CLUSTAL format seed alignment for MF_01682

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

MTND_CITK8       -MSALTIYSDKDA-------------SQPQWHSTD-AAEIAQQLNAKGVRFERWVADRDL
MTND_ENT38       -MSALTIYSETET-------------REPLWHSTD-AAEIADKLNARGVRFERWEADRDL
MTND_KLEOX       -MSALTIFSVKDP-------------QNSLWHSTN-AEEIQQQLNAKGVRFERWQADRDL
MTND_KLEP7       -MSALTLFSVTDP-------------QTPVWHSTD-AKAIQAQLNAKGVRFERWQADRDL
MTND_CROSK       -MSALTIFADNGA-------------SEPLWQSTD-ADAIREQLNAQGVRFERWQADRDL
MTND_CROS8       -MSALTIFADNGA-------------SEPLWQSTD-ADAIREQLNAQGVRFERWQADREL
MTND_ERWT9       -MSALTIFTESEA-------------TTPVWYSMD-AAEMAEKLGSKGVRFERWQADRDL
MTND_YERPP       -MSGLTIFSDQQP-------------EKPLWQSHN-AEEIQQQLTAIGVRFERWQADCEL
MTND_YERPG       -MSGLTIFSDQQP-------------EKPLWQSHN-AEEIQQQLTAIGVRFERWQADCEL
MTND_YERP3       -MSGLTIFSDQQP-------------EKPLWQSHN-AEEIQQQLTAIGVRFERWQADCEL
MTND_YERPS       -MSGLTIFSDQQP-------------EKPLWQSHN-AEEIQQQLTAIGVRFERWQADCEL
MTND_YERPB       -MSGLTIFSDQQP-------------EKPLWQSHN-AEEIQQQLTAIGVRFERWQADCEL
MTND_YERPY       -MSGLTIFSDQQP-------------EKPLWQSHD-AEEIQQQLTAIGVRFERWQADCEL
MTND_YERE8       -MSGLTIFSDEQP-------------EQPLWQSRD-AEEIQQQLTAIGVRFERWQADREL
MTND_SERP5       -MSGLTIFSDQEP-------------QQPLWQSRD-AQAIGQQLAQIGVRFERWQADREL
MTND_SODGM       -MRALTIYSDTDA-------------TAPRWQSHE-GDAIQRELNAIGVRFERWQTDREL
MTND2_PECAS      -MSGLTIFSDSDA-------------SQPIWQSQD-ADAIQKQLNDIGVRFERWEASQKL
MTND_ALCBS       MHSELKVFSDQAP-------------GRVEQHLTD-KAAMARVLASAGIRYEQWQANQAL
MTND_PROM3       -MSRLSIHPEGNT-NAT-------SPAEPLLESDD-PAVIKAELAKRGIEFQHWPAKVKL
MTND_PROMM       -MSRLSIHPEGST-NAT-------SPAEPLLESDD-PAVIKVELAKRGIAFQRWPAKVKL
MTND_SYNPW       -MSELSIYSE--------------QGGEPVFSTLD-SARIQHELSLRGIAFDRCASKAEI
MTND_SYNS9       -MSRLSIFPDGSTSMDQ-------SSPTPLLVTET-PAEIQAELARRGIGFEQWPALQEL
MTND_SYNPX       -MSRLSIFPDHGDGGDG-------ALPLPKLVCND-PASIQAELADRCVGFEQWPAAHAL
MTND_SYNSC       -MSRLSIFPDETAANAP-------DGLVPQLESND-PAVIQASLSRRGIGFEQWPAEHGL
MTND_SYNR3       -MSQLTIYNAVSE--GN-------DPPLPSLHTTD-AAIVAAELSQRGIRFQQWPTHDEL
MTND_SYNS3       -MTELRIYATRGAGVEADRDSAVAAAPEALLSTSN-AEQISAQLKTRGIKFQRWPSKPKL
MTND_SYNE7       -MTVLTIYREDLP-------------EQPLTQTTD-AAEIAALLAQQGLRFERWPAQVEL
MTND_SYNP6       -MTVLTIYREDLP-------------EQPLTQATDGAAEIAALLAQQGLRFERWPAQVEL
MTND_PSEAE       -MSSLTVYHENQP-----------EQPLKLLTHAE---DIASTLAEVGVRFERWEAAAPI
MTND_PSEAB       -MSSLTVYHENQP-----------EQPLKLLTHAE---DIASTLAEVGVRFERWEAAAPI
MTND_PSEA7       -MSSLTVYHESQP-----------EQPLKLLTHAE---DIASTLAEVGVRFERWEAAAPI
MTND_PSEU5       -MSVLSVYHESRP-----------EQPLKVLTHLE---DIAATLAEVGVQLERWDASAPV
MTND_PSEU2       -MSSLSVYHVSSP-----------DMPNKVLTHLE---DIASTLAEHGVAFDRWEAATPI
