------------KALAQALAE
MTNA_SERP5        ALITLRASRPTAVNLMNNLDRMKLALAQPQW-----------------------VPAMVE
MTNA_YERE8        ALIALRESRPTAVNLMNNLARMQQALLHANW-----------------------VAAMTH
MTNA_KLEP7        ALETLRAARPTAVNLMNNLDRMKQALAREDY-----------------------PQALEA
E3IVW2_FRAIE      AVGRLRAARPTAVALAQGVDAAYARIDDGL-------------------------DAVVA
F8B5D9_FRADG      AIGAIRDARPTALALALGVDAARQRLAHGI-------------------------SAVLA
MTNAB_NOCFA       EADRIAAARPTAVNLAWAVDRVRPRIAEGA-------------------------DAVLA
M3C5J9_STRMB      AAEMLARARPTAVNLAYGVARVRDAHRAAVRKGGGDG--------------RAAAAAALA
E2Q5D5_STRC2      SAGLLERARPTAVNLGYGVRRALDAYRAAAGRGE-----------------AEAAAAALM
MTNA_RHOBA        TIDYLATSRPTAVNLFWALDRMRAIVDDFSGPVA------------------ELRERLVT
MTNA_LEPIC        KLSELLESRPTAVNLRLAIEEFSSRFPESNYSSFS---------------LEEIQKGAEE
MTNA_LEPBP        LIKQVFESRPTAVNLSFALKEAKKRVEGVSH-------------------WDSIAKVWES
MTNA_UNCRE        KMDYLVSSRPTAVNLSDSAQKIKLLLDQRARK--------------SGLSGVETAMAFIQ
MTNA_ARTOC        KLDYLVTSRPTAVNLSDAAIKLKTLVQKRKQI--------------GDPKGKDLAEAYVE
MTNA_YARLI        RLDYLNTSRPTAVNLSDAVGSFKKLVQTQTG------------------SASELIEAFLS
MTNA_VERA1        RLDYLKESRPTAVDLTNAINQLKARTQELAGQ-----------------DRDAIIKAYIE
MTNA_SCHPO        SFEHLKQSRPTAVNLFETAKFMQGIALQ---------------------EGKNCRNKIIQ
MTNA_SCHJY        SFERLKQSRPTAVNLFQIAYKMRKLAEAY--------------------EGEEIRVVVVK
MTNA_ASHGO        RLAHLLGSRPTAVNLSHALRDVERLLD-------------------SATSLSQFRDRMYD
MTNA_CANGA        RLAFLLSSRPTAINLSNALDEIKIVLD-------------------SASDLQTFKNNLFD
MTNA_KLULA        RLDLLLSSRPTAVNLSNAITDLRKLI---------------------SNDIGKTYNSLFQ
MTNA_PICST        SIDYLETSRPTAVNLANALNDIKKLVSAKFGQ--------------NDLVDEDVYQIIYK
MTNA_PICGU        KIDYLESSRPTAVNLSNACNEIRALLG-------------------NSESLDEVYKRVFD
MTNA_KOMPG        RIDYLIKSRPTAVNLVNACTAIKAIVE-------------------TACTIDDLYAEVLR
MTNA_THAPS        KMEYLKTSRPTAVNLFNAMDELKSFIDDD-----------------AIKTREEVVSAIVQ
MTNA_CAEEL        KINFLISSRPTAVDLRNSLNGLKPILESQ------------------DYSDVVKLEKCRS
MTNA_CAEBR        KIEYLITSRPTAVDLRNSVTGLIPILETE------------------GITDDEKLAKCQE
                          *.*                                                 

MTNA_POSPM        EGKEIDEEDVGRNKQMSRHGAEWLLEQWAAKG--------------------LSGSNLNV
MTNA_CRYNJ        ICGDVHDEDLERNMKMGRLGAEWL---WKKRG--------------------GGKKGLKV
MTNA_ANOGA        AIEYMLEKDISDNRAIGDNGANVLVK--------------------------GVDRPLKL
MTNA_DROGR        ATEAMLEKDIADNRAIGSNGAKAILERVAEATGSP-----------------GSASPVRV
MTNA_HUMAN        CTEDMLEKDLRDNRSIGDLGARHLLERVA-----------------------PSGGKVTV
MTNA_XENTR        WAEALLKKDVEDNQMIGDFGAKHILETAG-----------------------PTE-KVCM
MTNA_NEMVE        KIEGMLSEDIAQNKAIGKFGAESILGAV------------------------GGP--VRM
MTNA_TRIAD        HIEEMLHKDVESNKRIGSYGAEAILAKV------------------------PSKEKINV
MTNA_MONBE        YIEGMMQADIADNQAIGKFGAEAILKDL------------------------SADVKVKV
MTNA_NAEGR        EAEALMNRDIEENAKISECGSDHIISTN------------------------PSSTTLKV
MTNA_ORYSJ        AAETMLVDDVSDNKAIGSHGAEFLKQKL------------------------EVSKDISV
MTNA_OSTLU        GCEAMHAEDVASCRAIGDKGAAALLRACGA----------------------KDGENIKV
MTNA2_TRYCC       LAEKIYAEDVACNEGIMRHGAAHLTQLVK-------------------------KSKVSV
MTNA_CALS8        EAKKIEDEDKSINKKIGEHGNTLIKEGA------------------------------NI
MTNA_SULSY        EAKRIEVEDYHANRSIGGYGEVLIPKKA------------------------------NI
MTNA_CALS4        EANKIYFEDLETNKKMAKIGNEVIKPNA------------------------------VI
MTNA_NATTJ        EAHKISDQELQRNYRIAEFGDQVISNGD------------------------------KI
MTNA_METJA        EAKKIHEEDIETCKKIGMIGEKLIEDGD------------------------------TI
MTNA_METST        VAIEMEKDDVAINKKIGEYGNSIIDDND------------------------------TI
MTNA_AERPE        EATRIYVEDVRGNVEIGRVGARLLESGD------------------------------TV
MTNA_ARCFU        EAEKLAEEDVERNRKMGEYGAELLEDGD------------------------------VV
MTNA_METAC        EARDIAEEDIATNKLIGKYGTKFLKDGD------------------------------SV
MTNA_SULAC        EANKIFEEEYEAELKIGLYGIEKVNDGD------------------------------TI
A8MBP9_CALMQ      EADAVFNEEYDAEIAMGIYGMEKLNNGD------------------------------SI
MTNA_METPB        EAASIAEEDVASCRAIGEHGARILAEIAVKKG-----------------------GPVNV
MTNA_RHORT        KAGAICDEDVALNEAIGDHGLGIIKDLARTKGVEKG-----------------GEGPINI
MTNA_SINMW        RAAEIAEEDIELNRAIGANGLKVIREIAARKK---------------------PGEPVKI
M9RDG3_9RHOB      LAHDIANEDVEINRQIGLNGLNLIQDIAAKKP---------------------SGEPVRL
MTNA_GLUOX        EADAICDEDVQVNEAIGRHGLELIREIWERKG---------------------KQGQVNL
MTNA_DESOH        EASAIAEEEVDNCRRIGVHGVGLIETISRQKG----------------------GKTVNV
MTNA_DESAL        KAIEITEAEVKNCRQIGVHGSPLIEEISKNKN----------------------GKTVNI
E4U607_OCEP5      TAQAIADEDAEFCRRIGEHGVKIIEEIYEKK-----------------------GDTVHI
K9Z7E6_CYAAP      IANTVADEDVDFCQNIGKHGVRLIEEISQRKQ----------------------GETVNI
F5Y6P1_TREAZ      EAQVIADSDADSCRNIGLHGLEAIKAISSKRN----------------------GEAVNI
MTNA_DECAR        EAAAIAEEDVAQNAAIGQHGLKLWNDLIVADG-----------------------QTLNI
MTNA_SULDN        FAIELNDAEALESQKIAEFGCEIIEEILKQKN----------------------KTRINI
B9XAE7_PEDPL      AAEEFANHDVQHCEEIGKHGAKLIRSG------------------------------MKV
M4YU26_THEXX      AADEYANITVDKCRRIGEFGGALIKDG------------------------------MKL
M1Z5A0_9FIRM      KACDVLEEQLNFEKELGRYGAEIINDGD------------------------------SI
MTNA_CHLTE        MAYKIHNDEIDNCDKIARHGVELLKQDFADVL---------------------KTRKLNV
MTNA_SYNP6        AAQQLYDEDVAVNRQIGLNAQALIP--------------------------QQAN----V
MTNA_SYNS9        AIEA---EDRALTQALVNHGVGVLP--------------------------EDCR----V
MTNA2_PSELT       EATDIEREDVEINKQIAKNGVELVP--------------------------FGAK----I
MTNA_HUNT2        EAYLMEKEDIESNRSIGRFGNELIK--------------------------ENWT----I
MTNA_DEHM1        EAVKIHHEEEEASRKISAFGAELIQ--------------------------PGWT----V
MTNA_BACSU        EAIQIQVEDEETCRLIGQNALQLFK--------------------------KGDR----I
MTNA_BACCN        EALQIQQEDEQVCRSLGEHALTCFQ--------------------------DGDR----I
MTNA_EXIS2        KALELYQTDAKTSRQIGVHALELFE--------------------------SGDR----V
MTNA_HELMI        EAKAVFDEDRAMNEQMGQYGLELIP--------------------------ESAG----I
MTNA_CARHZ        EANSIFYEDIELNKKIGAYGLEVVP--------------------------ENAS----I
MTNA_DESAP        EAQAIVREDIEANRRMGLFGRELIP--------------------------DPAR----I
MTNA_DESHY        EAESIAEDDRRVNRLIGEHGNAIVT--------------------------AEAN----I
MTNA_SYNWW        EAQNLYKEDIRVNEAIGEQGQELLG--------------------------EGSR----V
