CLUSTAL format seed alignment for MF_01681

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

MTNC_GLUDA      MTASTDAIDSVLLDIEGTTIPVAFVHQVLFPYARAAMPGLLAQRA--DDPAVRAAVADIA
MTNC_GLUOX      ------MIRLVLLDIEGTTLPISFVRDVMFPYAAKALPALM-QDH--TNPIVVGARADIV
MTNC_ACICJ      ---MTTRPELVLLDIEGTIAPISFVHDVLFPYARARLAGFVAAHG--DEPEIAAALAELD
MTNC_GRABC      ----MNPPKAILTDIEGTTTPIAFVHRVLFPYAKANMAGFLAAYS--DDEAVAAILAEVE
MTNC_PARL1      ----MTAVRAVVTDIEGTTTPLAFVHEVLFPYARARLADFVAANA--DDEEVAAALGDAR
MTNC_XANP2      -----MTIKAILTDIEGAAGPASFLKDILLPYAREHLGAFIAAHA--EDDGIEEALEEAG
MTNC_FRAAA      MSSPRPSAELALLDIEGTTSPTAAVLSSLFPYARARLGPWVRDHG--DDPEVRRIVAEAR
MTNC_SACEN      -MSASVAARWVVLDIEGTLTPTSQVHVVLYDYARPRLGPWIHDHP--EDPVVRKAVEDVK
MTNC_NOCFA      ------MTTAIVLDIEGTTSPTGAVREDLYGYTRARLPEWLA-RH--RDDAAAPILAATR
MTNC_STRAW      -MSSVFDIDSVVLDIEGTTSATGFVVDVLYPYSRSRFGALLTERS--GDPEVARAVAQVR
MTNC_SORC5      --MAALPARAVLVDIEGTTTDVRFVHDTLFSVARRDLAAYVSAHA--GGPEVEAARRAVA
MTNC_BRASB      -MALVLDAEVVLLDIEGTIASQSFVLDVLFGYSRARMADFVAARR--GDPEIEAILADVA
MTNC_KLEOX      ------MIRAIVTDIEGTTSDIRFVHNVLFPYARERLAGFVTAQQ--FVEPVKTILDNLR
MTNC_KLEP7      ------MIRAIVTDIEGTTSDIRFVHNVLFPYARERLAGFVTAQQ--HAEPVKTILDNLR
MTNC_CITK8      ------MIRAIVTDIEGTTSDIRFVHNVLFPYARERLAAFVTARQ--YAEPVKSILDNLR
MTNC_ENT38      ------MIRAIVTDIEGTTSDIRFVHNVLFPYARERLAAFVTAQQ--YAEPVKSILDNLR
MTNC_CROS8      ------MIRAIVTDIEGTTTDIRFVHNVLFPYARERLERFIRSGE--QREPVNLLLNELR
MTNC_CROSK      ------MIRAIVTDIEGTTTDIRFVHNVLFPYARERLERFIRSGE--QREPVNLLLNELR
MTNC_ERWT9      ------MIRAIVTDIEGTTSDIRFVHNVLFPYARENLPSFIIGNQ--QQPAVAQALDQLR
MTNC_PECAS      ------MIKAIVTDIEGTTSDIRFVHSVLFPYARERLADTVRQHD--SDPEIAQVLNALR
MTNC_SERP5      ------MIRAIVTDIEGTTSDIRFVHQVLFPYARERLATFLRLHA--EDAEVAAPLTALR
MTNC_YERPG      ------MIQAIVTDIEGTTTDIRFVHQVLFPYARERLTPFLRAHQ--QDDDIAALLVDLR
MTNC_YERPP      ------MIQAIVTDIEGTTTDIRFVHQVLFPYARERLTPFLRAHQ--QDDDIAALLVDLR
MTNC_YERPY      ------MIQAIVTDIEGTTTDIRFVHQVLFPYARERLTPFLRAHQ--QDDDIAALLVDLR
MTNC_YERP3      ------MIQVIVTDIEGTTTDIRFVHQVLFPYARERLTPFLRAHQ--QDDDIAALLVDLR
MTNC_YERPB      ------MIQAIVTDIEGTTTDIRFVHQVLFPYARERLTPFLRAHQ--QDDDITALLVDLR
MTNC_YERPS      ------MIQAIVTDIEGTTTDIRFVHQVLFPYARERLTPFLRAHQ--QDDDITALLVDLR
MTNC_YERE8      ------MIQAIVTDIEGTTTDIRFVQQVLFPYARERLTPFLREHQ--QDEEVANALLSLR
MTNC_METCA      ------MIRAILTDIEGTTSSLSFVKETLFPYARARMADFVRGHA--RDATVQALLADAK
MTNC_STRM5      -----MQPRVILTDIEGTTSSISFVKNVLFPYARKALPAFVAEHG--QQPEVRRWLDAVA
MTNC_STRMK      -----MQPRVILTDIEGTTSSISFVKNVLFPYARKALPAFVAEHG--QQPEVRRWLDAVA
MTNC_XANAC      ----MTRPQAILTDIEGTTSSISFVKDVLFPYARRAMPAYVRDHG--NHPQVRHWLNQVA
MTNC_XANC5      ----MTRPQAILTDIEGTTSSISFVKDVLFPYARRAMPAYVREHG--NHPQVRHWLNQVA
MTNC_XANC8      ----MTRPQAILTDIEGTTSSISFVKDVLFPYARRAMPAYVREHG--GHPQVRHWLNQVA
MTNC_XANCP      ----MTRPQAILTDIEGTTSSISFVKDVLFPYARRAMPAYVREHG--GHPQVRHWLNQVA
MTNC_XANCB      ----MTRPQAILTDIEGTTSSISFVKDVLFPYARRAMPAYVREHG--GHPQVRHWLNQVA
MTNC_XANOM      ----MTRPQAILTDIEGTTSSISFVKDVLFPYARRAMPAYVREHG--NHPQVRHWLNQVA
MTNC_XANOP      ----MTRPQAILTDIEGTTSSISFVKDVLFPYARRAMPAYVREHG--NHPQVRHWLNQVA
MTNC_XANOR      ----MTRPQAILTDIEGTTSSISFVKDVLFPYARRAMPAYVREHG--NHPQVRHWLNQVA
MTNC_XYLF2      ----MSMPQAILTDIEGTTSSLSFVKEVLFPYARRALPDFVREHR--EHPDVMPWLDQVA
MTNC_XYLFT      ----MSMPQAILTDIEGTTSSLSFVKEVLFPYARRALPDFVREHR--EHPDVMPWLDQVA
MTNC_XYLFM      ----MSMPQAILTDIEGTTSSLSFVKEVLFPYARRALPDFVREHR--EHPDVMPWLDQVA
MTNC_XYLFA      ----MSMPQAILTDIEGTTSSLSFVKDVLFPYARRALPDFVREHR--EHPDVMPWLDQVA
MTNC_ALCBS      ------MINAIITDIEGTTSSIAFVKEVLFPYAAKRFPDFLADHW--DHPCVQEQIKAAE