MTND_PSESM       -MSSLSVYHVSSP-----------DIPNKVLTHLE---DIASTLAEHGVAFDRWEAATPI
MTND_PSE14       -MSSLSVFHVSSP-----------DTPNKVLTHLE---DIASTLGEHGVAFDRWEAAAPI
MTND_PSEPF       -MSSLSVYHVSSP-----------EIPNKVLTHFE---DIASTLAEQGVRFDRWQAAAKI
MTND_PSEF5       -MSSLSVYHVSSP-----------DLPNKVLTHFD---DIAATLAEQGIRFDRWPATTRV
MTND_AQUAE       -MSRLRIYTESG----------------ELIKDITDPKEIAEELQKINVLFERWRANAPL
MTND_HYDS0       -MSHLVIYNEEG----------------SVLELIKEYEAVSKRLAALGVRFERWKADNEL
MTND_METCA       -MSLLTIHPESGT---------------SAPEIIREGDAIAARLAEIGVLFERWQAGRAF
MTND_HAHCH       -MSSLRIYNDNDF--------------SQPLVFTEDGAEISRQLNEAGIRFERWST-REL
MTND_MARHV       -MTTLSIFHQNQP--------------EQAQTVVTDPDTIRNKLSAHGVHFDRWAT-RDL
MTND_SORC5       -MSRLRVYRESDP--------------TRADEYTT-LEDIARVAAEAQIRFERWSAERPL
MTND_GLUDA       -MSHLTVYRDDDP-------------DDIVLRTDD-AAVIADALRGIGARFERWDSPVVP
MTND_GLUOX       -MSRLTVYRDDAP-------------DTILLDVTT-PGEIAETLRPHNIRFDRWSAPITP
MTND_GRABC       -MSRLTIYADSTP-------------DAPLLRTED-PERIAQELSSIGVRFERWSSAVTP
MTND_ACICJ       -MSTLRIFDDANP-------------DAPLVATSD-AARMAAELKSIGVRFERWESPVAI
MTND_STRMK       -MSRLRIYDDTRP-------------ESPLLDTQD-GAVIAAELQKIGVTFERWQATAPV
MTND_STRM5       -MSRLRIYDDTRP-------------ESPLLDTQD-GAIIAAELQKIGVTFERWQATAPV
MTND_XANAC       -MSRLRIFADTNP-------------ATPEFDSRD-GDAIAAELVKIGVTFERWHASAPV
MTND_XANC5       -MSRLRIFADTNP-------------ATPEFDSRD-GDAIAAQLQKIGVTFERWHASAPV
MTND_XANOR       -MSRLRIFADTNP-------------ATPEFDSRD-GDAIASELKKIGVTFERWHASAPV
MTND_XANOM       -MSRLRIFADTNP-------------ATPEFDSRD-GDAIASELKKIGVTFERWHASAPV
MTND_XANOP       -MSRLRIFADTNP-------------ATPEFDSRD-GDAIASELKKIGVTFERWHASAPV
MTND_XANCP       -MSRLRIFADSNP-------------TTPHFDSRD-GEQIATELRKIGVTFERWHASQPV
MTND_XANC8       -MSRLRIFADSNP-------------TTPHFDSRD-GEQIATELRKIGVTFERWHASQPV
MTND_XANCB       -MSRLRIFADSNP-------------TTPHFDSRD-GEQIATELRKIGVTFERWHASQPV
MTND_XYLF2       -MSRLRIFDDHTP-------------DTPFFVSKE-QAQITAELHKIGITFERWEATQAI
MTND_XYLFT       -MSRLRIFDDHTP-------------DTPFFVSKE-QAQITAELHKIGITFERWEATQAI
MTND_XYLFM       -MSRLRIFDDHTP-------------NTPFFVSKE-QAQITAELHKIGITFERWEATQAI
MTND_XYLFA       -MSRLRIFDDHTP-------------DTPFFVSKE-QTQITAELHKIGITFERWEATQAI
MTND_PARL1       -MTHLTVYPDTDP-------------ATVLLDTRD-GAEIAASLSGIGVVFERWDAPHAL
MTND_BRASB       -MTQLIVYEAGNP-------------SHVLLQTSD-FDVIAGKVAALGARIERWEARHPI
MTND_FRAAA       -MTYLTTWTADAR-------------PRLLEETTD-PARIAAVLAAIAVRFERWPLAPGL
MTND_STRAW       -MTLLTTWPESGP-------------ETVVRRTSD-PAEIAAALAPLGVRYEQWPVRADV
MTND1_NOCFA      -MTLVQVMAQDDR-------------DQVVLRTAD-RTEIADTLRPFGIQLDRWPLR-EL
MTND2_NOCFA      -MTLLQVMAADDA-------------ARVRLRTTE-EAAIAAELAAHGITFDRWPVL-DD