MTNA_DESAG        EAEAIHEEDKSINRAIGRHGATLIQ--------------------------DNDC----I
MTNA_DESVH        EAKRIHRDDIAINRRMGEHGAELID--------------------------DGDA----V
MTNA_PELCD        EAQAIAAQDDAINRAMGRHGAELIA--------------------------DNAR----V
MTNA_SOLUE        EAQIVREEDIAINRAIGRNGAALVP--------------------------DGKT----V
MTNA_SYNAS        EARRMAEEDVAINRRIGHYGQVLIR--------------------------DGYR----I
MTNA_SYNFM        EADLILAEDVAGNVAIGSWGKTVIP--------------------------RGAG----I
MTNA_RHOFT        QAHEISADDVRINRAMGAYGAALLA--------------------------DGAR----V
MTNA_MAGMM        EAHAIREEDIASCRAMGAHGAALLP--------------------------TNSQRPTVI
MTNA_ANADF        EAHAIRDEDEAACRRIGALGAALLP--------------------------PRAS----V
MTNA_SORC5        LAREIHREDVAACHQMGRAGAARLP--------------------------ESGT----V
MTNA_CHLAA        EAEAIFAEDLAMCHAIGEHGASLIP--------------------------PRGH----V
MTNA_HERA2        EAEAIRDQDEAMCRAIGQHGKVLLA--------------------------QSRN----V
MTNA_ROSS1        EAHAILAEDLAMCHAIGRHGVALIP--------------------------PRGH----V
MTNA_SYNY3        QAQQIQLDDLRTCQAIGAAGLEVLP--------------------------REPHQ-LTI
MTNA_CROS5        TAQKIQEEDLQTCQAIGHNSLSILP--------------------------TNPEK-LTI
MTNA_GLOVI        EATAILEGDIATCRAIGEHGLLALP--------------------------AAPER-LRL
MTNA_PYRHO        EAYKIADEDVEANLRMGHYGAEVLP---------------------------EGN----I
MTNA_THET8        EARRIWREVEETEAAISRHGAQVL----------------------------WGQ----V
MTNA_HAHCH        EATRIHEEDLQANLTMGELGADLIA--------------------------ESGRG--AL
MTNA_MARHV        EAVRLHEDDLAANLAMADYALEVMN--------------------------PDKPI--AV
MTNA_HALHL        EAQAIHEEDVAANRRMGRSGAGLIQ--------------------------PGSG----V
MTNA_NITOC        EARCIHEEDIAANRRMGELGTTLIE--------------------------GSVG----V
MTNA_XYLFA        EAESIAREDLTANRCMGAYGAALIP--------------------------IGSG----V
MTNA_METCA        AARRIHEDDLAANLAMGELGAAILG--------------------------GCKG----V
MTNA_PSEE4        EAIAIHESDREANLTMAQFGVEQIR--------------------------KHQGSEQAL
MTNA_ALCBS        DAEAIHREDLAANQAMGEFGADLLP--------------------------SGAT----V
MTNA_SERP5        EAQRLVEEDRKLCDRIADHGAGLVK------------------------------PGSRL
MTNA_YERE8        EALRLVEEDRELCERIAQHGVQLVK------------------------------PDSNL
MTNA_KLEP7        EALRLVEEDKQLCARIAEAGSALVK------------------------------PGSRL
E3IVW2_FRAIE      VGGALADADERANRAIGRHGADWIL-------------------------ARLGDRPLRV
F8B5D9_FRADG      YADDLLEQDERTNRAIGAHGADWLLRGAARPTGTTHSTHSTHSTHSGDTDSGIGRRPLRI
MTNAB_NOCFA       ETLDMLAEDGRVNRAAATHAADLVQ-------------------------RLCGPRPLRV
M3C5J9_STRMB      EARAVHREDAEASARMAEHGVALLE-------------------------ELLPGGGYRI
E2Q5D5_STRC2      AAKELHRQDAEASARMAAHGLAFLD-------------------------GLFPGGGHRV
MTNA_RHOBA        EAIRIHDDDRQMCRSIGCHGATLLA------------------------------DCKSV
MTNA_LEPIC        LALFMLSEDLENNLTLSKYALSLFP---------------------------KQPSSLNI
MTNA_LEPBP        YALEMMVQDLKANQTLGKNGADLFP---------------------------KNQNEFHI
MTNA_UNCRE        HAEQMLARDLADNHSIGEYGATWILKNTRAAL---------------------EGGNTCV
MTNA_ARTOC        AAEKMLIDDAMDNHRLGDFGATWIVNNTPVGK---------------------EGKKVGV
MTNA_YARLI        ASHKMLLDDVQDNKNIGKYGLEWIQKNVPQAA---------------------NGHKISA
MTNA_VERA1        EAENILEKDLKTNLSIGDHGADWLKDVAQAGP---------------------DG-KISV
MTNA_SCHPO        EAERMLVKDLEDNHNIGTAGRKFLLQHYKD------------------------KDKLTV
MTNA_SCHJY        EAEDLLARDLRDNHTIGELGSEYVLKLVN-------------------------KPRLTI
MTNA_ASHGO        YACELLDMDVANNVRMGDNGARFLLDALIAEG---------------------FDGSFAV
MTNA_CANGA        YVCKLIDDDFANNKRMGDNGAEFLLNLLKKEN---------------------FNEDFAV
MTNA_KLULA        YACDIIDHDYADNFTMGENGAKHLLAQLEKEA---------------------FEGDFGV
MTNA_PICST        YSVALYEDDLANNFKIGANGLNYIVETLKKDG---------------------FKGAFSI
MTNA_PICGU        FAVALYDDDLSNNHKIGSNGVDYLVESLRSQN---------------------FEGPFSI
MTNA_KOMPG        YSVVLFEDDLKNNYRIGANGVRYIDNEL--SN---------------------FEGPFAV
MTNA_THAPS        HAYLMLERDVSDNKAIGSHGADDLLSRHV------------------------HPEGVCV
MTNA_CAEEL        YLLNVYTDEKLQNRILVWNAYQELLSAFPD------------------------KEKLTV
MTNA_CAEBR        YLLNVYTAEKLQNRILLWNAYQELLTAFPG------------------------KEKFTV
                                     .                                        

MTNA_POSPM        MTVCNTGSLATSGYG-TALGLITHLHETGR--------------------LQRAFYTQST
MTNA_CRYNJ        MTVCNTGSLATSGYG-TAIGVITALFQEDH--------------------LDTAYYAQTT
MTNA_ANOGA        LTHCNTGSLATAGYG-TALGVIRSVNERNL--------------------LEHVYCTETR
MTNA_DROGR        LTHCNTGSLATAGYG-TALGVVRHLSELGK--------------------LEHVYCTETR
MTNA_HUMAN        LTHCNTGALATAGYG-TALGVIRSLHSLGR--------------------LEHAFCTETR
MTNA_XENTR        LTHCNTGSLATAGYG-TALGVVRSLHVLGR--------------------LSHVFCTETR
MTNA_NEMVE        LTHCNTGSLATAGYG-TGLGVIRSIHEMKQ--------------------LEHVYCTETR
MTNA_TRIAD        LTHCNTGSLATAGYG-TALGVIRSLYGRDS--------------------IDRVFCTETR
MTNA_MONBE        LTHCNTGSLATARYG-TALGVIRSLHEQQR--------------------LEHAFCTETR
MTNA_NAEGR        LTHCNTGALATMKYG-TALGVIRFLQKKNV--------------------LEHAFCTETR
MTNA_ORYSJ        LTHCNTGSLATAGYG-TALGVIRALHSGGI--------------------LEKAFCTETR
MTNA_OSTLU        MTCCNTGSLATAGYG-TALGVIRALWESGR--------------------LERAYCLETR
MTNA2_TRYCC       LTICNTGALATSRYG-TALGVVRQLFYEGK--------------------LEQVYACETR
MTNA_CALS8        LTHCNAGALATGGYG-TALGVIREAFFAGK--------------------NIHVYVDETR
MTNA_SULSY        LTHCNTGALATAGWG-TALGIIRSAFENDK--------------------DITVYVDETR
MTNA_CALS4        LTHCNTGALATVGYG-TALGVIREAHYSGK--------------------NIFVYADETR
MTNA_NATTJ        LTHCNTGALATTGYG-TALGVIRQAHYNHK--------------------DIFVYVDETR
MTNA_METJA        LTHCNAGALAT-SAYGTALSVIRFAFYNGK--------------------KIRVIADETR
MTNA_METST        LTHCNAGALAC-AGYGTALGVIRAAHEANK--------------------NIDVICDETR
MTNA_AERPE        LTHCNTGALAT-AGFGTALGVIRYAWMEGK--------------------DIRVITTETR
MTNA_ARCFU        LTYCNAGRLAT-VDWGTALGVVRSAVEQGK--------------------EIRVIACETR
MTNA_METAC        LTHCNAGRLAC-VDWGTALGVVRSAIEEGK--------------------EIKVIACETR
MTNA_SULAC        LTQCNAGGLATGTGLGTALAPAKLANALGI--------------------KVSVIAPETR
A8MBP9_CALMQ      MTQCNAGGLATGTGLGTALAPVKLAKLMGM--------------------EVSMFVPETR
MTNA_METPB        LTHCNAGWLATVDWG-TALAPIYVAHDAGV--------------------PVHVFVDETR
MTNA_RHORT        LTHCNAGWLATVDWG-TALAPLYKAHDAGL--------------------PIHVWVDETR
MTNA_SINMW        LTHCNAGWLATVDYG-TATAPIYMAVEEGL--------------------PVHVYVDETR
M9RDG3_9RHOB      LTHCNAGWIATVDWG-TATSPMYHAHNAGI--------------------ALHIWVDETR