MTNC_HAHCH      -MAEFNGIRAIVTDIEGTTSSISFVHEVLFPYAAKHMDAFIRENF--SAPAVAEQLDEVA
MTNC_MARN8      ------MIRVILTDIEGTTSSISFVHDVLFPYASEHLPEFIRANHH-TLPAVAEQLVRVA
MTNC_PSE14      -----MPIKAILTDIEGTTSAVSFVFDVLFPFAKKHLPGFVRQNA--GQPAVASQLQAVR
MTNC_PSEU2      -----MPIKAILTDIEGTTSAVSFVFDVLFPFARKHLPAFVREHA--EQPAVAQQLQAVR
MTNC_PSESM      -----MPIKAILTDIEGTTSAVSFVFDVLFPFARAHLPDFVRQHA--EQPQVAAQLQAVR
MTNC_PSEPF      -----MSIKVILTDIEGTTSAVSFVFDVLFPYAAKHLPDFVRQNA--QRADVAEQLDAVR
MTNC_PSEAB      -----MTIKAILTDIEGTTSAVSFVFDVLFPYAARHLPDFVREHA--GEPEVAAQLAAVR
MTNC_PSEAE      -----MTIKAILTDIEGTTSAVSFVFDVLFPYAARHLPDFVREHA--GETEVAAQLAAVR
MTNC_PSEA7      -----MTIKAILTDIEGTTSAVSFVFEVLFPYAARHLPDFVREHA--GEAEVAAQLDAVR
MTNC_SYNP2      ------MIQFVLMDIEGTTTSVSFVFDVLFPYFRDNIQSIASRAEEPEIAAILKQVQDLA
MTNC_AQUAE      ------MVKAILLDIEGTIAPLSFVKEVMFPYSKKKLREFLEKNW--EKPEIKKIVQEVE
MTNC_HYDS0      ------MIKAILTDIEGTTSSINYVKDVMFGYSKKRLKDYLQTHW--EEEHVKNIVKSLS
MTNC_SULSY      ------MIKAILTDIEGTTTPISFVKDVLFPYSYEKIEEFVKNNL--QNPQVQKIIEDVK
MTNC_SHEB5      -----MGIRAIVVDTAGTTTDLNFIQDVLFPYSVKALPDFLEQNQ--HNVLVENCICDTR
MTNC_SHEB8      -----MGIRAIVVDTAGTTTDLNFIQDVLFPYSVKALPDFLEQNQ--HNVLVENCICDTR
MTNC_SHEB9      -----MGIRAIVVDTAGTTTDLNFIQDVLFPYSVKALPDFLEQNQ--HNVLVENCICDTR
MTNC_SHEPC      -----MGIRAIVVDTAGTTTDLNFIQDVLFPYSVKALPDFLEQNQ--HNVLVENCICDTK
MTNC_SHESW      -----MGIRAIVVDTAGTTTDLNFIQDVLFPYSVKALPDFLEQNQ--HNVLVENCICDTK
MTNC_SHEON      -----MGIRAIVVDTAGTTTDLTFIQDVLFPYSVKALPDFLAQNQ--HNVLVENCICDTR
MTNC_SHESM      -----MGIRAIVVDTAGTTTDLTFIQDVLFPYSVKALPDFLAQNQ--HNVLVENCICDTR
MTNC_SHESR      -----MGIRAIVVDTAGTTTDLTFIQDVLFPYSVKALPDFLAQNQ--HNVLVENCICDTR
MTNC_SHESA      -----MGIRAIVVDTAGTTTDLTFIQDVLFPYSVKALPDFLAQNQ--HNVLVENCICDTR
MTNC_SHEHH      -----MGIRAIVVDTAGTTTDLNFIEEILFPYSAKALPAFLEENQ--HNVLVENCICDVQ
MTNC_SHEPA      -----MGIRAIVVDTAGTTTDLNFIEDVLFPYSAKALPAFLEENQ--NNVLVDNCICDVQ
MTNC_SHESH      -----MGIRAIVVDTAGTTTDLSFIKDTLFPYSAKALPDFLKENE--HNVLVENCICDVR
MTNC_SHEWM      -----MGIRAIVVDTAGTTTDLNFIKDTLFTYSAKALPDFLKENE--TNVLVDNCICDVR
MTNC_SHELP      -----MGIRAIVVDTAGTTTDLNFIQDTLFPYSSKALADFLEENQ--TNVLVDNCISDVK
MTNC_SHEAM      -----MGIRAIVVDTAGTTTDLNFIQQTLFPYSAKVMADFLREHQ--HNPLVDYCIGDVR
MTNC_SHEFN      -----MSIRAIIVDTAGTTTDLNFIQDVLFPYSRKAMAEFLEQNQ--HNVVVDYCISDVK
MTNC_SHEDO      -----MSIKAIVVDTAGTTTDLNFIQDVLFPYSHQVMASFLAQNQ--QQVLVESCINDVR
MTNC_SYNE7      -MPLPVSITTLLLDIEGTTTPVDFVFKVLFPYARDRVADFLATQG--ADPEVQADLDLLR
MTNC_SYNP6      -MPLPVSITTLLLDIEGTTTPVDFVFKVLFPYARDRVADFLATQG--ADPEVQADLDLLR
MTNC_SYNR3      -MIDWESLRAIVLDIEGTTCPVDFVTGSLFPYARQHLGTLLSQDD--QQAPLKPLLDEVR
MTNC_PROM3      -----------MLDIEGTTCPTSFVSDTLYPYAYSHLEGFLNEHR--ENNEIQSLIDEAW
MTNC_PROMM      ------MITHILLDIEGTTCPTSFVSDTLFPYADTHLEGFLNEHI--ENNEVQSLIDEAW
MTNC_PARMW      -----MSITHLLIDIEGTTCPVSFVSEVLFPYAKQSLSSYLNDHQ--EDLDLKNILQEAE
MTNC_SYNSC      -----MNQQHLLLDIEGTTCPVRFVSDTLFPFAKKELSRYITQNW--DKRPHSKSIRAAW
MTNC_SYNS9      ------MISHILLDIEGTTCPVTFVTETLFPYAQLALKDFLERHK--DDPSISQLINNAE
MTNC_SYNPW      ------MIKAIVLDIEGTTCPVTFVSQTLFPFARRQLSKTICSEN--RPSNVTAAIEEAI
MTNC_LEPBA      -----MQIKHNLLDIEGTTAPIAFVHQILFPYATKNIHRFLKEYQ-LTELQWKEVQTEFQ
MTNC_LEPBP      -----MQIKHNLLDIEGTTAPIAFVHQILFPYATKNIHRFLKEYQ-LTELQWKEVQTEFQ
MTNC_LEPBJ      -----MDFEIYLFDIEGTTTPIEFVHKILFPYSVGKFETFFRSNS-LERKWIEKLLEEGK
MTNC_LEPBL      -----MDFEIYLFDIEGTTTPIEFVHKILFPYSVGKFETFFRSNS-LERKWIEKLLEEGK
MTNC_LEPIC      --MNIKTFEFYLFDIEGTTTPIEFVHKILFPYSVEKFDSFFQSNL-LEKEWIEKLILEGK
MTNC_LEPIN      --MNIKTFEFYLFDIEGTTTPIEFVHKILFPYSVEKFDSFFQSNL-LEKEWIEKLILEGK
                           : *  *:      :   :       .                       