MTND_SACEN       -MSLLTVWPDTDA-------------GTVELRTED-PQEITDVLKQFGVSFSRWELR-EL
MTND1_PECAS      -MTTLSIYHRPHI--------------TQPIQQLTAFNDIASLLASAGIQLEHWQAE-AP
MTND_SYNP2       -MTTLYQTESK--------------------QTLTDPATIKDFLKSHGIWFEQWETPAQL
MTND_BACLD       -MATIRIHDEQNT-------------------SIENQEEVEQFLKRQEVIYEKWDITKLP
MTND_BACSU       -MATIRIHDEANT-------------------TIENQEEVASFLDSQEVIYEQWDITRLP
MTND_BACVZ       -MATIRIHDEKNT-------------------LIEHQEEVARFLDEQEVIYEQWNIEKLP
MTND_BACP2       -MATILIHNEENT-------------------LLESEQEVAAYLENQGVIYEHWDIAKLP
MTND_BACCZ       -MAQIRIH-EVNT-------------------RIENEVEVSKFLQEEGVLYEKWNISKLP
MTND_BACAH       -MAQIRIH-EVNT-------------------RIENEVEVSKFLQEEGVLYEKWNISKLP
MTND_BACAN       -MAQIRIH-EVNT-------------------RIENEVKVSKFLQEEGVLYEKWNISKLP
MTND_BACC1       -MAQIRIH-EINT-------------------RIENEVEVSKFLQEEGVLYEKWNISKLP
MTND_BACHK       -MAQIRIH-EINT-------------------RIENEVEVSKFLQEEGVLYEKWNISKLP
MTND_BACCR       -MAQIRIH-EVNT-------------------RIENEVEVSKFLQEEGVLYEKWNISKLP
MTND_BACMK       -MAQIRIH-EENT-------------------RIENEVEVSNFLQGEDVLYEKWNISKLP
MTND_BACCN       -MAQIRIH-EINT-------------------RIENEKEVQLFLQKEDVLYEKWDISKLP
MTND_EXIS2       -MATVLFQ-KTNE-------------------RYTDQNEVSAFLASRGVLYEQWDVSKLP
MTND_GEOKA       -MAVIKVR-KTGQ-------------------VIEGEDNVRAFLNSQGVLYEHWDITKLP
MTND_GEOTN       -MAVIKVK-KTGQ-------------------VIEGEDNVRAFLNSQGVLYEHWDITKLP
MTND_SULSY       -MARLVFR-KNGK-------------------VIENPEEIKSFLSQYGVVYDVWGVDRLP
MTND_NOSS1       -MATLLLEDGTIESN---------------------LDEIVRELAPLGIYLKHYDPGTSI
MTND_TRIV2       -MATLLLEDGTIESN---------------------LDEIARELAPLGVYIKHYDPGTSI
MTND_MICAE       -MAILRLENGTTYTQ---------------------LADISLELAKLNVTLNYWPI-ENE
MTND_MICAN       -MAILRLENGTTYTQ---------------------LADISLELAKLNVTLNYWPI-ENE
MTND_TRIEI       -MAILKLEDGTIYTQ---------------------LHDISRELSSLNIQLNHWPVGDNL
MTND_DELAS       --------MGALASH---------------------RVSDADFVAAIGVQWQHRPLAPEP
MTND_LEPBA       MATIVKKQ--ETIQD---------------------KDQVKAYLTQKGLVYESYKT--PE
MTND_LEPBP       MATIVKKQ--ETIQD---------------------KDQVKAYLTQKGLVYESYKT--PE
MTND_LEPBJ       MATIVRQKGLAPIEE---------------------TSEVKSFLKERGIDYDHWKV--PY
MTND_LEPBL       MATIVRQKGLAPIEE---------------------TSEVKSFLKERGIDYDHWKV--PY
MTND_LEPIN       MATIVRQNGLTPIQE---------------------TNEVKSFLKERGIDYDHWKV--PH
MTND_LEPIC       MATIVRQNGLTPIQE---------------------TNEVKSFLKERGIDYDHWKV--PH
MTND_RHOPA       --MATLLFDDGREAT---------------------AAEIEAIARAHRIVVEHRPV--PA
MTND_RHOPT       --MATLLFDDGREAT---------------------AAEIEAIARAHRIVVEHRPV--PA
                                                                    .        