MTNA_GLUOX        LTHCNAGWIATVDWG-TALAPIYMAHDEGI--------------------PVHVWVDETR
MTNA_DESOH        LTHCNAGWLACVEHG-TATAPIYKAFEKRI--------------------DIHVWVDETR
MTNA_DESAL        LTHCNAGWLACVDHG-TATAPIYAAFDKGI--------------------DVHVWVDETR
E4U607_OCEP5      LTHCNAGWLAFVDYG-TATAPMYEAQKRGI--------------------PIHVWVDETR
K9Z7E6_CYAAP      LTHCNAGWLGCVDNG-TATSPIYEAHRRGI--------------------KVHVWVDETR
F5Y6P1_TREAZ      LTHCNAGWLAFVDYG-SALSPVYAAFDAGI--------------------KVHVWVDETR
MTNA_DECAR        MTHCNAGWLATVDWG-TALSPVYAAHDAGV--------------------PVHVWVSETR
MTNA_SULDN        LTHCNAGWLAVIDEG-TALAPIYEAKRRGI--------------------DVHVWVDETR
B9XAE7_PEDPL      LTHCNAGWLAFVDIG-SATAPMYAAQAEGK--------------------KFHVFCDETR
M4YU26_THEXX      MTHCNAGALATVDVG-TALAPMRNAHDAGK--------------------KFFVYASETR
M1Z5A0_9FIRM      LTHCHSGALAGSGFGGRALSVIRTAFLEGK--------------------NIHVYCCETR
MTNA_CHLTE        LTHCNTGTLACCGIG-TALGVIRLAYQEGL--------------------IERVITSESR
MTNA_SYNP6        IHHCNTGALATVDYG-TALGIIRIAHEQGK--------------------QIHAYLDETR
MTNA_SYNS9        LHHCHTGAVATAGVG-TALGVIVAGHQRGI--------------------VKHAWLDETR
MTNA2_PSELT       IHHCNTGSLATVDYG-TALGVIRYAHEIGK--------------------KIHVFLDETR
MTNA_HUNT2        LTHCNAGALATCDYG-TALGVIRAAHESGK--------------------NIQVFADETR
MTNA_DEHM1        LTHCNAGPLATAGYG-TALGVIIAAHQQGK--------------------NISAFATETR
MTNA_BACSU        MTICNAGSIATSRYG-TALAPFYLAKQKDL--------------------GLHIYACETR
MTNA_BACCN        LTICNAGSIATARYG-TALAPFYIGKEKGI--------------------HLHAYACETR
MTNA_EXIS2        LTICNAGSIATAAYG-TALAPFYLAKEQGI--------------------PLSVYASETR
MTNA_HELMI        LTHCNAGALATAGFG-TALGVIRAAHRAGK--------------------EISVFADETR
MTNA_CARHZ        LTHCNAGALATAGYG-TALGVVRAAFEAGK--------------------LRKVFADETR
MTNA_DESAP        LTHCNAGALATAGYG-TALGVIRAAREAGK--------------------QVKVFAGETR
MTNA_DESHY        LTHCNAGALATVEYG-TALGVIRAAQQAGK--------------------KVHVYAGETR
MTNA_SYNWW        MTICNAGALATCGYG-TALGVIRSAARRNK--------------------IEMVWACETR
MTNA_DESAG        MTHCNAGALATAGYG-TALGVVRGAVDAGRT-------------------GITVIANETR
MTNA_DESVH        MTHCNAGALATAGYG-TALGVIRGAVEAGKN--------------------ITVIANETR
MTNA_PELCD        LTHCNAGALATGGYG-TALGVIRAAVESGKK--------------------ISVLADETR
MTNA_SOLUE        LTHCNAGALATAGYG-TALGVIRAAIESGKK--------------------IDVFADETR
MTNA_SYNAS        LTHCNAGALATAGYG-TALGVIRAAREAGKQ--------------------VQVFADETR
MTNA_SYNFM        MTYCNAGALATADYG-TAVGVIRAAFDADPG--------------------IRVFSCETR
MTNA_RHOFT        LTHCNAGALATAGHG-TALGVIRSAVQAGK--------------------RISVIADETR
MTNA_MAGMM        MTHCNAGALATAGYG-TALGVIRAAHTAQQG-------------------NLRVIANETR
MTNA_ANADF        LTHCNAGALATAGYG-TALGVVRAAVEGGN--------------------PVTVFADETR
MTNA_SORC5        LTHCNAGALATGGYG-TALGVIRAAIEAGK--------------------ALRVLACETR
MTNA_CHLAA        LTHCNAGGLATAGYG-TALAPIRTAFAQGR--------------------PVHVFVDETR
MTNA_HERA2        LTHCNAGGLATAAYG-TALAPIRAVHEDGQ--------------------PIHVWVDETR
MTNA_ROSS1        LTHCNAGGLATAGYG-TALAPVRTAHEQGR--------------------PIHVYVDETR
MTNA_SYNY3        LTHCNAGALATAGYG-TAIGVIRAAWSAGR--------------------LARVYADETR
MTNA_CROS5        LTHCNAGALATAGYG-TALGVIRSVWTAGR--------------------LNRVFADETR
MTNA_GLOVI        LTHCNAGALATAGYG-TALGVVRSAHRADR--------------------LERVYADETR
MTNA_PYRHO        LTHCNAGSLATVHLG-TVGSVVRVMHKDGS--------------------LKLLWLDETR
MTNA_THET8        LTHCNTGPLATGGYG-TALGAIVEAYRLGR--------------------VRHVWVDETR
MTNA_HAHCH        LTHCNTGSLATGGYG-TALGVIRSAYRRDL--------------------VTEVFADETR
MTNA_MARHV        LTHCNTGALATGGYG-TALGVIRRLHEEKL--------------------LKRVYADETR
MTNA_HALHL        LTHCNTGSLATGGLG-TALGVIRTAWADGR--------------------VERVFADETR
MTNA_NITOC        LTHCNTGSLATGGFG-TALGVIRHAYGKGR--------------------IEKVFADETR
MTNA_XYLFA        LTHCNTGSLATAGFG-TALGVIRAGIAQGR--------------------IARVFAGETR
MTNA_METCA        LTHCNTGALATGGYG-TALGVIRSTWRRGA--------------------LERVYATETR
MTNA_PSEE4        LTHGNAGALATGGFG-TALGVIRAATLEGM--------------------VEQVYVCESR
MTNA_ALCBS        YTHCNTGALATGGHG-TALGIIRSAWARNQ--------------------LTGVFAGETR
MTNA_SERP5        LTHCNTGGLATAGIG-TAIGVLLRAHQQGK--------------------VQQVWVDETR
MTNA_YERE8        LTHCNTGGLATAGIG-TAIGVLLRAHQQGK--------------------IKQVWVDETR
MTNA_KLEP7        LTHCNTGGLATAGVG-TALGVIALAHRQGK--------------------VTNVWVDETR
E3IVW2_FRAIE      LTHCNTGALATAAWG-TALGIIRELHARGR--------------------VELVYVDETR
F8B5D9_FRADG      LTHCNTGALATAGWG-TALGIIRELHARGA--------------------LEIVYVDETR
MTNAB_NOCFA       LTHCNTGRLATSAFG-TAIGALRVLAERGA--------------------VEEVLVDETR
M3C5J9_STRMB      LTHCNTGALVSGGQG-TAFAVAGALHGAGR--------------------LRRLWVDETR
E2Q5D5_STRC2      LTHCNTGALVSGGEG-TAFAVALSAHRAGR--------------------LRRLWVDETR
MTNA_RHOBA        MTHCNAGSLATSMWG-TALAPMYHLHESGH--------------------SLEVFADETR
MTNA_LEPIC        ITHCNTGALATAGHG-TALGVIRSLRDAGH--------------------SLTVFADETR
MTNA_LEPBP        ITHCNTGALATAGHG-TALGVIRSLRDQGK--------------------KVVVYADETR
MTNA_UNCRE        LTHCNTGSLATAGYG-TALGIIRRLH--------------------EHGRLSRAYCTETR
MTNA_ARTOC        LTHCNTGSLATAGYG-TALGVIRSLL--------------------ASDKLEHAYCTETR
MTNA_YARLI        LTICNTGSLATAGYG-TALGIIRALH--------------------EAGVLERVYALETR
MTNA_VERA1        LTHCNTGSLATSGHG-TALGIIRTLQ--------------------SRGWLNHAYCTETR
MTNA_SCHPO        LTHCNTGSLATSGYG-TALGIIRSLH--------------------ESGNLEHAYCTETR
MTNA_SCHJY        LTHCNTGSLATSGYG-TALGIIRSLN--------------------EKGAIERVYCTETR
MTNA_ASHGO        LTICNTGSLATAGYG-TALGAIRSLWQHAEAGLTAP---KKQKASACAPRMTHVFPLETR
MTNA_CANGA        FTICNTGSLATSGYG-TALGVIRSLWNDSKSKTQEGNPNKKVKLTESSPKMVQVFPLETR
MTNA_KLULA        LTICNTGSLATSGYG-TALGVIRSLYERTKKQISGDE--QPKRTKTSNAKMVRVFPLETR
MTNA_PICST        VTICNTGSLATSGHG-TALGIIRSTYDKLK-----------KSESSEEFWLDHVYPCETR
MTNA_PICGU        ITYCNTGSLATSGHG-TALGIVRSAYKALS-----------KENSKEKFWLEQIYPCETR
MTNA_KOMPG        MTICNTGSLATSGHG-TALGIIRSLWAKSKANPRNAD---DKTIQGQKSWLSHVYACETR
MTNA_THAPS        VTICNTGSLATAGWG-TALGVARELQ--------------------RRGKLRSIAALETR
MTNA_CAEEL        MTICNTGSLATISWG-TALGVIRALHS--------------------ENRLKLVYVLETR
MTNA_CAEBR        MTICNTGSLATVSWG-TALGVIRALHS--------------------ENRLNLAYVLETR
                      ::* :          .                                     :: 

MTNA_POSPM        PYHQGSRLTAFELQTLNIPSTMLC-DSMVGSLFQSHG-------------IHAVAVGADR
MTNA_CRYNJ        PYHQGSRLTSLELTTLQIPACMIC-DTMLGSLFQHED-------------IDGVIVGADR