MTNC_GLUDA      ----------------------ALAP-------GVPPLDQLNAWMDRDEKIGPLKALQGL
MTNC_GLUOX      ----------------------MEHP-------GQDPLKVCQDWMKADVKAAPLKTLQGL
MTNC_ACICJ      ----------------------AIAP-------GAPPVETLLALMDRDAKVGPLKLIQGR
MTNC_GRABC      ----------------------AQYP-------GRPALETLLGWMDEDAKITPLKALQGL
MTNC_PARL1      ----------------------ELGGI--AGAGDAETLQLLLAWMDEDRKAGPLKLLQGL
MTNC_XANP2      ----------------------RLMGG--FSLKPDEAEALLQRWMKQGRNPTPLKIIQGR
MTNC_FRAAA      ----------------------SLLG--EADAPVQRVVAALTRWSDDDRKVAPLKALQGL
MTNC_SACEN      ----------------------SEAGL-PAEATAEQVVAVLHGWMDADRKAAPLKTLQGL
MTNC_NOCFA      ----------------------ELAG--RPDADTDEVARILREWLGSDVKAEPLKEAQGL
MTNC_STRAW      ----------------------ELLG--EPDADAVRVEKALNEWLDDDRKATPLKTLQGL
MTNC_SORC5      ----------------------RERGESEQAVSDGELAAALLAWIDQDRKETTLKALQGK
MTNC_BRASB      ----------------------ARAG-------GTDPVAALLAWQDADQKIPPLKKLQGR
MTNC_KLEOX      ----------------------EEIAQ--PAAGAEELIATLFAFMDEDRKSTALKALQGI
MTNC_KLEP7      ----------------------RETDA--PAASTADLITTLFAFMDEDRKSTALKALQGI
MTNC_CITK8      ----------------------NEIAR--PDASTAELIETLFTFMDEDRKSTALKALQGI
MTNC_ENT38      ----------------------DEIAA--PHATIGELVDALFTFMDEDRKSTALKALQGI
MTNC_CROS8      ----------------------GEIHA--PAASVDQLIETLFKFMDEDRKSPALKSIQGY
MTNC_CROSK      ----------------------GEIHA--PAASVDQLIETLFKFMDEDRKSPALKSIQGY
MTNC_ERWT9      ----------------------AEVER--PEATVQELIDVLFGFMDEDRKSTALKALQGM
MTNC_PECAS      ----------------------QELAQ--PDADSDTLIAALNQFMDEDRKSTSLKLLQGI
MTNC_SERP5      ----------------------QELDQ--PQADIEQLIAALYRFMDEDRKSTALKALQGI
MTNC_YERPG      ----------------------REIAQ--PDADIETLITVLHGFMDEDRKSTVLKAIQGI
MTNC_YERPP      ----------------------REIAQ--PDADIETLITVLHGFMDEDRKSTVLKAIQGI
MTNC_YERPY      ----------------------REIAQ--PDADIETLITVLHGFMDEDRKSTVLKAIQGI
MTNC_YERP3      ----------------------REIAQ--PDADIETLITVLHGFMDEDRKSTVLKAIQGI
MTNC_YERPB      ----------------------REIAQ--PDADIETLITVLHGFMDEDRKSTVLKAIQGI
MTNC_YERPS      ----------------------REIAQ--PDADIETLITVLHGFMDEDRKSTVLKAIQGI
MTNC_YERE8      ----------------------REVEQ--PDADIETLITTLHSFMDEDRKSTALKAIQGI
MTNC_METCA      ----------------------AAAGD--PSMDDEHVIARLVRWIDEDRKITPLKALQGL
MTNC_STRM5      ----------------------TEIGG--AC-QDSLVAETLQGWIDQDRKHTALKALQGL
MTNC_STRMK      ----------------------TEIGG--AC-QDSLVAETLQGWIDQDRKHTALKALQGL
MTNC_XANAC      ----------------------DEIGE--DV-PDEVLITTLQTWIDEDRKHTALKALQGL
MTNC_XANC5      ----------------------DEIGE--DV-PDEVLITTLQTWIDEDRKHTALKALQGL
MTNC_XANC8      ----------------------DEIGE--DV-PDEVLITTLQTWIDEDRKHTALKALQGM
MTNC_XANCP      ----------------------DEIGE--DV-PDEVLITTLQTWIDEDRKHTALKALQGM
MTNC_XANCB      ----------------------DEIGE--DV-PDEVLITTLQTWIDEDRKHTALKALQGM
MTNC_XANOM      ----------------------DEIGE--DV-PDDVLITTLQTWIDEDRKHTALKALQGL
MTNC_XANOP      ----------------------DEIGE--DV-PDDVLITTLQTWIDEDRKHTALKALQGL
MTNC_XANOR      ----------------------DEIGE--DV-PDDVLITTLQTWIDEDRKHTALKALQGL
MTNC_XYLF2      ----------------------NETGT--AF-SEEALVATLQTWIDTDSKHTALKALQGM
MTNC_XYLFT      ----------------------NETGT--AF-SEEALVATLQTWIDTDSKHTALKALQGM
MTNC_XYLFM      ----------------------NETGT--AF-SEEALVATLQTWIDTDSKHTALKALQGM
MTNC_XYLFA      ----------------------NETGT--AF-SEEALVATLQTWIDTDSKHTALKALQGM
MTNC_ALCBS      ----------------------KESGE--TLGSADKAAALFLRWIEEDRKATPLKTLQGM
MTNC_HAHCH      ----------------------RLGGV--DRKSPDALIKQLLDWIAEDKKITPLKALQGM
MTNC_MARN8      ----------------------EISGT--DRKDIDGLINVLQEWIAEDRKEGALKALQGM
MTNC_PSE14      ----------------------TEAGE--PDADVERVIAILLEWIAEDRKATPLKALQGM
MTNC_PSEU2      ----------------------DLAGE--PDADVERVIALLLEWIAEDRKATPLKALQGM
MTNC_PSESM      ----------------------TQSAE--PDADVERVIAILLEWIAEDRKATPLKALQGM
MTNC_PSEPF      ----------------------RDSNE--PQADVERVVEILLAWIAEDRKATPLKALQGM
MTNC_PSEAB      ----------------------AESGE--ADADVERAIAILLQWIAEDRKATPLKALQGM
MTNC_PSEAE      ----------------------AESGE--ADADVERVIAILLQWIAEDRKATPLKALQGM
MTNC_PSEA7      ----------------------AASGE--ADAGVERVIAILLQWIAEDRKATPLKTLQGM
MTNC_SYNP2      ----------------------LTETG--TSLDQTGAIATLHQWSVEDRKVAPLKAMQGF
MTNC_AQUAE      ----------------------KIEGR---ELSLEEAVQLFSRWIDEDRKITPLKELQGH
MTNC_HYDS0      ----------------------QKLEK---NIDLQTAVLVFKDFIEKDIKDTLLKELQGH
MTNC_SULSY      ----------------------KEINK--SDASLEEVIENLKSWIVEDKKITPLKELQGL
MTNC_SHEB5      ----------------------DIALE--PDADLARVTEILQQWVSEDRKATPLKTLQGL
MTNC_SHEB8      ----------------------DIALE--PDADLARVTEILQQWVSEDRKATPLKTLQGL
MTNC_SHEB9      ----------------------DIALE--PDADLARVTEILQQWVSEDRKATPLKTLQGL