MTND_CITK8       GQA----------PAPETVITAYQHAIDKLVAEKGYQSWDVISLRAD------NPQKEAL
MTND_ENT38       GQD----------PAAETVINAYQHAIDKLVAEKGYQSWDVISLRAD------NPQKEAL
MTND_KLEOX       GAA----------PTAETVIAAYQHAIDKLVAEKGYQSWDVISLRAD------NPQKEAL
MTND_KLEP7       GAN----------PSPETVIAAYQHAIDKLVAEKGYQSWDVISLRAD------NPQKEAL
MTND_CROSK       GDD----------PTPEAVLTAYQHAIDLLVAEKGYQSWDVISMRAD------NPQKEAL
MTND_CROS8       GDN----------PTPETVLTAYQHAIDLLVAEKGYQSWDVISMRAD------NPQKEAL
MTND_ERWT9       GDN----------PDPETVIGAYQHAIDRLVAEKGYQSWDVISMRAD------NPQKEAL
MTND_YERPP       GEN----------PQPEAVIAAYQHEIDRLVAENGYKSWDVISMRPD------NPQREAL
MTND_YERPG       GEN----------PQPEAVIAAYQHEIDRLVAENGYKSWDVISMRPD------NPQREAL
MTND_YERP3       GEN----------PQPEAVIAAYQHEIDRLVAENGYKSWDVISMRPD------NPQREAL
MTND_YERPS       GEN----------PQPEAVIAAYQHEIDRLVAENGYKSWDVISMRPD------NPQREAL
MTND_YERPB       GEN----------PQPEAVIAAYQHEIDRLVAENGYKSWDVISMRPD------NPQREAL
MTND_YERPY       GEN----------PQPEAVIAAYQHEIDRLVAENGYKSWDVISMRPD------NPQREAL
MTND_YERE8       GEN----------PQPDAVIAAYQHEIDRLVAEKGYQSWDVISMRPD------NEQREVL
MTND_SERP5       GEN----------PDPAVVIAAYQHQIDRLVAEKGYQSWDVISMRPD------NAQREVL
MTND_SODGM       GAN----------PDADTVIAAYQDAIDRLVAEKGYQSWDVISMRPD------NPQRETL
MTND2_PECAS      SDA----------PSSEEVLAVYQHEIDKLVAEKGYQSWDVISMRSD------NPQCAEL
MTND_ALCBS       SDD----------PQQDEVIQAYQADIDRLIADEGYQTVDVVSMVPD------HPEKTAF
MTND_PROM3       HQN----------SIESDILAAYAVEIARVQADGRYPTVDAIRITPD------HPDREAL
MTND_PROMM       DQN----------SSESDILAAYAVEIARVQADGRYPTVDAIRITPD------HPDREAL
MTND_SYNPW       ALD----------ADQADILSTYAEEIHRIQALGDYPTVDAIRMKPD------HPDRQAL
MTND_SYNS9       PLA----------ADQSWILKAYANEIDRVKRDGGYATVDAIRMTPD------HPERVAL
MTND_SYNPX       PPD----------ADQSTILTTYASEVARVQRDGGYQTVDAIRMTPD------HPEREAL
MTND_SYNSC       PEG----------ADQATILQAYADAIAWVQRDGGYFTVDAIRMTPN------HPDREPL
MTND_SYNR3       DAA----------SSQEEILAAYSAEIAEVQAAGGYQTVDAISLGPD------HPQRAEL
MTND_SYNS3       EQG----------AMQEQILEAYASLIASVQKNEGYQTVDVMRVERD------QISGSTL
MTND_SYNE7       ADD----------ATPEQILAAYATEVDRVKTEGGYITVDAVSLRPD------HPDRAAL
MTND_SYNP6       ADD----------ATPEQILAAYATEVDRVKTEGGYITVDAVSLRPD------HPDRAAL
MTND_PSEAE       AAG----------ASQDEVIAAYAHEIERLKRERGYITVDVVSLNSD------HPQKAEL
MTND_PSEAB       AAG----------ASQDEVIAAYAHEIERLKRERGYITVDVVSLNSD------HPQKAEL