MTNA_ANOGA        PYNQGARLTAYELVHDKLPATLVT-DSMVAALLNSRK-------------IDAIIVGADR
MTNA_DROGR        PYNQGARLTAYELVHEKLPATLVL-DSMVAALFRVKN-------------VAAVVVGADR
MTNA_HUMAN        PYNQGARLTAFELVYEQIPATLIT-DSMVAAAMAHRG-------------VSAVVVGADR
MTNA_XENTR        PYNQGSRLTAYELVYEKIPATLIT-DSMASAAIRDRK-------------VTAVVVGADR
MTNA_NEMVE        PYNQGSRLTAYELVYEKIPSTLIA-DSAVSMAMKTKK-------------ISAVVVGADR
MTNA_TRIAD        PYNQGSRLTAFELVHDGIPATLIT-DSMASLVMKKKD-------------ISAVVVGADR
MTNA_MONBE        PYNQGARLTAYELVTEGIPGTLVA-DSMVSLLMKQKG-------------ISAVVVGADR
MTNA_NAEGR        PYNQGARLTAFELVYEKIPSTLIC-DSAVSYLFKTKK-------------IDAIIVGADR
MTNA_ORYSJ        PFNQGSRLTAFELVHDKVPATLIA-DSAAAALMKSGC-------------IQAVIVGADR
MTNA_OSTLU        PYNQGSRLTAYELVYEKIPGTLIC-DNMAAALMARGD-------------VDAIVVGADR
MTNA2_TRYCC       PWNQGARLTVYECVQENIPCTLIC-DSAVSALMGSRP-------------IDAVIVGADR
MTNA_CALS8        PYLQGARLTAFELSEDGIPNTVIC-DNMAGYLMKLGK-------------IDCVIVGADR
MTNA_SULSY        PYLQGSRLTAWELLREGIPHYIIT-DSSAGFLMKKGM-------------IDVIVVGADR
MTNA_CALS4        PRLQGAKLTAWELVQEGIPAKLIA-DSVAATLIRDGK-------------IDIILVGADR
MTNA_NATTJ        PRLQGAKLTAWELKQEQLPFALIP-DSSAAVLIKNGD-------------IDVIFVGADR
MTNA_METJA        PRLQGAKLTAFELNYEGIPVKVIT-DNTAGFLMQKGE-------------IDKIIVGAD-
MTNA_METST        PVLQGARLSVFEMQQENIPVRLIV-DGAAGHMMQKGE-------------VDKVIIGAD-
MTNA_AERPE        PVLQGARLNVWELRKEGIPFKLVV-DSAVGLIMSRGM-------------VSKAIVGAD-
MTNA_ARCFU        PLNQGSRLTCWELMEDGIDVTLIT-DSMVGIVMQKGM-------------VDKVIVGAD-
MTNA_METAC        PLNQGSRITTWELMQDKIPVTLIA-DSMAGWAMHQGL-------------VDSVLVGAD-
MTNA_SULAC        PWLQGSRLTVYELMEENIPVTLIA-DTAVGLVMFKKM-------------VNSVMVGAD-
A8MBP9_CALMQ      PWLQGARLTVYELVMEGIDTTLIT-DTAVGLVMYKGM-------------VNHVMVGAD-
MTNA_METPB        PRNQGAALTAFELNAHGVPHTVIA-DNAGGHLMQHGQ-------------VDVCIVGSDR
MTNA_RHORT        PRNQGASLTAWELNSHGVPHTVIA-DNTGGHLMQHGL-------------VDMVIVGTDR
MTNA_SINMW        PRNQGAYLTAWEMNGHGVPHTLIV-DNAGGHLMQHGD-------------VDLVIVGTDR
M9RDG3_9RHOB      PRNQ-DALTSWELGSHGIAHTYIT-DNAGGHLMQHGQ-------------VDMVITGTDR
MTNA_GLUOX        PRNQGSLLTAWELGSHGVPHTVIA-DNAGGHYMQTGR-------------VDMVIVGTDR
MTNA_DESOH        PLNQGARLTAWELGQRGVAHTVIT-DNAGGHLMQHGM-------------VDMVIVGTDR
MTNA_DESAL        PLNQGSRLTAWELGQHGVPHTIIT-DNAGGHLMQHGK-------------VDMVIVGTDR
E4U607_OCEP5      PRNQGARLTAWELVQQGVPHTVVA-DNVGGHLMQHGL-------------VDLVITGADR
K9Z7E6_CYAAP      PRNQGSTLTAWELGQQGINHTIIP-DNAGGHLMQHGL-------------VDIVIVGSDR
F5Y6P1_TREAZ      PRNQGASLTAWELCGHGVPHDLVP-DNAGGHMMQHGL-------------VDMVITGADR
MTNA_DECAR        PRNQ-GLLTAWELEQHGVPHTLIA-DNAAGLLMRNGK-------------VDAVIVGADR
MTNA_SULDN        PRNQGASLTAWELSKEGIEHTIIA-DNMGGLLMQRGE-------------VDMVIVGADR
B9XAE7_PEDPL      PRSQGATLTAWELAQQGISHQIIA-DNAAGHLMQRGH-------------IDMVIVGSDR
M4YU26_THEXX      PRLQGMQLTAWELNQEGIDHAIIP-DGSAAYYMSQG--------------VDMIIVGADR
M1Z5A0_9FIRM      PYLQGARITAYELEKFGIPHTLIT-DGMSGYLMRIGK-------------INKVVVGSDR
MTNA_CHLTE        PLLQGLRLTAWELEHDGIPFASIS-DSSSAILMQRGM-------------IDFAITGADR
MTNA_SYNP6        PRLQGANLSAFELQAYGVPHTVIV-DGASGFLMRQQQ-------------IDCCLVGCDR
MTNA_SYNS9        PRLQGAALSAWELGCCGVPATVIV-DGASGLLMRRGQ-------------VDVVLVGCDR
MTNA2_PSELT       PRLQGARLSAWEMKELGIPHTIIV-DGASGLVMKKFK-------------IDLALVGADR
MTNA_HUNT2        PYLQGARLTAWELMQDNIPVTLIC-DNMAGHFMKEGL-------------IDCVIVGADR
MTNA_DEHM1        PLLQGARLTALELKEAGIPFKLIT-DSMAGHFMQKGV-------------INAVVVGADR
MTNA_BACSU        PVLQGSRLTAWELMQGGIDVTLIT-DSMAAHTMKEKQ-------------ISAVIVGADR
MTNA_BACCN        PVLQGARLTTWELREAGVDVTLIT-DNMAAHTIRTKN-------------ISAIIVGADR
MTNA_EXIS2        PLLQGARLTTWELQRAGIDVTLIT-DNMVAHTIKEKQ-------------ITAIIVGADR
MTNA_HELMI        PLLQGARLTAWELMQDGIPVTLIT-DSMAAYVMKQKL-------------VDLVIVGADR
MTNA_CARHZ        PLLQGARLTAFELLEDGIDVTLIC-DNMAGYVMSLGL-------------VDLVVVGADR
MTNA_DESAP        PFLQGARLTAWELMREGIEVVLVA-DNMAGYLMAREG-------------LDLVIVGADR
MTNA_DESHY        PFLQGARLTALELMNDHIPVTLIA-DNMAGFLMQQGN-------------IDLVIVGADR
MTNA_SYNWW        PVLQGSRLTVWELWQDKIPVTLLT-DNMAGYTMSLGK-------------VDAVITGADR
MTNA_DESAG        PFLQGARLTAYELHKDGIPVTVAC-DNACGLLMQRGM-------------VQKVVVGADR
MTNA_DESVH        PFLQGARLTAFELHEDGIPVTVAC-DNACGLLMKRGM-------------VQKVVVGADR
MTNA_PELCD        PFLQGSRLTAWELHKDGIPVTLIC-DNMAGALMRQGE-------------IDCVIVGADR
MTNA_SOLUE        PFLQGARLTVWELQQDSIPTTLIT-DNMAGHFMKAGR-------------IGCVVVGADR
MTNA_SYNAS        PVLQGARLTAWELQKENIPVTLIT-DSMAGFLMKQGR-------------IDCILVGADR
MTNA_SYNFM        PFLQGARLTVYELMKAGIPVTLIT-DNSIGSLMSRGM-------------IDVVVVGADR
MTNA_RHOFT        PFLQGARLTAWEMVQENIPVTLIT-DNMAGHLMSRGE-------------VDAIVVGTDR
MTNA_MAGMM        PYLQGARLTAWELLQDHIDTTLIT-DNMAGWLMANGE-------------VDAVVVGSDR
MTNA_ANADF        PFLQGARLTAWELKRDGIPVTLLT-DNMAGWLMAQGE-------------IACVVVGADR
MTNA_SORC5        PYLQGARLTAWELQRDGIPVEVIS-DSMAAWFMQKGE-------------IGAVVVGADR
MTNA_CHLAA        PFLQGARLTAWELLQAGIPQTLIT-DNMAAFMMQRGQ-------------IDCVIVGADR
MTNA_HERA2        PFLQGARLTAWELQQAGIDLTLIT-DNMAAYFMQQGQ-------------VDCIIVGSDR
MTNA_ROSS1        PFLQGARLTAWELIQERIPLTLIT-DNMAGYFMKRGD-------------IDCVIVGADR
MTNA_SYNY3        PRLQGAKLTVWECVQAGIPVTLIT-DNMAAHCMQQQR-------------IDAVVVGADR
MTNA_CROS5        PRLQGAKLTAWECVQEKIPVTVIS-DNMAAHCMQKGL-------------IDMVVVGADR
MTNA_GLOVI        PRLQGARLTAWELVHERIPVTVLA-DTMAAHVIGRGL-------------VDAVVVGADR
MTNA_PYRHO        PVLQGARLSAWEYSYDGLNVKLIA-DNAAAFVMQQGF-------------VDAIIVGADR
MTNA_THET8        PYLQGARLTAYELQKAGVPATLIT-DGMAGWLMARGA-------------VDAVVVGVDR
MTNA_HAHCH        PWLQGARLTAWELCQDDIPVKLIA-DSAAAHVMKTCA-------------VKWVIVGADR
MTNA_MARHV        PWLQGSRLTAWELTRDHIPVTLNA-DGAAAAIMASGK-------------VKWIVVGADR
MTNA_HALHL        PWLQGSRLTAWELAADGIPVDLLA-DGAAAALMRTGQ-------------VQWAIVGADR
MTNA_NITOC        PWLQGARLTTWELLRDGIPVVLIA-DSVAPYLLGQGE-------------VQWVIVGADR
MTNA_XYLFA        PWLQGARLTVWELQQDGIDVTLIA-DSAAAHLMKSGQ-------------VQWVIVGADR
MTNA_METCA        PWSQGARLTVWELGQDRIPATLLA-DSAAAWLMKSGA-------------VQWVVVGADR
MTNA_PSEE4        PWLQGSRLTAWELAADGVPVTVVA-DAAAGHLMKTKG-------------ISWVVVGADC
MTNA_ALCBS        PWLQGSRLTSWELLNDGIPVTLVA-DSCAGQLMQQGK-------------IQAVIVGADR
MTNA_SERP5        PLLQGGRLTAWELGELGIPYRLIC-DSMAASLMAQGQ-------------VDAVWVGADR
MTNA_YERE8        PLLQGGRLTAWELGELGIPYQLIC-DSMAASLMAQGR-------------VDAVWVGADR
MTNA_KLEP7        PLLQGGRLTAWELGELGVPYQLIA-DSMAASLMAQGQ-------------VDAVWVGADR
E3IVW2_FRAIE      PLLQGSRLTAWELAQAGIDYRVQV-DGAAASAIVGGL-------------VDVAIVGADR