MTNC_SHEPC      ----------------------DIALE--PEADLARVTEILQQWVNEDRKATPLKTLQGL
MTNC_SHESW      ----------------------DIALE--PEADLARVTEILQQWVNEDRKATPLKTLQGL
MTNC_SHEON      ----------------------DIALE--PDADLNRVTEILQQWVREDRKATPLKTLQGL
MTNC_SHESM      ----------------------DIALE--PDADLARVTEILQQWVHEDRKATPLKTLQGL
MTNC_SHESR      ----------------------DIALE--PDADLARVTEILQQWVHEDRKATPLKTLQGL
MTNC_SHESA      ----------------------DIALE--PDANLARVTEILQQWVHEDRKATPLKTLQGL
MTNC_SHEHH      ----------------------DIALE--PDASLARVTEILLQWIKEDRKATPLKTIQGL
MTNC_SHEPA      ----------------------DIALE--PDASLARVTEILLQWIEEDRKATPLKTIQGL
MTNC_SHESH      ----------------------DIALE--PEATLERVIEILQQWVAEDRKSTPLKTLQGL
MTNC_SHEWM      ----------------------DIALE--PDASLERVVEILQQWVEEDRKATPLKTLQGL
MTNC_SHELP      ----------------------DIALE--PDASLERVVEILQQWIAEDRKATPLKTLQGL
MTNC_SHEAM      ----------------------DIALE--TDADIDRVAEILVQWIAEDRKVTPLKTLQGL
MTNC_SHEFN      ----------------------DIALE--PDATLERVTEILQQWIDEDRKLTPLKTLQGL
MTNC_SHEDO      ----------------------DIALE--PSATVARVAEILQIWITEDRKLAPLKTLQGL
MTNC_SYNE7      QEYAQEAA--------------AELPDWA-GEDAIAAVPYIQWLIDSDRKSTGLKSLQGK
MTNC_SYNP6      QEYAQEAA--------------AELPDWA-GEDAIAAVPYIQWLIDSDRKSTGLKSLQGK
MTNC_SYNR3      IAWKHENS--------------AEAPAYSDSQDPLALLPYLQWLIDQDRKLAPLKELQGL
MTNC_PROM3      REWQADTDA--------SSKDLLSKALRKNSSEIVNICSYLHHLITIDRKSSALKDLQGR
MTNC_PROMM      HEWQADEDP--------SSKDLLSKAFRENSSEIENICSYLHHLITIDRKSSALKDLQGR
MTNC_PARMW      REWDGDPSP--------DSIKLRQATRNQNLNFIDSIKVYFEYLINVDRKSTALKDLQGK
MTNC_SYNSC      KEWMDDQSA--------ESMIIKQQVTQCEIEEVEGLIQYLKHLISIDRKSTALKDLQGK
MTNC_SYNS9      DEWMQDQDK--------QSATLRHSSEEIQQPKHLKIESYLQLLIASDKKSTALKDIQGK
MTNC_SYNPW      AEWKNDPES--------KSQALLLRASNQNQPTSEDIIHYFDHLIQNDRKSTALKELQGI
MTNC_LEPBA      KDTSSGDPLFIEKFRIKNVPSGLIVNEVPNTLSKDMVSVYFEYLIEKDRKFGPLKEIQGK
MTNC_LEPBP      KDTSSGDPLFIEKFRIKNVPSGLIVNEVPNTLSKDMVSVYFEYLIEKDRKFGPLKEIQGK
MTNC_LEPBJ      RDS---------------TYSRQLTDSPQN------LSDYCKYLVSVDRKSGPLKEIQGR
MTNC_LEPBL      RDS---------------TYSRQLTDSPQN------LSDYCKYLVSVDRKSGPLKEIQGR
MTNC_LEPIC      NDT---------------TYSGKLSDSAFD------LSEYCKHLVSLDRKSGILKEIQGR
MTNC_LEPIN      NDT---------------TYSGKLSDSAFD------LSEYCKHLVSLDRKSGILKEIQGR
                                                               . :   **  ** 

MTNC_GLUDA      AWEEGYRTGALRATLYPDVVPALRRWRAAGLRLAVYSSGSEAAQRLIYGHTTDGDVAGLF
MTNC_GLUOX      TWRQGFEDGTLQADLYPDVPPALKAWSKGGLRLAVYSSGSIPSQKLLYGHTAQGDLTPLF
MTNC_ACICJ      IWAEGFAEGALTSRLYPDVAPVLRAWHGSGLRLAIYSSGSEEAQRLLLGHTPDGGLTALF
MTNC_GRABC      IWREGYRNGALQAQVHPDAAQSLRAWHEAGLNLFVYSSGSVEAQQLLFSYSDQGDLSLLF
MTNC_PARL1      IWRHGYEEGVLKGEIYADAAAALRLWHGRGLRLFVYSSGSEAAQRLIFGHSDQGDLGPCF
MTNC_XANP2      IWQQGYEAGAFTAEIFPDVAPSLGAWKNAGIRLFTYSSSSELAQRLWLGSAG----AEVF
MTNC_FRAAA      IWAAGFAAGELTGELFDDVAPALRRWHAAGVRLAVFSSGSVLAQRAWFAATPAGDLTGLF
MTNC_SACEN      IWQDGYARGELTTDYFADVVPALRAWRQRGLVLAVFSSGSVAGQVASFSHTTSGDLRGLF
MTNC_NOCFA      ICHEGFATGALHGEFFPDVPPALRAWHAAGHRLCVYSSGSLRNQRDWFAHARGGELGSLI
MTNC_STRAW      VWSEGFARGELVSHFYDDVVPALRAWHAAGVRLHVYSSGSVAAQRAWFRSSPEGDLLPLV
MTNC_SORC5      IWRSAYESGGLRSHVYADVEPALRRWRDLGVTLAVFSSGSVEAQQLLFRHTTSGDLTGLF
MTNC_BRASB      IWESGYKEGAYVSHIYDDALIALRRFKAAGLPLYIFSSGSVQAQIQYFQFSSAGDLRSLF
MTNC_KLEOX      IWRDGYVHGDFTGHLYPDVLPALEKWKSQGIDLYVYSSGSVAAQKLLFGYSDEGDITHLF
MTNC_KLEP7      IWRDGYLNGDFTGHLYPDVLPALEQWKAQGIDLYVYSSGSVAAQKLLFGYSDEGDITHLF
MTNC_CITK8      IWHDGYVNGDFTGHLYPDVLPALEKWKAQGIDLYVYSSGSVAAQKLLFGYSDEGDITHLF
MTNC_ENT38      IWQDGYVNGDFTGQLYPDVLPALEKWKAQGIDLYVYSSGSVAAQKLLFGYSDEGDITHLF
MTNC_CROS8      IWREGYVNGDFTGHLYPDVVPALRRWSAQDIDIYIYSSGSVPAQKLLFSHSDEGDVTELL
MTNC_CROSK      IWREGYVNGDFTGHLYPDVVPALRRWSDQDIDIYIYSSGSVPAQKLLFSHSDEGDVTELL
MTNC_ERWT9      VWRDGYLNGSFTGHLYPDVLPALRRWQQQGLALYVYSSGSVAAQKLLFGYSDAGDITGLF
MTNC_PECAS      IWRAGYRNGDFQGHLYPEVAAQLAAWQQQGLHLYVYSSGSVEAQRLLFGYSNAGDLRPLF
MTNC_SERP5      IWRSGYQNGDFRGHLYPEVAGQLAAWQQQGLKLYVYSSGSVEAQKLLFGYSDAGDLQPLF
MTNC_YERPG      IWRTGYLQADFRGHVYPEVAQQLADWHQQGLKLYVYSSGSVAAQKLLFGYSDAGDLCPLF
MTNC_YERPP      IWRTGYLQADFRGHVYPEVAQQLADWHQQGLKLYVYSSGSVAAQKLLFGYSDAGDLCPLF
MTNC_YERPY      IWRTGYLQADFRGHVYPEVAQQLADWHQQGLKLYVYSSGSVAAQKLLFGYSDAGDLCPLF
MTNC_YERP3      IWRTGYLQADFRGHVYPEVAQQLADWHQQGLKLYVYSSGSVAAQKLLFGYSDAGDLCPLF
MTNC_YERPB      IWRTGYLQADFRGHVYPEVAQQLADWHQQGLKLYVYSSGSVAAQKLLFGYSDAGDLCPLF
MTNC_YERPS      IWRTGYLQADFRGHVYPEVAQQLADWHQQGLKLYVYSSGSVAAQKLLFGYSDAGDLCPLF
MTNC_YERE8      IWRSGYLQGDFRGHLYPDVTPQLADWQQQGLKLYVYSSGSVDAQKLLFGYSDAGDLQPLF
MTNC_METCA      IWEEGYRNRDFFGHVYDDAVRRLKAWHEQGISLYVFSSGSVHAQRLLFGHTAAGDLQPLF
MTNC_STRM5      IWDEGYRRGDYTAHFYPEVAPVLKGWHASGLPLYVYSSGSVPAQKLFFGFSDAGDLSPLV