MTND_PSEA7       AAG----------ASQEEVIAAYAHEIERLKRERGYITVDVVSLDSD------HPQKAEL
MTND_PSEU5       AAG----------ASQEDVIAAYRPQIDRLMAERGYVTVDVISVSRD------HPQKDEL
MTND_PSEU2       TPG----------ASQEEVISAYRTQIDTLMTERGYVTVDVISLNSD------HPQKAEL
MTND_PSESM       TPG----------ASQEEVINAYRTQIDTLMTRHGYVTVDVISLNSD------HPQKAEL
MTND_PSE14       TPG----------ASQEEVISAYRTQIDKLMTEHGYVTVDVISLNSD------HPQKAEL
MTND_PSEPF       QPG----------ASQEEVIGAYKEQIDKLMTERGYITVDVISLNSD------HPQKAEL
MTND_PSEF5       APG----------TSQQEVICAYQEQVDRLMTEGGYASVDVISLDED------HPRKAEL
MTND_AQUAE       KEN----------ASDEEIINAYKHEIDRLINKYGFQSYDVIAMTPE------HPKKDEL
MTND_HYDS0       SWD----------AGQKEVIKAYEEDINRIIKEFGFKSLDVVSLIPE------NPKKDEL
MTND_METCA       EPD----------AEQQTILAAYADSVERLKAKYGFESADVISVGPD------HPQKDEL
MTND_HAHCH       DEG----------ATPDSILAAYQEEVEKLKAENGFTTADVVSLTPA------HPQKDEF
MTND_MARHV       PAD----------ATQEEILEAYADEVARLKQDWGFQTADVVSLTAD------HPQKDAF
MTND_SORC5       PPG----------AAQEQVLEAYAGPVKQLSEACGFVTADVVSVSPG------TPNHPEL
MTND_GLUDA       PLD----------ATPDAVLNTYRPYLDELMGETGAGSADVVRINAA------TPNLTAL
MTND_GLUOX       APD----------APAEEVLDAYRPYLDTLMGETGAGSADVVRINAS------TPNLPEL
MTND_GRABC       SPD----------DDEATILAAYRPYLNALMGETGAGTADVIRLRPD------TPNLPAL
MTND_ACICJ       AAD----------ASPEEILEAYRPYLDRLMGETGAGSADVIKMTPD------HPQAGTL
MTND_STRMK       APG----------ASQEEVFAAYRADIDRLVAERGFKSVDVASIAPD------NPNRAEL
MTND_STRM5       APG----------ASQEEVFAAYRADIDRLVAERGFKSVDVASIAPD------NPNRAEL
MTND_XANAC       EPG----------ATPEQVMDAYRADIDRISAERGFKTVDVVSIAPD------NPKREEM
MTND_XANC5       EPG----------ATPEQVMDAYRADIDRISAERGFKTVDVVSIAPD------NPKREEM
MTND_XANOR       EPG----------ATPEQVMDAYRADIDRISAERGFKTVDVVSIAPD------NPKREEM
MTND_XANOM       EPG----------ATPEQVMDAYRADIDRISAERGFKTVDVVSIAPD------NPKREEM
MTND_XANOP       EPG----------ATPEQVMDAYRADIDRISAERGFKTVDVVSIAPD------NPKREEM
MTND_XANCP       EPG----------ASPEQVMAAYRADIDRISAERGFKTVDVVSIAPD------NPKREEM
MTND_XANC8       EPG----------ASPEQVMAAYRADIDRISAERGFKTVDVVSIAPD------NPKREEM
MTND_XANCB       EPG----------ASPEQVMAAYRADIDRISAERGFKTVDVVSIAPD------NPKREEM
MTND_XYLF2       EPG----------ATAEQVMAAYRTDIDRLIATHGFKTVDVISIAPD------NAKREEM
MTND_XYLFT       EPG----------ATAEQVMAAYRTDIDRLIATHGFKTVDVISIAPD------NAKREEM
MTND_XYLFM       EPG----------ATAEQVMAAYRADIDRLIATHGFKTVDVISIAPD------NAKREEM