F8B5D9_FRADG      PLLQGSRLTAWELDVEDIPHLVQV-DAAAAGTIVRGL-------------VDAAVVGADR
MTNAB_NOCFA       PLLQGARLTTWELAEAGIPHRLTI-DSAAAWAMATGL-------------VDCVLVGADR
M3C5J9_STRMB      PLLQGARLTAYEAARAGMAYTVLT-DSAAGSLFAAGE-------------VDAVLVGADR
E2Q5D5_STRC2      PLLQGARLTAYEAARNGLPYTLLT-DNAAGSLFAAGE-------------VDAVLIGADR
MTNA_RHOBA        PLLQGARLTAWELHQAGIPVTVCT-DSMSGSLMRQGR-------------VDAVIVGADR
MTNA_LEPIC        PYLQGARLTAWELQEEKIQSFLIT-DNMAGWVMSSRK-------------IDAVIVGADR
MTNA_LEPBP        PFLQGSRLTAFEMMEEGIECYIIT-DGMSGWLMNHRK-------------IDAVLVGCDR
MTNA_UNCRE        PYNQGARLTAYELVSDKIPATLIT-DSMAGQLLAN-----------PDKKIAAIVVGADR
MTNA_ARTOC        PYNQGARLTAFELVHDKIPATLIT-DSMAASLLAQ-----------KGAGLAAIVVGADR
MTNA_YARLI        PYNQGSRLTAYELVHDGIPATLVT-DSMAAALLR------------KNKDIGVIIVGADR
MTNA_VERA1        PYNQGSRLTAFELVFEKIPSTLIT-DSMAAALFALQK---------ETMNISAVIVGADR
MTNA_SCHPO        PYNQGSRLTAFELVHDKIPATLVT-DSTVASIMHK---------------IDAIVVGADR
MTNA_SCHJY        PNNQGSRLTAYELLYDNIASTLIT-DSTAASIMPK---------------IDAVIVGCDR
MTNA_ASHGO        PYNQGSRLTAYELLHDAIPATLIT-DSSVAYRIQTS-----------PVPIKAAFVGADR
MTNA_CANGA        PYNQGSRLTAYELVHDDIPATLIP-DSSIAYKIMTS-----------KIPIKAAFVGADR
MTNA_KLULA        PYNQGSRLTAYELLHDEIPSTLIT-DSSISYLVSTS-----------KIPIKAAFVGADR
MTNA_PICST        PYNQGAKLTTYELHYEQIPFTLIC-DNMVSSLVNTLSSNK-NIQDNAAAPVKFIIVGADR
MTNA_PICGU        PYNQGAKLTTFELKYEKIPFTLIC-DNMVTSLISRTHNKK-QVKD-IVAPVKFAIVGADR
MTNA_KOMPG        PYNQGSRLTSYELNFEKIPFSLIT-DNMPAYLIDSLFSQRVNCPLPSRAPVKFIIVGADR
MTNA_THAPS        PYNQGSRLTAYEIMQEQMPNPILLCDSMAASYLKS-------------KGADVCVVGADR
MTNA_CAEEL        PYNQGIRLTSIELLHGEVPFKLIT-DSMAAWAMKNH-------------QVDCVLTGADN
MTNA_CAEBR        PYNQGIRLTATELLHGQVPFKLIT-DSMAAWAMKNH-------------QLDCVLVGADN
                  *  *   :.  *     :       *      .                       * * 

MTNA_POSPM        ITR-DGDTANKVGTYNAAVLAARHK----------IPFIVVAPVSTVDLDIADG-SSIPI
MTNA_CRYNJ        VVK-NGDTANKIGTYQAAVLAQRHN----------VPFMVVAPVTTIDLSLPTG-AEIHI
MTNA_ANOGA        VAA-NGDTANKIGTYQMAVVAKHHG----------VPFYVAAPFTSIDVAIEDG-SHIKI
MTNA_DROGR        VAA-NGDTANKIGTYQIAVVAKHHG----------VPFYVAAPLTSIDLQIPSG-EHIII
MTNA_HUMAN        VVA-NGDTANKVGTYQLAIVAKHHG----------IPFYVAAPSSSCDLRLETG-KEIII
MTNA_XENTR        VVA-NGDTANKIGTYQLAITARYHG----------IPFYVAAPSTSCDLSLPTG-GSIVI
MTNA_NEMVE        IAC-NGDTANKIGTYQLALAAKHHE----------IPFYVAAPVTSIDFSLVNG-DAIVI
MTNA_TRIAD        VLG-NGDTANKIGTYQLAITAKYHK----------IPFYIAAPTTTIVLD--DS-KDIVI
MTNA_MONBE        VVA-NGDTANKIGTYQIAIAAKHHG----------VPFFVAAPLTSVDLKLSHG-SEITI
MTNA_NAEGR        VCN-NGDTANKIGTYHIAVSAKHHG----------IPFYVAAPFTSIDLTLASG-DLITI
MTNA_ORYSJ        IAA-NGDTANKIGTYNLAISAKHHG----------VQFYVAAPITSIDLSLPSG-EQIVI
MTNA_OSTLU        VAA-NGDFANKIGTYSLAVNAKHHG----------VPMFTAAPVTTLDPETATG-ADIHI
MTNA2_TRYCC       ICR-NGDTANKIGTCNLAVAAAHYG----------VPFFVAAPSTTLDPMTADG-ESVVI
MTNA_CALS8        IAL-NGDTANKIGTYSLSVLAKHHG----------IPFYISAPISTIDFNIKSG-SEIPI
MTNA_SULSY        ITL-NGDVANKIGTYSLSILAKHHN----------IPFYVAAPSSSLDFNLESG-DEIPI
MTNA_CALS4        IAL-NGDTANKIGTFMLSVVAKVYN----------VPFYVVAPTSTIDFNIETG-AEIVI
MTNA_NATTJ        IAS-NGDTANKIGTFMLSILAKKYK----------VPFYVVAPVSTIDFQAKNG-DDITI
MTNA_METJA        RILADGTVYNKIGTYSLAVLAKYHR----------IPFYVAAPLSTFDLRSSEE--DVII
MTNA_METST        RVAKDG-VANKIGSLMVALAAKRYD----------IPFYVAAPMSTFDFENNIF--DTII
MTNA_AERPE        RIVSTGHTANKIGTYMVAMAASRHG----------VPFYVAAPASTFQPDAGPE--AIVI
MTNA_ARCFU        RIVRDA-VFNKIGTYTVSVVAKHHN----------IPFYVAAPKATFDWERTAK--DVVI
MTNA_METAC        RITQDV-VFNKIGTYTHSILAKEHE----------IPFYVAAPISTFDFKGWEG--SVKI
MTNA_SULAC        RILSDGHVFNKIGTFKEAVIAHELG----------IPFYALAPSSTFDMISTVD--QVKI
A8MBP9_CALMQ      RILKDGHVFNKVGTFKEAVIAHELG----------IPFYALAPSSTFDLTSDVN--DVKI
MTNA_METPB        TTA-AGDVCNKIGTYLKALAASDNR----------IPFYAALPFSTIDWTLADGVRDIPI
MTNA_RHORT        TTA-TGDVCNKIGTYLKALAAFDNA----------VPFYVALPGPTIDWTVNDGLREIPI
MTNA_SINMW        TTA-NGDVCNKIGTYLKALAARDNG----------IPFYVALPSPTIDWTVHDGVKEIPI
M9RDG3_9RHOB      TTR-RGDVCNKIGTYLKALAAHDNG----------VPFYVALPSPTIDWTVADGVADIPI
MTNA_GLUOX        VTA-QGDVANKIGTYLKALAAHDNN----------VPFWVALPSSTIDWRVRDGVKDIPI
MTNA_DESOH        STY-TGDVANKVGTYLKALAARDNN----------IPFYVALPSSTFDWEMTDGLAQIPI
MTNA_DESAL        TTH-TGDVANKVGTYLKALAAKDNN----------VPFYVALPSSTIDWEMKNGVKDIPI
E4U607_OCEP5      VTR-CGDVANKIGTYLKALAAADNG----------VPFYVALPSSTLDWSICDGVAEIPI
K9Z7E6_CYAAP      TTY-TGDVANKIGTYLKAVAAKDNN----------VPFYVALTYSAFDWNISDGVKQIPI
F5Y6P1_TREAZ      VTR-KGDSANKIGTYLKALAAKENN----------VPFYIALPSSTFDFKMRDGIKEIPI
MTNA_DECAR        IAA-NGDVANKVGTYLKALACADNG----------IPFYVAAPRSTLDFACPEG-ASIPI
MTNA_SULDN        VSA-NGDVANKIGTYLKALAAHDNG----------VPFYVAIPASTFDFEIKDGVKEIPI
B9XAE7_PEDPL      TLGRTGEVANKIGTYTKAVLAKRHG----------IPFYVAIPLSTIDWDMKSG-FDIPI
M4YU26_THEXX      IAA-NGDFANKIGTYDKAIVAKKFG----------IPFYVAAPVSTFDFSTKTG-KDIVI
M1Z5A0_9FIRM      VAS-NGDLINKVGTYMHALAAKENG----------IPFYTATSSHTIDFSLERG-MDIDV
MTNA_CHLTE        ITA-NGDTANKIGTYAHAISARYHG----------LPFYIAAPVSTIDITMAEG-SEIPI
MTNA_SYNP6        VTA-NGDVANKIGTYNLALAAKAHG----------VPFYVACPISTIDRSLATG-AEIEI
MTNA_SYNS9        VAG-NGDVANKIGTYNLALAARAHG----------VPFYVCAPSSSIDITTVDG-DAITI
MTNA2_PSELT       IAA-NGDTANKIGTYNLAIVAKYHN----------VPLYVVAPTSTIDLKTPAG-QDIPI
MTNA_HUNT2        IAL-NGDTANKIGTYSLAVLAKENN----------IPFYVAAPTTTIDFSIETG-EQIPI
MTNA_DEHM1        IAK-NGDTANKIGTYSLAVLALAHG----------IPFYVAAPSSTFDKSIESG-RDIVI
MTNA_BACSU        IAK-NGDTANKIGTYGLAILANAFD----------IPFFVAAPLSTFDTKVKCG-ADIPI
MTNA_BACCN        IVA-NGDTANKVGTLNLAILAKHYQ----------IPFYVAAPLSTFDTKKKTG-NEIII
MTNA_EXIS2        ITR-NGDTANKIGTFQLALLARAFG----------IPFYVAAPLSTFDFTSLSG-DEIEI
MTNA_HELMI        ITA-NGDVANKIGTYGVALAAKAHG----------IPFYVAAPVSTFDLSLESG-LQIPI
MTNA_CARHZ        VTA-NGDVANKIGTYSLAILAKEHG----------IPFYVAAPYSTIDLNLTSG-QDIPI
MTNA_DESAP        VAA-NGDVANKIGTYSLAVLARAHG----------IPFYVAVPLSTVDLRTAIG-RDIPI
MTNA_DESHY        IAA-NGDTANKIGTYSLAVLAHAHG----------IPFYVAAPTSTIDLKVPSG-QDIPI
MTNA_SYNWW        IAT-NGDTANKIGTYSLAVLAKYHG----------IPFYVAAPLSTFDWNIKQG-GEIPI
MTNA_DESAG        IAA-NGDAANKIGTYSVALLAREHG----------IPFYVAAPLSTIDRATPSG-KQIPI
MTNA_DESVH        IAA-NGDAANKIGTYSVALLAREHG----------IPFYVAAPLSTIDRETPDG-DHIPI
MTNA_PELCD        IAA-NGDVANKIGTYSVAVLAKEHG----------LPFYVAAPLSTIDLKIPDG-DHIPI
MTNA_SOLUE        IAA-NGDVANKVGTYSVAVLAKENG----------VPFYVAAPISTLDLTLSSG-EQIPI