MTNC_STRMK      IWDEGYRRGDYTAHFYPEVAPVLKGWHAAGLPLYVYSSGSVPAQKLFFGFSDAGDLSPLV
MTNC_XANAC      IWGDGYKTADFTAHIYADAAIQLKAWHAAGIPLYVYSSGSVPAQKLFFAHSDAGDLSGLI
MTNC_XANC5      IWGDGYKTADFTAHIYADAAIQLKAWHAAGIPLYVYSSGSVPAQKLFFAHSDAGDLSGLI
MTNC_XANC8      IWEDGYRTADFSAHIYTDAAIQLQAWHAEGIPLYVYSSGSVPAQKLFFAHSDAGDLSGLV
MTNC_XANCP      IWEDGYRTADFSAHIYTDAAIQLQAWHAEGIPLYVYSSGSVPAQKLFFAHSDAGDLSGLV
MTNC_XANCB      IWEDGYRTADFSAHIYADAAIQLQAWHAEGIPLYVYSSGSVPAQKLFFAHSDAGDLSGLV
MTNC_XANOM      IWGDGYKIADFTAHMYADAALQLQAWHAAGIPLYVYSSGSVPAQKLFFAHSDAGDLSGLV
MTNC_XANOP      IWGEGYKIADFTAHMYADAALQLQAWHAAGIPLYVYSSGSVPAQKLFFAHSDAGDLSGLV
MTNC_XANOR      IWGDGYKIADFTAHMYADAALQLQAWHAAGIPLYVYSSGSVPAQKLFFAHSDAGDLSGLV
MTNC_XYLF2      IWTSGYQNGDFTAHLYPDAVQRLRAWHAANVPLYVYSSGSVPAQQLFFRHSHAGDLSGLF
MTNC_XYLFT      IWTSGYQNGDFTAHLYPDAVQRLRAWHAANVPLYVYSSGSVPAQQLFFRHSHAGDLSGLF
MTNC_XYLFM      IWASGYQNGDFTTHLYPDAVQRLRAWHAANVPLYVYSSGSVPAQQLFFRHSHAGDLSGLF
MTNC_XYLFA      IWASGYQNGDFTAHLYPDAVQRLRAWHAANVPLYVYSSGSVPAQQLFFRHSHAGDLSGLF
MTNC_ALCBS      IWKAGYENGDYTAHMYPDTAPALKKWHQKGIALYVYSSGSITAQKLFFGYSDAGDLTGLL
MTNC_HAHCH      IWRSGYDEGAYKGHVYPEVAERLRHWRELGIRLFVYSSGSVAAQKQIFGFSEAGDLTPLF
MTNC_MARN8      VWEQGYHSGELKGHIYPDAADYLKRWHDRGLRLFVYSSGSVKAQKLIFGHSNEGDFTVFF
MTNC_PSE14      VWEQGYNAGQLKGHVYPDAVDALKHWHQQGYRLYVYSSGSIQAQQLIFGCSEAGDLSGLF
MTNC_PSEU2      VWEQGYNAGQLKGHVYPDAVDALKHWHQQGYRLYVYSSGSIQAQQLIFGCSEAGDLSGLF
MTNC_PSESM      VWEQGYNAGQLKGHVYPDAVDALQHWHQQGYRLFVYSSGSIQAQQLIFGCSEAGDLSGLF
MTNC_PSEPF      VWEQGYQAGQLKGHVYPDAVEALQRWHQAGYQLFVYSSGSIQAQKLIFGCSEAGDLTPLF
MTNC_PSEAB      VWAQGYRDGQLKGHVYPDAVQALREWKARGLDLYVYSSGSIQAQKLIFGCSEAGDLGPLF
MTNC_PSEAE      VWAQGYRDGQLKGHVYPDAVQALREWKARGLDLYVYSSGSIQAQKLIFGCSEAGDLGSLF
MTNC_PSEA7      VWAQGYRDGQLKGHVYPDAAQALREWKARGLDLYVYSSGSIQAQKLIFGCSEAGDLGPLF
MTNC_SYNP2      LWEEGYKNGDFRGHVYPDVLPKLKEWQKEGIQLGIYSSGSVKAQKLLFGYSDYGDLTGYF
MTNC_AQUAE      IWEEGFKSGELKAPLYEDAYEKIKEWKEKGIPVYIYSSGSVKAQNLFFGHSVYGDIRNLF
MTNC_HYDS0      IWEEGFKSGELKGHIYEDAYIKLKELKEKGYKIFAYSSGSIKAQKLFFGYSVYGDITNFF
MTNC_SULSY      IWEEGYKSGKLQGFVYPDAYNKLKEWFDSGIKIFIYSSGSVKAQKLLFSNTNYGDLNYLF
MTNC_SHEB5      IWKQGYAHGEFKGHIFPDFIEAVKRFSAQNLRIYSFSSGSVDAQKLLFSHSDGGDLTEMF
MTNC_SHEB8      IWKQGYGHGEFKGHIFPDFIEAVKRFSAQNLRIYSFSSGSVDAQKLLFSHSDGGDLTEMF
MTNC_SHEB9      IWKQGYAHGEFKGHIFPDFIEAVKRFSEQNLRIYSFSSGSVDAQKLLFSHSDGGDLTEMF
MTNC_SHEPC      IWKQGYAHGEFKGHIFPDFIEAVKRFSTQNLRIYSFSSGSVDAQKLLFSHSDGGDLTEMF
MTNC_SHESW      IWKQGYAHGEFKGHIFPDFIEAVKRFSAQNLRIYSFSSGSVDAQKLLFSHSDGGDLTEMF
MTNC_SHEON      IWKQGYAHDEFKGHIFPDFIEAVKRFSAQNLRIYSFSSGSVDAQKLLFSHSDGGDLTEMF
MTNC_SHESM      IWKQGYAHGEFTGHIFPDFIEAVNRFSAQKLRIYSFSSGSVEAQKLLFSHSDGGDLTEMF
MTNC_SHESR      IWKQGYAHGEFTGHIFPDFIEAVNRFSAQKLRIYSFSSGSVEAQKLLFSHSDGGDLTEMF
MTNC_SHESA      IWKQGYAHGEFTGHIFPDFIEAVNRFSAQKLRIYSFSSGSVEAQKLLFSHSDGGDLTEMF
MTNC_SHEHH      IWKQGYANGEFKGHIFPDFIEALDGYKQQGLRVYSFSSGSVEAQKLLFSHSDAGDLNDKF
MTNC_SHEPA      IWKQGYANGEFTGHIFPDFIEALDGYKQQGLRVYSFSSGSVEAQKLLFSHSDAGDLNDKF
MTNC_SHESH      IWKQGYAKGEFTGHIFPDFIDAIEGIKQQNMRLYSFSSGSAEAQKLLFSHSDAGDLTPNF
MTNC_SHEWM      IWKQGYARGEFTGHIFPDFIDTIESIKQQNIRIYSFSSGSAEAQKLLFSHSDGGDLTPHF
MTNC_SHELP      IWKQGYAQGEFKGHIYPDFIDSVKEIKAQNVRLYSFSSGSVDAQKLLFSHSDGGDLTEYF
MTNC_SHEAM      IWKQGYANDEFKGHIYPDFIDAIKTYRAQGLRVYSFSSGSVDAQKLLFSHSDSGDLTELF
MTNC_SHEFN      IWKQGYNRVEFTGHIYPDFIDSIERIKEKGIRIYSFSSGSVEAQKLLFSHTEAGDLTGSF
MTNC_SHEDO      IWKQGYSSLAFQGQIYPDFIEAISRYRQQGVAIYSFSSGSVEAQKLLFSHSEVGDLTPMF
MTNC_SYNE7      IWEQGYVSGEIKGQLFADVLPAFQRWQAAGLAIAIFSSGSVQAQQLLFGYSEAGDLSPHL
MTNC_SYNP6      IWEQGYVSGEIKGQLFADVLPAFQRWQAAGLAIAIFSSGSVQAQQLLFGYSEAGDLSPHL
MTNC_SYNR3      TWRHGYQSGALTTPLFADVAPALKRWQQRGLRLAVYSSGSVAAQQLFYGHTSDGDLSDLF
MTNC_PROM3      IWREGYEKGDLCSSLYPETIEALRKLKQQDYVLAVYSSGSISAQKLLYRHTADGDQTALF
MTNC_PROMM      IWREGYEKGDISSSLYPETIEVLNKLKQQDYILAVYSSGSISAQKLLYRHTTNGDQTALF
MTNC_PARMW      IWDNGYRKGEITSHLFNETTECLKRWHRRQLSLSVYSSGSIQAQKLLYRHTNDGDLEHLF
MTNC_SYNSC      IWEYGYGNGELKSQLFPETAVCLRQWHEQGLTLSVYSSGSIQAQKLLYRHSLNGNLEDLF
MTNC_SYNS9      VWKEGYTTGKITSELFEDAYEGLKKWHKQGFTLGIYSSGSVEAQRLLYKYTSKGDIENLF
MTNC_SYNPW      IWEQGYAAGELQSPLYGDVVPALNAWTQQGITLAVYSSGSVKAQQLLYAHTTDGDITNRF
MTNC_LEPBA      IWKEGYESGEIKSTVFDDVPKFLNDAIQSGIQNHVYSSGSVEAQHLIYQYSVLGDLRQYF
MTNC_LEPBP      IWKEGYESGEIKSTVFDDVPKFLNDAIQSGIQNHVYSSGSVEAQHLIYQYSVLGDLRQYF
MTNC_LEPBJ      IWKHGYENGELKSSLFADVPSFLKRIQSAKKKSAVYSSGSIEAQKLIFKYSDFGDLTEYF
MTNC_LEPBL      IWKHGYENGELKSSLFADVPSFLKRIQSAKKKSAVYSSGSIEAQKLIFKYSDFGDLTEYF
MTNC_LEPIC      IWKSGYENGELKSSMFSDVPSFLKKIQASKKKSAVYSSGSIQAQKLIFEYSDFGNLTHFF
MTNC_LEPIN      IWKSGYENGELKSSMFSDVPSFLKKIQASKKKSAVYSSGSIQAQKLIFEYSDFGNLTHFF
                    .:         . :    .            :**.*   *      :        .