MTND_XYLFA       EPG----------ATPEQVMAAYRADIDRLIATHGFKTVDVVSIAPD------NPKREEM
MTND_PARL1       GED----------ADQTAVLAAYEADVKRLMDEGGYKSVDVVRVKPD------NPNRAEM
MTND_BRASB       APG----------ASNEEVLSAYGHEIDRLKRERGYTNGDVVRIKPG------NPNWPEL
MTND_FRAAA       PAG----------AEAEDILAAYRSRIDALSAAEGFVLVDVAALHPS-AAADWREVAAAA
MTND_STRAW       PAD----------ADSDTVFAAYGPEIDRLNAEEGFTTVDVLGLHPS-DDPEYPVKAKAA
MTND1_NOCFA      PAD----------AGQDAVLAAYRAEVDEVCRAGGYRFVDVVRLVPAPEDPEWPARAAAA
MTND2_NOCFA      AAA----------LSSDDLLAHYADRIAALNADGRYRHIDVARIHPDDADPQWPQTARAA
MTND_SACEN       PER----------PSSEEVLEAYRAEVDEVIEREGYIKVDAAVMAPS-QDPQWPAQAKAA
MTND1_PECAS      PLN----------ASSETILTQYHADIERLKQQEGYTSADVISLTPN------HAERKAL
MTND_SYNP2       TQE----------ASQADILAAYADVLDPFMAANGYQSADVVNIHSG------IENYQAI
MTND_BACLD       AGLKEKYD--LTDEEKQEILDVFAAEIKDISERRGYKASDVISLSDQ------NPKLDEL
MTND_BACSU       EHLSEKYD--LTEEEKQQILDTFETEIKDISTRRGYKAQDVISLSDS------NPKLDEL
MTND_BACVZ       SELSEKYD--LTEDEKERILAVFDTEIQDISARRGYQSQDVISLSDT------TPNLDEL
MTND_BACP2       NRLSEKYD--LTDEEKDEILTVFQKEIESISEKRGYKSQDVISLSDA------TPNLDDL
MTND_BACCZ       PHLNENYS--LTDENKAEILAVFSKEIADVSARRGYKAHDVISLSNS------TPNLDEL
MTND_BACAH       PHLNENYS--LTDENKAEILAVFSKEIADVSVRRGYKAHDVISLSNS------TPNLDEL
MTND_BACAN       PHLNENYS--LTDENKAEILAVFSKEIADVSARRGYKAHDVISLSNS------TPNLDEL
MTND_BACC1       THLKENYS--LTDENKAEILAVFSKEIADVSSRRGYKAHDVISLSNS------TPNLDEL
MTND_BACHK       THLKENYS--LTDENKAEILAVFSKEIADVSARRGYKAHDVISLSNS------TPNLDEL
MTND_BACCR       THLNENYS--LTDENKAEILAIFSKEIADVSARRGYKAHDVISLSSS------TPNLDEL
MTND_BACMK       THLKENYS--LTDENKAEILTLFSKEIADVSERRGYKAYDVVSLSNS------TPNLDEL
MTND_BACCN       AHLQNNYA--LTDENKEEILTLFSNEIADVSQRRGYKAHDIISLSSA------TPNLDEL
MTND_EXIS2       AELVDTYT--LTDADKQTILDTFQSEITDVSERRGYQTADIISLSDA------TPNLDEL
MTND_GEOKA       EHLRDKYV--LTDEEKNEILATFKDEIEDLAARRGYKTWDIVALSDA------TPNLDEL
MTND_GEOTN       EHLRDKYV--LTDEEKEEILATFKDEIEDLAARRGYKTWDIVALSDA------TPNLEEL
MTND_SULSY       EDVRKNYD--IDEENSKAIIQAYEKELKELKEKMGYITEDIVVLSEK------TPNLDGL
MTND_NOSS1       LFPHLLTQDALTDKEKCHIVDLHNSVFEFIQQENGYLWCDLLNVHPG------SPNLQTL
MTND_TRIV2       LFPHLLIQDALTDKEKCHIVDLHNSVFEFIQQENGYLWCDLLNVHPG------SPNLQTL
MTND_MICAE       ATRQLLKEASLTDEEKEIVLTSLDGYFEQLKQEAGYQARDLIVLHPD------IANLDTL
MTND_MICAN       ATRQLLKQASLTDEEKEIVLTSLDGYFEQLKQEAGYQARDLIVLHPE------IANLDTL