MTNA_SYNAS        IAT-NGDTANKIGTYTLAVLAAAHS----------VPLYVAAPLSTIDRKLSSG-NEIPI
MTNA_SYNFM        IAA-NGDTANKIGTYMAAVLACTHG----------IPFYVAAPRSTIDASLPDG-DGIPI
MTNA_RHOFT        VAA-NGDVANKIGTYMVAVLAQRHN----------IPFYVACPLSTIDLAIPDG-AAIPI
MTNA_MAGMM        VAA-NGDVANKIGTYTLAVLARRHD----------IPFFVAAPLSTVDLRCPTG-REIPI
MTNA_ANADF        IAA-NGDVANKIGTYALAVLAAYHH----------LPFYVAAPWSTVDLATPDG-SAIPI
MTNA_SORC5        IAR-NGDVANKIGTYGLACLARHHG----------IPFYVAAPWSTIDLATDSG-ASIPI
MTNA_CHLAA        IAA-NGDVANKIGTYGLAVLARYHN----------IPFYVAAPSSTIDLATASG-ADIPI
MTNA_HERA2        IAA-NGDVANKIGTYGLAVLAKAHN----------IPLYVAAPTSTIDLQTADG-AAIPI
MTNA_ROSS1        IVA-NGDVANKIGTYSLAVLARAHR----------IPFYVAAPSSTIDCSLPNG-DAIPI
MTNA_SYNY3        IAR-NGDIANKIGTYGLAVLAKMHA----------IPFFVAAPLSTVDFALDDG-SQIPI
MTNA_CROS5        IAA-NGDTANKIGTYGLAVIAKMHQ----------VPFYVAAPLSTVDFSLETG-DLIPI
MTNA_GLOVI        IAA-NGDTANKIGTCGVAIIARHYG----------VPFFVAAPWSTVDLNLSSG-EQIPI
MTNA_PYRHO        IVA-NGDFANKIGTYMLAVLAREHG----------IPFFAVAPLSSIDMELKSG-KDIPI
MTNA_THET8        MAL-NGDFANKVGTYALAVLAHHHG----------IPFYAALPLSSVDPRLASG-EGIPI
MTNA_HAHCH        ITA-HGDVANKIGTYGLAVLARHHG----------VKFMVAAPSSTIDFELFSG-ADIPI
MTNA_MARHV        ITA-NGDVANKIGTYNLAVLARHHK----------IGFMVVAPSSTVDMSLESG-KDIPI
MTNA_HALHL        IAA-NGDVANKIGTYAVALAARQHG----------VRLMVVAPTSTIDLATPAG-EQIPI
MTNA_NITOC        IAA-NGDTANKIGSYGLAVAARYHN----------VRFMVVAPTSTIDWNLSDG-TRIPI
MTNA_XYLFA        ICA-NGDAANKIGTYQLAITARHHG----------VKFMVVASAATVDMDTTAG-EAIEI
MTNA_METCA        IAA-NGDVANKIGTYSLAVLARHHG----------VKLMVVAPISTVDWATATG-EDIVV
MTNA_PSEE4        IAA-NGDVAAKIGTYQIAVAAMHHG----------LRFMVVAPSSSIDLNLATG-EDIPL
MTNA_ALCBS        ITA-NGDTANKIGTYNLAVLAQHHN----------IPFIVAAPVSTLDPALPNG-SHIVI
MTNA_SERP5        IAA-NGDVANKIGTYSLAVLAHYHR----------IPFYVAAPHTTHDPHCPNG-AAIAI
MTNA_YERE8        IAA-NGDVANKIGTYSLAVLANYHR----------IPFYVAAPHTTHDPDCPNG-AAIPI
MTNA_KLEP7        IAA-NGDVANKIGTYSLAVLAHYHQ----------IPFYVAAPQTTLDRYCPNG-AAIPI
E3IVW2_FRAIE      IAA-NGDVANKIGTLGVALACAHAG----------VPFVVAASASTIDEESAGS-AAMTI
F8B5D9_FRADG      IAA-NGDVANKIGTLGVALACAYAR----------IPFVVAASASTVDPATASG-DMIPI
MTNAB_NOCFA       VTA-RGDVANKIGTYAVALAAHRHG----------IPFVVVAPESTRDPATASW-RDIVV
M3C5J9_STRMB      IAA-DGSVANKVGSYPLAVLARYHH----------IPFVVVAPSTTVDLGSEGG-ADIEV
E2Q5D5_STRC2      IAA-DGAVANKVGSYPLAVLAKYHR----------VPFVVVAPTTTIDPGTPDG-ASIVV
MTNA_RHOBA        IAA-NGDVANKIGTYPLAVLAKYHN----------IPFYVAAPTNTFDSELESG-DLIPI
MTNA_LEPIC        IAS-NGDTANKIGTYPLAIVAKHHG----------VPFYVAATAKSMDFRIPNG-SYIPI
MTNA_LEPBP        VAT-NGDTANKIGTYNLAIVAYEHK----------VPFYVCATKDSFDLKLKTG-DEIPI
MTNA_UNCRE        VAA-NGDTANKIGTYTLAVLAKFHN----------IKFVVAAPRTTIDMKTKTG-NEIII
MTNA_ARTOC        VVA-NGDTANKIGTYQLAVLAKYHG----------VKFIVAAPRTTIDLRTKEG-EDIII
MTNA_YARLI        VVL-NGDTANKIGTFQLSILANHFD----------RKFIVAAPTTSIDVQTKSG-EDIEI
MTNA_VERA1        VVR-NGDTANKIGTYQLAVLAKHHG----------IKFIVAAPTTSIDLETMTG-EGIHI
MTNA_SCHPO        VTR-NGDTANKIGTYNLAILAKHFG----------KPFIVAAPFSSIDTSLASG-SQITI
MTNA_SCHJY        VAR-NGDTANKIGTLSLAILAKHFN----------VPFIVAGPSFSIDMTLPDG-EQTKI
MTNA_ASHGO        IAR-NGDTANKIGTLQLALVCRHFG----------IRFFVVAPRSTVDGTTAAG-TDIPV
MTNA_CANGA        IVR-NGDTANKIGTLQLAIICKQFG----------IKFFVVAPRTTIDKVTEEG-KDIIV
MTNA_KLULA        IVK-NGDTANKIGTYQLSIVCRHFG----------IKFYVVAPTTTFDSNTETG-DKIVV
MTNA_PICST        VVK-NGDTANKIGTFQLSTIANFFNSNKLSGSANKIKFIVAAPRTTIDLNTATG-DEIVI
MTNA_PICGU        IVQ-NGDTANKIGTFQLAAIFDSFN-RRNTGPRDSLKMIVAAPRTTIDLKTTTG-DDIII
MTNA_KOMPG        IVT-NGDLANKIGTFQLALIASQYD---------GVKFIGAAPTTTIDYTRDSG-DDIVI
MTNA_THAPS        VCA-NGDTANKIGTFQLSIIAKEMG----------VEFFVASPFTTLDVELESG-DMIEI
MTNA_CAEEL        VAR-NGDTANKIGTYMLAVLCKHHN----------INFYPVVPFTTINKNIATG-EEIKI
MTNA_CAEBR        VAR-NGDTANKIGTYMLAVLCKHHN----------INFYPVVPFTTINKNISSG-EEIKI
                            *:*:   :                   :    .  :             :

MTNA_POSPM        EHRPALEACVVRGALYP--VRTDAEG-LKEQATVMITPEG-LDGVYNPSFDVTPAELITA
MTNA_CRYNJ        EHRPAAEATQVRGLDTE--TGKLSVV-RITPEGVGEGDKP-WQRVYNPSFDVTPAELISA
MTNA_ANOGA        EERPEHELTHIGG--------------------QRIAAPG--IGCWNPAFDVTPAELITG
MTNA_DROGR        EVRPDREMTHVGE--------------------HRIAAPG--INCWNPAFDVTPASLITG
MTNA_HUMAN        EERPGQELTDVNG--------------------VRIAAPG--IGVWNPAFDVTPHDLITG
MTNA_XENTR        EERPSHELTDING--------------------VRIAAPG--IGVWNPAFDVTPHELITG
MTNA_NEMVE        EERSPLELTSVKG--------------------IPVAASG--IGVWNPAFDVTPAGLITG
MTNA_TRIAD        EERSHKEVTEIQG--------------------IPIAPSG--INVYNPAFDVTPAELITG
MTNA_MONBE        EERPGKELTHIFG--------------------QQLAAPG--IGTWNPAFDVTPADLITG
MTNA_NAEGR        EERSEKEITHYRNN------------------DERAVVEN--IGVWNPGFDVTTADLISG
MTNA_ORYSJ        EERSPNELLNSEGGL-----------------GKQVAASG--ISVWNPAFDVTPANLITA
MTNA_OSTLU        EERPGEEVTHSLG--------------------KRVAAEG--IDVWNPSFDVTPAALLTG
MTNA2_TRYCC       EERETMELTHSMAT------------------QQRVVAEGPSLRIWNPVFDITPAALVTG
MTNA_CALS8        EERSEDEIRFFNG--------------------KKIVPDE--SKVFNPAFDVTPAENITA
MTNA_SULSY        EERNEDEVKNCHC--------------------CKVAPQQ--SHALNYSFDITPADNITA
MTNA_CALS4        EERSPEEVTHING--------------------VRIAPEG--IDVYNPAFDVTPHENITG
MTNA_NATTJ        EERSSKEVTEIDG--------------------VRVAPTD--IQVYNPAFDITPAENITG
MTNA_METJA        EERDEKEVAYIDG--------------------VRIVPEG--VGCYNYAFDKTPPDLITA
MTNA_METST        EQRLPEEVLCING--------------------KYISKKQ--TNVENPAFDIVESDLITG
MTNA_AERPE        EERSPDEVRGVISEA----------------GYVRITLGD--VEAYNPSFDVTPPELITA
MTNA_ARCFU        EERPREELIFCGK--------------------RQIAPLN--VKVYNPAFDPTPLENVTA
MTNA_METAC        EMRDPDELRFSGC--------------------QQLAPKD--VEVYNPAFDATPMENVTA
MTNA_SULAC        EERSPDEVRSIKG--------------------VYISPKE--VKVYNPVFDVTPPKYVSA
A8MBP9_CALMQ      EERDPNEVRLIRG--------------------VPITLSD--VKVYNPVFDVTPPRYVTA
MTNA_METPB        EERDAREVTHLTGRTD-----------DGAFATVAVVSPG--SPVANPAFDVTPARLVTG
MTNA_RHORT        EQRDAAEVTRVWGRTA-----------AGALEWVTITPTG--SPAANYAFDVTPARLITG
MTNA_SINMW        EERAGEEVSFVQGRAP-----------DGSIASVRISPEG--SPAANPAFDVTPARLITG
M9RDG3_9RHOB      KDRGEREITYVMGRNN-----------AGQITEVQVTPDG--THGGNPAFDVTPNRLVSG
MTNA_GLUOX        EERSADEVLFMTGLDS-----------NGEAGRVRIAPLN--SPAANPAFDVTPARLVTG
MTNA_DESOH        EERNPDEVRCVEGLCP-----------DGRVEKVRIVPEN--SRAANYAFDVTPARLVTG
MTNA_DESAL        ENRDPDEVRKVWGLH------------DGHLVDVLVPPEE--SPALNVAFDVTPARLVTG