MTNC_GLUDA      SGFYDLRIG-GKRAAGSYRAILAET-GWAAGRTLFLSDITAELDAAEEAGLRTCQLVRPE
MTNC_GLUOX      EDFFDLSTG-GKKDAASYEKITAAV-GLPADEILFLSDIGAELDAAQRAGLSVCQLVREQ
MTNC_ACICJ      ERFFDTRMG-GKRDAASYAAIARSM-AVAPAHVLFLSDVADELAAAATAGIQVCQIVRPE
MTNC_GRABC      GGFFDTRIG-GKREADSYRHIIANT-GMQPQSMLFLSDIEEELDAALDAGLRTCQLVRAG
MTNC_PARL1      EGYFDTRIG-AKVDSASYAAIAQSA-GLPTREVLFLSDHEGEIKAAREAGMQAVTIDRTL
MTNC_XANP2      EGFFDTRVG-QKLEEESYKAIAEQL-ALPAAEILVLSGNEDELDAAKAAGLATALIAREG
MTNC_FRAAA      DGYFDIDSAGPKRDPAAYRRIATEL-AVTPRRAVFLSDVSAELDAASAAGFATVAVLRPG
MTNC_SACEN      AQHFDTVNAGPKRERGSYEAIAAALGAARPLQIVFLSDVPAELDAAAQAGWHTVGLARPG
MTNC_NOCFA      SAHFDLTTAGPKREAGSYRRIAEAL-GVEAGQLLFLSDHADELDAAVAAGWSAVGVHRPG
MTNC_STRAW      EGLYDTENAGPKQEPESYRTIAAAL-GTGADRILFLSDRPGELDAARAAGWRTVGVRRPG
MTNC_SORC5      TAFFDTTTG-PKREAGAYQRIAEAL-GLQPGEVLFLSDIVAELDAAAAAGMRTVQLLRPG
MTNC_BRASB      DGHFDTDIG-AKVEAASYQAIADTI-GARPSRIVFFSDNPRELEAAAAAGIVVVHVVKGN
MTNC_KLEOX      NGYFDTLVG-AKREAQSYRNIAEQL-GQPPAAILFLSDIHQELDAAEEAGFRTLQLVRGD
MTNC_KLEP7      TGYFDTLVG-AKREVQSYRNIAEHL-GHAPGTILFLSDIHQELDAAEAAGLRTIQLVRGD
MTNC_CITK8      SGYFDTHIG-AKRETQSYRNIASYI-GVAPSQILFLSDVYQELDAAEEAGLRTLQLIRGE
MTNC_ENT38      SGYFDTRVG-AKRDVQSYQNIAAQI-GVSPSQILFLSDIHEELDAAEQAGFRTLQLIRGD
MTNC_CROS8      SGFFDTHVG-AKRQVSSYRNISMKT-GVPVHQMLFLSDIREELDAAREAGWKTVQLIRGE
MTNC_CROSK      SGFFDTHVG-AKRQVSSYRNISMKT-GVPVHQMLFLSDIREELDAAREAGWKTVQLIRGE
MTNC_ERWT9      SGYFDTHMG-AKREVDAYRNIASQI-GLPAEQLLFLSDIHEELDAARDAGWHTVQLIRGA
MTNC_PECAS      SDYFDTRVG-AKRETDSYRTIAQAI-GLPAEQLLFLSDIRQELDAAQEAGWHTCQLIRDD
MTNC_SERP5      SGYFDTHVG-AKRETASYLNIAGKI-GIAADELLFLSDIHQELDAARAAGWHTCQLIRDE
MTNC_YERPG      SGYFDTHVG-AKRDVSAYQKIANQL-GIAPQALLFLSDIRQELDAAQLAGWHTCQLIRDL
MTNC_YERPP      SGYFDTHVG-AKRDVSAYQKIANQL-GIAPQALLFLSDIRQELDAAQLAGWHTCQLIRDL
MTNC_YERPY      SGYFDTHVG-AKRDVSAYQKIANQL-GIAPQALLFLSDIRQELDAAQLAGWHTCQLIRDL
MTNC_YERP3      SGYFDTHVG-AKRDVSAYQKIANQL-GIAPQALLFLSDIRQELDAAQLAGWHTCQLIRDL
MTNC_YERPB      SGYFDTHVG-AKRDVSAYQKIANQL-GIAPQALLFLSDIRQELDAAQLAGWHTCQLIRDL
MTNC_YERPS      SGYFDTHVG-AKRDVSAYQKIANQL-GIAPQALLFLSDIRQELDAAQLAGWHTCQLIRDL
MTNC_YERE8      SGYFDTHVG-AKREVSAYQNIAHQL-AIAPQALLFLSDIRQELDAAQLAGWQTCQLIRDL
MTNC_METCA      SGYFDTRIG-AKQEPAAYSAIAREL-NLPPSEILFLSDIEAELDAAREAGYKTFMLVREG
MTNC_STRM5      SGWFDTEIG-GKREADSYRRIVQAI-DVPAGEILFLSDVVEELDAAREAGLQTRLIDRLD
MTNC_STRMK      SGWFDTEIG-GKREADSYRRIVQAI-GVPAGEIVFLSDVVEELDAAREAGLQTRLIDRLD
MTNC_XANAC      TDWFDTEVG-PKRESASYRRIAERI-GVPGPEILFLSDVIEELDAAKRAGMRTALLDRLD
MTNC_XANC5      TDWFDTEVG-PKRESASYRRIAERI-GVPGPEILFLSDVIEELDAAKRAGMRTALLDRRE
MTNC_XANC8      SDWFDTEVG-PKRESSSYRRIAERI-GVPAPEILFLSDVIEELDAAKRAGMRTALLDRLE
MTNC_XANCP      SDWFDTEVG-PKRESSSYRRIAERI-GVPAPEILFLSDVIEELDAAKRAGMRTALLDRLE
MTNC_XANCB      SDWFDTEVG-PKRESSSYRRIAERI-GVPAPEILFLSDVIEELDAAKRAGMRTALLDRLE
MTNC_XANOM      SDWFDTEVG-SKREAASYRRIAERI-GVPASEILFLSDVIEELDAAKRTGMRTALLERRE
MTNC_XANOP      SDWFDTEVG-SKREAASYRRIAERI-GVPASEILFLSDVIEELDAAKRTGMRTALLERRE
MTNC_XANOR      SDWFDTEVG-SKREAASYRRIAERI-GVPASEILFLSDVIEELDAAKRTGIRTALLERRE
MTNC_XYLF2      SGWFDTQIG-GKRESTSYQRIAQHI-GIAPAGIVFLSDVIEELNAAAQIGLNTVLIDRRD
MTNC_XYLFT      SGWFDTQIG-GKRESTSYQRIAQHI-GIAPAGIVFLSDVIEELNAAAQIGLNTVLIDRRD
MTNC_XYLFM      SGWFDTKIG-GKRESTSYQRIAQHI-GIAPAGIVFLSDVIEELNAAAQIGLNTVLIDRRD
MTNC_XYLFA      SGWFDTEIG-GKRESTSYQRIAEHI-GIAPAGIVFLSDVIEELNAAAQIGLNTVLIDRRD
MTNC_ALCBS      SGYFDTTTG-PKQETDSYRKIQQAI-DKPANTLLFLSDIEAELDAAAEAGFNTCLLDR--
MTNC_HAHCH      SGYFDTRVG-GKRDADSYRAIVREV-SEPASSVLFLSDVPAELSAAAEAELQVCQLVR-G
MTNC_MARN8      SGYFDTAVG-GKKESQSYRNILAEL-GVDAGTVLFLSDVEEELRAAEEAGLKTAWLVREG
MTNC_PSE14      SGYFDTTSG-PKREAQSYRTIAQAI-ECPAENILFLSDIVEELDAAQAAGMITCGLARDG
MTNC_PSEU2      SGYFDTTSG-PKREAQSYRTIAQAM-DCPAGDILFLSDIVEELDAAQAAGMATCGLARDG
MTNC_PSESM      SGYFDTTSG-PKREAQSYQTIANAT-GFAAEEILFLSDIVEELDAAKAAGMLTCGLARDG
MTNC_PSEPF      SGYFDTTSG-PKREPQSYTNIQQAI-GVEPQEILFLSDIVQELDAAQSAGLQTCGLAREG
MTNC_PSEAB      SGYFDTTSG-PKRESASYARIAGAI-GLPAAEILFLSDVVQELDAARDAGMRTLGLAREG
MTNC_PSEAE      SGYFDTTSG-PKRESASYARIAGAI-GLPAAEILFLSDVVQELDAARDAGMRTLGLAREG
MTNC_PSEA7      SGYFDTTSG-PKRESASYARIAGAI-GLPAAQILFLSDVVQELDAARDAGLRTLGVAREG