MTND_TRIEI       ETHNLLEKDVLSDDQKEEFLQSVDHYFEELKETAGYQSRDLLAIHPE------IPNLDAI
MTND_DELAS       GLAALLAQAQLDDGGKATVVQAVGMLVVDECVAHGYHSMDLVVLHPG------TPGLDEA
MTND_LEPBA       SLDLILGQKGLSDAEKEEVLSGLEYRFDQLKKQHGYKANDLVVLHDE------VPGISDM
MTND_LEPBP       SLDLILGQKGLSDAEKEEVLSGLEYRFDQLKKQHGYKANDLVVLHDE------VPGISDM
MTND_LEPBJ       NAADLTDKEILADVEKEELLKKLDDRFETLKEKEGYQSRDLIVLHPN------VSGLNDM
MTND_LEPBL       NAADLTDKEILADVEKEELLKKLDDRFETLKEKEGYQSRDLIVLHPN------VSGLNDM
MTND_LEPIN       NASNLTDKEVLVDTEKEELLKKLDDRFETLKAKEGYQSRDLIVLHPN------VSGLNEM
MTND_LEPIC       NASNLTDKEVLVDTEKEELLKKLDDRFETLKAKEGYQSRDLIVLHPN------VSGLNEM
MTND_RHOPA       ALAETLARPLLDDTSAATVLDALPPRPE-------FPSRDLIVLHPD------RPDNEQL
MTND_RHOPT       ALAETLARPLLDDTAAATVLDALPPRPE-------FPSRDLIVLHPE------RPDNEQL
                                   ..                   *   :                

MTND_CITK8       RAKFLNEHTHGED-EVRFFVEGAGLFCLHI-GDQ-VYQVLCEKNDLISVPAGTPHWFDMG
MTND_ENT38       RAKFLNEHTHGED-EVRFFVEGAGLFCLHI-DDQ-VYQVLCEKNDLISVPAGTPHWFDMG
MTND_KLEOX       REKFLNEHTHGED-EVRFFVEGAGLFCLHI-GDE-VFQVLCEKNDLISVPAHTPHWFDMG
MTND_KLEP7       REKFLNEHTHGED-EVRFFVEGAGLFCLHI-GDE-VFQVLCEKNDLISVPAHTPHWFDMG
MTND_CROSK       RGKFLNEHTHGED-EVRFFVEGAGLFCLHI-GDK-VYQVLCEKNDLISVPAGTPHWFDMG
MTND_CROS8       RDKFLNEHTHGED-EVRFFVEGAGLFCLHI-GDK-VYQVLCEKNDLISVPAGTPHWFDMG
MTND_ERWT9       RSKFLSEHTHGED-EVRFFVEGAGLFCLHL-DGH-IFQVLCEKNDLISVPAGTPHWFDMG
MTND_YERPP       REKFLSEHTHGED-EVRFFVEGSGLFCLHL-NEK-VYQILCEKNDLLSVPADIPHWFDMG
MTND_YERPG       REKFLSEHTHGED-EVRFFVEGSGLFCLHL-NEK-VYQILCEKNDLLSVPADIPHWFDMG
MTND_YERP3       REKFLSEHTHGED-EVRFFVEGSGLFCLHL-NEK-VYQILCEKNDLLSVPADIPHWFDMG
MTND_YERPS       REKFLSEHTHGED-EVRFFVEGSGLFCLHL-NEK-VYQILCEKNDLLSVPADIPHWFDMG
MTND_YERPB       REKFLSEHTHGED-EVRFFVEGSGLFCLHL-NEK-VYQILCEKNDLLSVPADIPHWFDMG
MTND_YERPY       REKFLSEHTHGED-EVRFFVEGSGLFCLHL-NEK-VYQILCEKNDLLSVPADIPHWFDMG
MTND_YERE8       REKFLSEHTHGED-EVRFFVEGAGLFCLHL-NSK-IYQILCEKNDLLSVPADTPHWFDMG
MTND_SERP5       RSKFLSEHTHGED-EVRFFVEGAGLFCLHL-DGK-IFQILCEKNDLISVPANTRHWFDMG
MTND_SODGM       RTKFLAEHTHGED-EVRFLVEGAGLFCLHV-QGK-IYQILCEKNDLISVPAGTAHWFDMG
MTND2_PECAS      RTKFLSEHIHHED-EVRFFVEGAGLFCLHL-NGK-IYQILCEKNDLLSVPAGTAHWFDMG
MTND_ALCBS       RQKFLEEHRHSED-EVRFFVEGQGLFTLHI-NGK-VYEVLCSKGDLISVPANTPHWFDMG
MTND_PROM3       RQKFLAEHTHAED-EVRFFVEGRGLFCLHI-GAE-VLQVLCEQNDCINVPAGTRHWFDMG