E4U607_OCEP5      EQRGEEEVKYIQGLS------------DGEVKRVLLTPPE--SPAANYGFDVTPARLVKG
K9Z7E6_CYAAP      EQRDATEVKYIKGLH------------EGKIKEVLIAPEN--SPAANYGFDVTPARLITG
F5Y6P1_TREAZ      EERDAAEVRFMSGKTA-----------NGLIETVQICPDT--TPARNWGFDVTPNRYITG
MTNA_DECAR        EERDGDEFRLVHGLDS-----------RGVPSALRQLPAG--EDVANPAFDVTPNWLVKA
MTNA_SULDN        EERSGDEVKFIRGVDE-----------DGVLRRVRITPED--SPTKNYGFDVTPARLISA
B9XAE7_PEDPL      EERHESEVLGAWGITG-----------KGKREYVRVANPG--SGAFNAGFDVTPAELITG
M4YU26_THEXX      EQRSETEMTEVQGIR--------------------IAPVG--SKALNPAFDVTTSDLVTG
M1Z5A0_9FIRM      EYRPEYEVTHLDGKL--------------------ITTEN--TRALYPAFDVTPNEMING
MTNA_CHLTE        EERNPDELRKIFG--------------------TQVATPT--TPVVNFAFDVTPGTLIRG
MTNA_SYNP6        EERDGREITEIR--------------------GQAIAPAG--TKTWNPAFDITPAELVTA
MTNA_SYNS9        EERPEDEITHFR--------------------GELVCASG--VRAWNPAFDITPAHLITG
MTNA2_PSELT       EERSADEIRCVG--------------------NSQVAPQE--SPVFNPAFDVTPAELISG
MTNA_HUNT2        EERSPAEITHIK--------------------GIRIAPEG--VKVRNPAFDVTPNKYISA
MTNA_DEHM1        EERKPEEITQIR--------------------GQRIAPEN--IAVANPAFDVTPANLITA
MTNA_BACSU        EERDPEEVRQIS--------------------GVRTAPSN--VPVFNPAFDITPHDLISG
MTNA_BACCN        EERDETEVTKIN--------------------GQQIAPAG--IHIYNPAFDITPHEFISG
MTNA_EXIS2        EERDAREVTQLA--------------------GKATAPAG--VPVFNPAFDVTPHDLITA
MTNA_HELMI        EERDTEEVRRVG--------------------DSITAPPG--VPVYNPAFDVTPAELVTA
MTNA_CARHZ        EERNPDEVRKIG--------------------DRLIAPPQ--VKVFNPAFDVTPAKYITG
MTNA_DESAP        EERDPAELTHFR--------------------GRRVAPQG--VAVWNPAFDVTPNELITA
MTNA_DESHY        EERNPKELREVF--------------------GVQVAPPE--VPVYNPAFDVTPAKLITG
MTNA_SYNWW        EERSAEEVRTIK--------------------GSCLTVPV--VDVFNPAFDITPEHLITA
MTNA_DESAG        EERPAEEVTHVG--------------------ETRITPEG--VPVYNYAFDVTPAHLIAG
MTNA_DESVH        ENRTPTEVTHVG--------------------ATQITPDG--VPVFNFAFDVTPAHLIAG
MTNA_PELCD        EERDTSEVTHCG--------------------PTRLAPEG--INVRNPAFDVTPAGLITA
MTNA_SOLUE        EERSAAEVTHVF--------------------GHAVAPAG--TAVKNPAFDVTPARYVTG
MTNA_SYNAS        EERPAEEILTIR--------------------GVPIAPAG--VEVYNPAFDVTPGHYISA
MTNA_SYNFM        EQRAPKEVTHFN--------------------GRRVAPQG--AAALNAAFDVTPNKYITG
MTNA_RHOFT        EERAAEEVTGFR--------------------DCQWAAKG--VQVRNPAFDVTPAELVTA
MTNA_MAGMM        EERSANEVTHCM--------------------GIRSAADG--VKVRNPAFDVTPAELITA
MTNA_ANADF        EERGDEEVVTLA--------------------GQRIAPAG--VPARYPAFDVTPEPLVTA
MTNA_SORC5        EERSRDELAVVG--------------------GRRVVPPG--VPVRHPAFDVTPAELVTA
MTNA_CHLAA        EERDPAEVTHIA--------------------GVAIAPQG--VRAAHPAFDVTPNELVTA
MTNA_HERA2        EQRSTQEVTHIG--------------------QQAIAAAG--IKVAHPAFDVTPAHLVTA
MTNA_ROSS1        EERSSDEVTMLF--------------------GRRIAPEG--VIAAHPAFDVTPADLVTA
MTNA_SYNY3        EERDPVEIYQPE--------------------GNRITPEG--AEFYNPAFDVTPASLITA
MTNA_CROS5        EERDPSELYQIG--------------------NTVIYPDG--VDYYNPAFDVTPADLITG
MTNA_GLOVI        EQRDSEEMRAIE--------------------GVALCPQG--VEFYNPAFDVTPASLVTG
MTNA_PYRHO        EERSPEEVLTCG--------------------GCRIAPD---VPVYNPAFDVTPHKYLTG
MTNA_THET8        EERSPEEVVAFR--------------------GVRIAPEG--FPAYHPAFDVTPHRYLTG
MTNA_HAHCH        EERTSDELKFVQ------------------GTPLA--PEK--ADAFNPVFDVTPAELIDA
MTNA_MARHV        EEREGTEVREIR------------------GIPLA--PAG--VQVFNPVFDVTPASLIDA
MTNA_HALHL        ETRDAREVLYAG------------------GRRIAPESEA--VGAWNPVFDVTPAELVDV
MTNA_NITOC        EQRPPEEVLTLG------------------GKAIA--TVG--AEAYNPAFDVIPAHLIDA
MTNA_XYLFA        EQRDPEELLGVS------------------GVRTV--AEG--IAAWNPVFDVTPGALIDA
MTNA_METCA        EERDPRELLHPL------------------FLGS---DSV--IGAWNPVFDVTPAALIDA
MTNA_PSEE4        ETRGVEELLEVA------------------GIQVT---AD--VEVYNPVVDVTPADLIDV
MTNA_ALCBS        EERDANEVRNVQ------------------GKSLA--PEH--CPVYNPAFDITPAQLITA
MTNA_SERP5        EQRAAVEVTGVTGSF--------------GSCQWA--PVD--APVYNPAFDVTPAALISG
MTNA_YERE8        EQRDASEVKGVSGGF--------------GHCQWA--PAN--APVYNPAFDVTPAALISG
MTNA_KLEP7        EQRAAAEVTGVAGSF--------------GAVQWA--PTG--AAVYNPAFDVTPAGLISG
E3IVW2_FRAIE      EQRPDDEVLLVA------------------GRRVA--PPG--ARAHNPAFDVTPAGLVDA
F8B5D9_FRADG      ELRGGGEVLSHA------------------GSRVA--PAR--SRAHNPAFDVTPAHLVDA
MTNAB_NOCFA       EERAAEEVTAFA------------------GSATA--PVG--TAAFNPAFDVTPADLVTA
M3C5J9_STRMB      EQRPGHEVTEIPVPPQA--AGAGTGA----GVPVA--PLG--AQAYNPAFDITPPELMTA
E2Q5D5_STRC2      EQRSADEVTELAAPVLV--SAAGQDGPSFGGRRTA--PLG--TQAYNPAFDVTPPELVTA
MTNA_RHOBA        EQRSADEVSYPCGTD---------------SPRQT--PEG--VAVVNPAFDVTPAELVTA
MTNA_LEPIC        EMRKEEEITSFGFLKDS--DG------KPLLKEGVIAPKG--MKALNPSFDVTPASLITG
MTNA_LEPBP        EMRKESEVTQFDFLKNE--EG------NFLFPEGKTSPIG--ARALNPSFDITKAKFIKN
MTNA_UNCRE        EERQSSEVTKIRGPCEG----DGDHREA---VMETIKIAADGIDVWNPAFDVTPAALIDA
MTNA_ARTOC        EERAKSEVTRITGPRIS----DLGKNEENI-TLETVNIAAPGIDVWNPAFDVTPYDLIDA
MTNA_YARLI        EERPAIELTQVKGVDAN----KQP---------LTVSVAAPGIEVWNPAFDYAPYKLIDA
MTNA_VERA1        EERKREELTQISGATVG----SDGSVDVA--KTVRVATADQRIDVWNPAFDVTPHDLIDA
MTNA_SCHPO        EQRPPIEMTTITGPIIT----DSNSRNLEDPKRVRISIAAPGIDVYSPAFDVTPANLITA
MTNA_SCHJY        EERPSRELVMVRGPVVR----DFTTHQFG--ARESVHIAPINVKAYCPVFDVTPADLISA
MTNA_ASHGO        EERCPDEFRVVTGAAAG---------ATGDPTTASVAIAPRDMPVWNPAFDVTPHAYIDA
MTNA_CANGA        EERNANEFKIVTGSAVDMQTNKPILDEKNEPITAKVGIAPENINVWNPAFDITSFEYIDG
MTNA_KLULA        EERPPNEFRFVQGTLIDGTDPTPVLNESKTPVKAKVGITPLDMPVWNPSFDITPYTHIDG
MTNA_PICST        EERPANELTT-LKGPVL-REDGSIGDKY------TVGIATPGISVWNPAFDVTPHALIDA
MTNA_PICGU        EERPANELTT-LKGPIL-RKD-VAGEKQ------IVGVATPGIQVWNPAFDVTPHELIDS
MTNA_KOMPG        EQRPANELTSILGGQVD-SSDQFVTDSEGKVNLLRIKTATPNIDVWNPAFDVTPNRLIDS
MTNA_THAPS        EERPDGEMLESSGAPKG-------------------------MKCWNPAFDVTPAKYISG
MTNA_CAEEL        EERPSAEMLRVNGVLIG----------------------NSECPVWNPAFDVTPAHLITK
MTNA_CAEBR        EERAASELLRVNGVLVG----------------------NSECPVWNPAFDVTPAHLITK
                  : *   *                                          .*      :  

MTNA_POSPM        -IVTEKGVAVKRDGESTFDLTSIV----------------------
MTNA_CRYNJ        -VVTEKGVAERKEGEKSIDVASIC----------------------
MTNA_ANOGA        -IITERGVLKPCELAEKVRQK-------------------------
MTNA_DROGR        -IITEHGVFKPSTLKDEIAKLIEL----------------------
MTNA_HUMAN        GIITELGVFAPEELRTALTTTISSRDGTLDGPQM------------
MTNA_XENTR        -IITERGVFKPEELRDGLTKGQ------------------------
MTNA_NEMVE        -IVTEHGTFSPQEMKDKLLALKG-----------------------