MTNC_SYNP2      DYFFDLKVG-QKRDVQSYQAIAQAV-QLPPEAILFLSDVPAELDAAIQAGYQAWQLVRPG
MTNC_AQUAE      SGFFDTKIG-SKRERSSYEKIAKEI-GLPPHEILFISDNPEELKAAKEAGMKVIQSVREG
MTNC_HYDS0      DGFFDTTMG-SKKDKNSYIKIASAT-EIDPQMFLFLSDVKEEINASKEAGMNAILVSRD-
MTNC_SULSY      SGYFDTNIG-NKKDKQSYVKIAKEI-GFSPSEILFLSDNPDEIIAAASAGYNVIRLVRPL
MTNC_SHEB5      NGHFDTRTG-NKLDKQAYCNILNTI-SLSPKQVLFVSDVIEELKAAEAAGMMTCQMVRDS
MTNC_SHEB8      NGHFDTRTG-NKLDKQAYCNILNTI-SLSPKQVLFVSDVIEELKAAEAAGMMTCQMVRDS
MTNC_SHEB9      NGHFDTRTG-NKLDKQAYCNILNTI-SLSPKQVLFVSDVIEELKAADAAGMMTCQMVRDS
MTNC_SHEPC      NGHFDTRTG-NKLDKQAYCNILNTI-SLSPKQVLFVSDVIEELKAADAAGMMTCQMVRDS
MTNC_SHESW      NGHFDTRTG-NKLDKQAYCNILNTI-SLSPKQVLFVSDVIEELKAADAAGMMTCQMVRDS
MTNC_SHEON      NGHFDTRTG-NKLDKQAYCNILNTI-SLSPKQVLFVSDVIEELKAADAAGMMTCQMVRDS
MTNC_SHESM      SGHFDTRTG-NKLDKQAYANILNTI-SLSPKQVLFVSDVVEELKAAEAAGMMTCQMVRDS
MTNC_SHESR      SGHFDTRTG-NKLDKQAYANILNTI-SLSPKQVLFVSDVVEELKAAEAAGMMTCQMVRDS
MTNC_SHESA      SGHFDTRTG-NKLDKQAYANILNTI-SLSPKQVLFVSDVVEELKAAEAAGMMTCQMVRDS
MTNC_SHEHH      NGHFDTRTG-NKRFKQAYCNIVNTI-SLSPKQILFVSDVLEELKAASEAGLNVVQMVRDD
MTNC_SHEPA      NGHFDTRTG-NKRFKQAYSNIVNTI-SLSPKQILFVSDVLEELKAANEAGLHVVQMVRDD
MTNC_SHESH      DGHFDTRTG-NKLFKQAYCNIINTI-SLAPKQVLFISDVIEELKAAEEAGMRTLQMVRTP
MTNC_SHEWM      DGHFDTRTG-NKLFKQAYCNIINTI-SLAPKQVLFISDVIEELKAAEEAGMRTLQMVRSA
MTNC_SHELP      DGHFDTRTG-NKLFKQAYLNIINTI-SLAPKQVLFISDVLEELKAAEQAGMRVMQMVRET
MTNC_SHEAM      NGHFDTRTG-NKLDKQAYANIVNTI-SLTPRQILFVSDVVEELKAAEAAGMITCQMVREP
MTNC_SHEFN      NGHFDTRTG-NKLDKQAYCNICNTI-SLKPKQILFVSDVAEELKAAEAAGMTTCQMIRFA
MTNC_SHEDO      SGHFDMRMG-NKLDKQAYLNIHNTL-GLPPKQILFVSDTQEELTAAQAAGMMTCLMSRGD
MTNC_SYNE7      SGYFDTRTG-PKREAASYGAIAAQL-GKAPAQVLFVSDIPAELEAAATAGFQTRLSLRPG
MTNC_SYNP6      SGYFDTRTG-PKREAASYGAIAAQL-GKAPAQVLFVSDIPAELEAAATAGFQTRLSLRPG
MTNC_SYNR3      ERWYDTRLG-PKNEAQSYTLLAADL-QLPAHAVLFISDSSGELAAAQAAGLQICGSQRPG
MTNC_PROM3      SHWFDTRTG-NKKESRSYSDISIAM-NIPVEKVLFVSDSYAECNAAEKSGMSVLFSLREG
MTNC_PROMM      SHWFDTRTG-NKKESKSYSDISIAM-NIPVEKVMFVSDSCAECNAAKKAGMSVLFSLREG
MTNC_PARMW      DHWFDTHTG-NKKECASYRKIATKI-STNPSEILFISDNGEECDAAGASGMETLFSLRDG
MTNC_SYNSC      SHWFDTHTG-PKKSAESYTTIAKQL-QSSPNKIWFVSDNGDECNSARLAGMHTLFSLREG
MTNC_SYNS9      SHWFDTHIG-NKKEQRSYTAIASSM-ACKPQNILFISDNSDECDAAKGAGLFTLYSLREG
MTNC_SYNPW      SQWFDTRTG-PKLNADSYRIISQSI-GLKPASILFVSDHPRECDAAAEAGMETRFCLREG
MTNC_LEPBA      TMYFDTAVG-GKREKTSYERIASTL-AVSPSEIRFFTDIVEEAEAANATGMDVVILNRPG
MTNC_LEPBP      TMYFDTAVG-GKREKTSYERIASTL-AVSPSEIRFFTDIVEEAEAANATGMDVVILNRPG
MTNC_LEPBJ      SAYFDTGVG-GKRESASYSRIAEQL-GIAPEKILFFTDIKEEADAARNAEFKTTLLERPG
MTNC_LEPBL      SAYFDTGVG-GKRESASYSRIAEQL-GIAPEKILFFTDIKEEADAARNAEFKTTLLERPG
MTNC_LEPIC      YAYFDTGVG-GKRESSSYSKISEQL-GVAPEKILFFTDIKEEADAAKEAKLHSAILERPG
MTNC_LEPIN      YAYFDTGVG-GKRESSSYSKISEQL-GVAPEKILFFTDIKEEADAAKEAKLHSAILERPG
                   :*   .  *    :*  :             ..:.   *  ::           :  

MTNC_GLUDA      D--GTVAGDRHPVATTLDDVARRFALPVAA------------
MTNC_GLUOX      D--GTVPHPGVPQAPDLNAVSTQFGLPVA-------------
MTNC_ACICJ      D--GTIASADYPTAPDLAAVAAAFDRPDPA------------
MTNC_GRABC      DN-GGPPTLRHPHAPDFIAVAHLFGLPHP-------------
MTNC_PARL1      Q---EEAWMEGPKAGSFSAVERALAPGKSA------------
MTNC_XANP2      G-----GGGNHPVAADFASVTIG-------------------
MTNC_FRAAA      EPHHLA--GNHPCVASFAEMAVDAA-----------------
MTNC_SACEN      EPYADADFGSHPAVGAFDDIDIEVVS----------------
MTNC_NOCFA      EPNPPRP--PHRWIGSFDELDLARTPVS--------------
MTNC_STRAW      EPYYEQGVGDHAQAGSFGGITIARSTA---------------
MTNC_SORC5      TARDAES--RHAVAERFDDIAP--------------------
MTNC_BRASB      TPSDPR----FPEITDFSTVELRHSKTE--------------
MTNC_KLEOX      RDPASHHPQVQRFDDIHPEQIPA-------------------
MTNC_KLEP7      RDPASHHPQVQRFDDIHPEQIPA-------------------
MTNC_CITK8      GDGASRHHQVHQFDDINPEQILS-------------------
MTNC_ENT38      DDGASHHHQVHQFDEINPEQIPS-------------------
MTNC_CROS8      PDTQSTHRQVSSFDDIHPEQIPT-------------------
MTNC_CROSK      PDTQSTHRQVSSFDDIHPEQIPT-------------------
MTNC_ERWT9      ADNASRHRQVTDFDRINQELLNS-------------------
MTNC_PECAS      ADSVSRHRQAARFDQIDLPEYAQ-------------------
MTNC_SERP5      ADSQSQHPQVNRFDQIDLGEFAS-------------------
MTNC_YERPG      PDNDSAHPQVNRFDQIVLSLFTE-------------------
MTNC_YERPP      PDNDSAHPQVNRFDQIVLSLFTE-------------------
MTNC_YERPY      PDNDSAHPQVNRFDQIVLSLFTE-------------------
MTNC_YERP3      PDNDSAHPQVNRFDQIVLSLFTE-------------------
MTNC_YERPB      PDNDSAHPQVNRFDQIVLSLFTE-------------------
MTNC_YERPS      PDNDSAHPQVNRFDQIVLSLFTE-------------------
MTNC_YERE8      PDSESRHLQVSRFDEIDIEGFTA-------------------
MTNC_METCA      GAKASHHPQGADFDAIRPELL---------------------
MTNC_STRM5      DYPLPRTGQAANGHERVENFQQIQL-----------------
MTNC_STRMK      DYPMPRIGQAANGHERVENFQQIQL-----------------
MTNC_XANAC      DYPTPRSADEVGSHQRVESFSQLVL-----------------
MTNC_XANC5      DYPTPRSADDVGSHQRVESFSQLVL-----------------
MTNC_XANC8      DYPTPRSADDVGSHQRVESFTQLVL-----------------
MTNC_XANCP      DYPTPRSADDVGSHQRVESFTQLVL-----------------
MTNC_XANCB      DYPTPRSADDVGSHQRVESFTQLVL-----------------
MTNC_XANOM      DYPTPRSADDVGSHQRVENFSQLVF-----------------
MTNC_XANOP      DYPTPRSADDVGSHQRVENFSQLVF-----------------
MTNC_XANOR      DYPTPRSADDVGSHQRVESFSQLVF-----------------
MTNC_XYLF2      DYPTPRHLKDTDRHLHLDSFAQLPF-----------------
MTNC_XYLFT      DYPTPRHLKDTDRHLHLDSFAQLPF-----------------
MTNC_XYLFM      DYPTPRHLKDTDRHLHLDSFAQLPF-----------------
MTNC_XYLFA      DYPTPRHLKDADHHLHLDSFAQLPF-----------------
MTNC_ALCBS      -----QQAGLESRHPVASNFNHINLAD---------------
MTNC_HAHCH      AGIERQETYPAVASFADLLIKPA-------------------
MTNC_MARN8      ELPDTARVVARDFSEVDALLRKR-------------------
MTNC_PSE14      GVLVGHRYVSSFALIDPASF----------------------
MTNC_PSEU2      GALAGHRYVTSFALIDPASF----------------------
MTNC_PSESM      GVLAGHRHVNSFTLIDPASF----------------------
MTNC_PSEPF      GELEGHVTVDSFTGIEPEAF----------------------
MTNC_PSEAB      GSLDGHPTVASFADIVVE------------------------
MTNC_PSEAE      GSLDGHPTVASSPTSSWSERAGYPEGTLLLGSIAPWVPPSAG
MTNC_PSEA7      GSLDGHPTVASFADIVVE------------------------
MTNC_SYNP2      TTASPTHQQVTDFGAITSLH----------------------
MTNC_AQUAE      VEPSGD---FEKITSFRELEI---------------------
MTNC_HYDS0      -RPCEE---KDCIRDFTEINL---------------------
MTNC_SULSY      DADHIDNFPYKQVESFDEIEIGRV------------------
MTNC_SHEB5      TLRTGE---FRKISSFDELLIE--------------------
MTNC_SHEB8      TQRTGE---FRKISSFDELLIE--------------------
MTNC_SHEB9      KQRTGE---FRTISSFDELLIE--------------------
MTNC_SHEPC      KQRTGD---FRKISSFDELQIE--------------------
MTNC_SHESW      KQRTGE---FHKISSFDELLIE--------------------
MTNC_SHEON      KQRTGD---FRTINSFDKLVIE--------------------
MTNC_SHESM      KQRTGD---FRTINSFDELVID--------------------
MTNC_SHESR      KQRTGD---FRTINSFDELVID--------------------
MTNC_SHESA      KQRTGD---YRTINSFDELVID--------------------
MTNC_SHEHH      SQRTGD---FKTISSFAELSI---------------------
MTNC_SHEPA      SQRTGD---FKTIASFDELKID--------------------
MTNC_SHESH      GQRTGT---YKQISSFAELTF---------------------
MTNC_SHEWM      DQRTGN---FKQIASFKELTF---------------------
MTNC_SHELP      TQRTGD---YPQITNFKELSF---------------------
MTNC_SHEAM      SQRTGK---YRIIQSFSELNFE--------------------
MTNC_SHEFN      DQRQAK---CKKISSFSELVFD--------------------
MTNC_SHEDO      AFAPTE---HKQVGSFTALNI---------------------
MTNC_SYNE7      NATVEIGDWTTIHSFDEL------------------------
MTNC_SYNP6      NATVEIGDWTTIHSFDEL------------------------
MTNC_SYNR3      NPETLSAKWPVVVSSLEALAPSGPPGLR--------------
MTNC_PROM3      NPEQDPHDHKAIKELCCLFDYLL-------------------
MTNC_PROMM      NPEQDPHDHQPIKDLRCLFDYLL-------------------
MTNC_PARMW      NPDQSPRSHRVIKTLNDVDEYL--------------------
MTNC_SYNSC      NPDRDPRDHKVVHSLREVSALLIAEQ----------------
MTNC_SYNS9      NPQQEPRDHPIIINLGDVDQWLK-------------------
MTNC_SYNPW      NPFSDGGDHQMIHNLGEIKL----------------------
MTNC_LEPBA      NLAQKPHPFPVWEHF---------------------------
MTNC_LEPBP      NLAQKPHPFPVWEHF---------------------------
MTNC_LEPBJ      NAPQPKHSHPKISSFENFNP----------------------
MTNC_LEPBL      NAPQPKHSHPKISSFENFNP----------------------
MTNC_LEPIC      NYPQPQHSHFKISSFEGLNP----------------------
MTNC_LEPIN      NYPQPQHSHFKISSFEGLNP----------------------