MTNA_TRIAD        -IITEVGVFSPSEMKSKLQTILNS----------------------
MTNA_MONBE        -IITERGVAYKAEGQQEFDMASFAASVGRA----------------
MTNA_NAEGR        -FFTDIGVFTPLTCATTGKKYYDLKTQQAEKLKQQ-----------
MTNA_ORYSJ        -IITEKGVITKSDADETFNIKDFIQSAKLYSTMQ------------
MTNA_OSTLU        -VITEHGVIEKNASGLFPVADFVAQAKGGT----------------
MTNA2_TRYCC       GIITERGVLQPSATAPFFDITRIVSAS-------------------
MTNA_CALS8        -IITEKGVVFPPFEENISKLKEK-----------------------
MTNA_SULSY        -IITEKGIIEKPNKEKILKFFGRKLS--------------------
MTNA_CALS4        -IITEKGIIRPPFRENILKLR-------------------------
MTNA_NATTJ        -IITEKGIIGPNNREIMTIQE-------------------------
MTNA_METJA        -IITEKGIVKPNRDEILKLFR-------------------------
MTNA_METST        -IITEEGIKKPL----------------------------------
MTNA_AERPE        -FITDRGVIEPPFDVNIRRTLED-----------------------
MTNA_ARCFU        -LITEYGVIYPPYEVNVPKVLKF-----------------------
MTNA_METAC        -IITDKGVFYPPFLLDEVLV--------------------------
MTNA_SULAC        -IITEYGIIYPPFDKNMRRMLGK-----------------------
A8MBP9_CALMQ      -IITEKGIIYPPFDKNVNRVINGGGGYG------------------
MTNA_METPB        -LITERGVCAATEEGLAGLYPERRKAA-------------------
MTNA_RHORT        -LITERGVCAASAAGLAGLYPERAPAPVPAGSAAGKGAAATADGAL
MTNA_SINMW        -LITERGVADASPEGLKALFPERS----------------------
M9RDG3_9RHOB      -LITERGICDASEAGLTAMFPDLSG---------------------
MTNA_GLUOX        -LITERGRCDASEAGLQSLFPEQTKAH-------------------
MTNA_DESOH        -FITERGVCGAGRDQVLALFPEKR----------------------
MTNA_DESAL        -LITERGLCKASEEGVRSLFPDKMK---------------------
E4U607_OCEP5      -LITERGIAAASEAGLLELYPERR----------------------
K9Z7E6_CYAAP      -LITERGICQASKEGIFSLYPEKIN---------------------
F5Y6P1_TREAZ      -LITERGICPASEQGISSLYPEEINEQ-------------------
MTNA_DECAR        -IITERGVCPASRDGLLALYPEEARG--------------------
MTNA_SULDN        -LITNKGVCRANFDEIKEKFRG------------------------
B9XAE7_PEDPL      -IITPAGVFKPKELWGRRKQLGFIG---------------------
M4YU26_THEXX      -FITEKGIFKPSEIAEMKE---------------------------
M1Z5A0_9FIRM      -IISEEGIIRAPYLTQLLRLKK------------------------
MTNA_CHLTE        -IITEKGAVVGNYNEGLARVVNG-----------------------
MTNA_SYNP6        -IITERGILYPPYGQALEQVLINPG---------------------
MTNA_SYNS9        -LITEFGVIRSPSRESIASLPFAN----------------------
MTNA2_PSELT       -IITEKGIVYPPFKENLRKLFESA----------------------
MTNA_HUNT2        -IITEKGIIYPPYDENIKKYR-------------------------
MTNA_DEHM1        -FITENGIIRREAKN-------------------------------
MTNA_BACSU        -IITEKGIMTGNYEEEIEQLFKGEKVH-------------------
MTNA_BACCN        -IITEKGILQGDYTKEIASLFEK-----------------------
MTNA_EXIS2        -IITELGVIEHPDVETIKRTIGQHTH--------------------
MTNA_HELMI        -FITDRGVFRPPYLETLRAMAETK----------------------
MTNA_CARHZ        -IITDRGIVRPPYKENIKKLFGGK----------------------
MTNA_DESAP        -LITDAGVLKPPFGEALRRAVGSGRRE-------------------
MTNA_DESHY        -IITEKGIVTSPYSVNLLKMMVRS----------------------
MTNA_SYNWW        -IICEKGIIRPPFGAAIKIWGREGE---------------------
MTNA_DESAG        -IVTEQGVLRPPYTASIARAFAAADKDRS-----------------
MTNA_DESVH        -IVTEMGVLRAPYRESIAEAFRKAGL--------------------
MTNA_PELCD        -IITERGVVRGDYVRGLANLF-------------------------
MTNA_SOLUE        -IITEKGVAHAPYEESLKKLVTTK----------------------
MTNA_SYNAS        -IITEAGIAEFPYESSLERLFLSFP---------------------
MTNA_SYNFM        -IITEVGILSKPFGRAIRQALKA-----------------------
MTNA_RHOFT        -LITERGVLRQPNRTTIAGLFAT-----------------------
MTNA_MAGMM        -FICEKGVAKAPDQEKIAKLFQI-----------------------
MTNA_ANADF        -IITERGVVRRPFAPGLAALAAR-----------------------
MTNA_SORC5        -VFTERGKLTTREISRSVPPAAPAG---------------------
MTNA_CHLAA        -IITERGIVRPPYLAALRQLESGR----------------------
MTNA_HERA2        -IITEQGIAYPPFAEQLQTMVEAANAANAGK---------------
MTNA_ROSS1        -IITECGVIYPPFAGALQRSGPKRH---------------------
MTNA_SYNY3        -IITEQGAIAPEKLADLQA---------------------------
MTNA_CROS5        -IITEQKTVNPKELITLKG---------------------------
MTNA_GLOVI        -IIVESGVYAPGELAAAGQVRLGR----------------------
MTNA_PYRHO        -IITDRGVVWPPFKRNLKKLFEVNKSGGDEAV--------------
MTNA_THET8        -IITEKGVLYPPFAEGLRRALGLD----------------------
MTNA_HAHCH        -IVTERGVVLRPNAEKMLKLQ-------------------------
MTNA_MARHV        -IVTEKGAVRNPNITGMRALFT------------------------
MTNA_HALHL        -IVTERGVVHQPDADGIARLFEGAG---------------------
MTNA_NITOC        -IVTERGVVRQPTHERMKALFG------------------------
MTNA_XYLFA        -IVTERGVIQSPDAAQMRATFGN-----------------------
MTNA_METCA        -IVTEAGVVTNPSPDTMATLRGKAR---------------------
MTNA_PSEE4        -IVTEKGVVERPDAAKIAQLMCRKRLH-------------------
MTNA_ALCBS        -IVTERGVVHRPDTAKINSHLAQTKES-------------------
MTNA_SERP5        -WVFDSGVITP--QQVSEGIFQRALG--------------------
MTNA_YERE8        -WVLDSGVITP--GQVAAGFFQPKN---------------------
MTNA_KLEP7        -WVLDSGVVTP--AQVAAGAFAPDNG--------------------
E3IVW2_FRAIE      -LITEQG------ARLPASPFTR-----------------------
F8B5D9_FRADG      -LVTEHGIVEVARGQCPQPPAPSR----------------------
MTNAB_NOCFA       -VVTEHG--------VVHG>--------------------------
M3C5J9_STRMB      -IVTENGVVSPVTKAGLAELCDRSRSGNGMMSI-------------
E2Q5D5_STRC2      -IVTEEGVLSPVTREGVTEVCAKARRVVSG----------------
MTNA_RHOBA        -LITEKGVISEPDTAKVRAHLGL-----------------------
MTNA_LEPIC        -IITEKGIVSPVTEENLKKIFQSI----------------------
MTNA_LEPBP        -FITELGCFVP---EEISFRLKNV----------------------
MTNA_UNCRE        IVTEV-GVETKDSSGQFHLSSLFESMA-------------------
MTNA_ARTOC        IVTEV-GVAEKNADGLFQLEKLFGFP--------------------
MTNA_YARLI        IVTEK-GVAEK-TGGEFNLKEFKSAN--------------------
MTNA_VERA1        VVTEK-GAVVKGTNGEFDFSHVMPERWARLVGQQ------------
MTNA_SCHPO        IATEK-GFYTQQTNNKYDFS--------------------------
MTNA_SCHJY        VVTEK-AVFTKGPNG-YEFKW-------------------------
MTNA_ASHGO        IVTET-RVFTKDAAGNFDLDELFT----------------------
MTNA_CANGA        IVTEV-GVFTKNENGNFDLSALH-----------------------
MTNA_KLULA        IITEK-GVFAKDENGNFHLETAFQ----------------------
MTNA_PICST        IVTEEEKVYTKNSHGEFELSK-------------------------
MTNA_PICGU        IVTEE-KVYAKDKEGNYHL---------------------------
MTNA_KOMPG        IVTEQ-DYLVKDSHGKFNL---------------------------
MTNA_THAPS        IITEK-GVLKPSADGTFDVKGFVSMHS-------------------
MTNA_CAEEL        ILTDFGNWPPEMLEQQIPK---------------------------
MTNA_CAEBR        ILTDFGNWSPAALEEQIPR---------------------------