MTND_PROMM       RQKFLDEHTHAED-EVRFFVEGCGLFCLHI-GAE-VLQVLCEQNDCINVPAGTRHWFDMG
MTND_SYNPW       RQKFLSEHTHAED-EVRLFVEGRGLFCLHI-KSE-VLQVTCETNDWISVPAGTRHWFDMG
MTND_SYNS9       RSKFLAEHTHAED-EVRFFVEGRGLFCLHL-GAE-VLLTLCERGDLIRVPAGTKHWFDMG
MTND_SYNPX       RNKFLSEHTHAED-EVRFFVEGQGLFSLHI-DKE-VLVTLCERGDLISVPAGTRHWFDMG
MTND_SYNSC       RRKFLEEHTHAED-EVRFFVEGCGLFVLHI-GSE-VLSVLCERGDLMRVPAGTRHWFDMG
MTND_SYNR3       RQKFLSEHTHSED-EVRFFVDGRGLFCLHI-GDE-VLQVLCERNDWLSVPAGTRHWFDMG
MTND_SYNS3       RQTFRQEHQHAED-EVRFFVEGCGLFALHI-KDE-VLQVICEANDWIAIPAGTRHWFDMG
MTND_SYNE7       RQKFLAEHIHSED-EVRFFVAGQGLFSLHL-GDH-VYALLCTQNDWISVPAGTRHWFDMG
MTND_SYNP6       RQKFLAEHIHSED-EVRFFVAGQGLFSLHL-GDH-VYALLCTQNDWISVPAGTRHWFDMG
MTND_PSEAE       RAKFLDEHRHGED-EVRFFVAGRGLFVLHI-EEH-VYAVLCERNDLISVPAGTRHWFDMG
MTND_PSEAB       RAKFLDEHRHGED-EVRFFVAGRGLFVLHI-EEH-VYAVLCERNDLISVPAGTRHWFDMG
MTND_PSEA7       RAKFLDEHRHGED-EVRFFVAGRGLFVLHI-EEH-VYAVLCERNDLISVPAGTRHWFDMG
MTND_PSEU5       RAKFLDEHRHAED-EVRFFVAGRGLFTLHI-EDM-VYAVLCEKNDLISVPAGTRHWFDMG
MTND_PSEU2       RARFLEEHRHGED-EVRFFVAGRGLFTLHI-DDY-VYAVLCEKNDLISVPAGTRHWFDMG
MTND_PSESM       RARFLEEHRHGED-EVRFFVAGRGLFTLHI-DDY-VYAVLCEKNDLISVPAGTRHWFDMG
MTND_PSE14       RAKFLEEHRHGED-EVRFFVAGRGLFTLHI-DDY-VYAVMCEKNDLISVPAGTRHWFDMG
MTND_PSEPF       RAKFLEEHRHGED-EVRFFVAGRGLFTLHI-DDY-VYAVLCEKNDLISVPAGTKHWFDMG
MTND_PSEF5       RASFLDEHRHSED-EVRFFVAGRGLFNLHI-DDY-VYAVLCERNDLISVPAGTAHWFDMG
MTND_AQUAE       RQKFLKEHTHSDF-EVRYFVYGDGVFYLHP-NDK-VYILHCTAGDLISVPPNTKHWFDMG
MTND_HYDS0       RNVFLKEHTHSDF-EVRFFVDGSGTFYLHI-DDK-VYVAFCEKGDFISVPAYTKHWFDMG
MTND_METCA       RARFLREHTHSDF-EVRFFVEGRGLFYLHP-GDR-VYAILCERGDLLSVPSNTRHWFDMG
MTND_HAHCH       RKKFLDEHRHSED-EVRFFVRGQGLFYLHL-EDK-VYVVLCRKNDLISVPNGTKHWFDMG
MTND_MARHV       RQKFLDEHTHSED-EVRFFVRGQGLFYLHF-GDQ-VYALLCEKNDLISVPDGTRHWFDMG
MTND_SORC5       RRKFLDEHIHTED-EARFFVEGRGLFCIHH-GER-VLSFLVEKGDLISVPAGTRHWFDMG
MTND_GLUDA       RDKFLSEHTHSED-EVRFFVHGSGNFVLHV-DGR-VYDVCCTAGDLISVPRGTPHWFDAG
MTND_GLUOX       RKKFLSEHTHSED-EVRFFVHGQGAFVLHI-RGR-VYSVLCTQGDLISVPAGIPHWFDAG
MTND_GRABC       RQKFLSEHTHTED-EVRFFVHGSGNFILHV-DDR-VYDAHCTQGDLISVPTGIKHWFDAG
MTND_ACICJ       REKFLNEHIHTED-EVRFFVRGSGHFVMHL-DGK-VYDAYCTEGDLISVPANTRHWFDAG
MTND_STRMK       RKKFLDEHFHKED-EVRFFVAGSGLFTLHV-GDK-VYEIECVKDDLIAVPDGTTHWFDMG
MTND_STRM5       RRKFLDEHFHKED-EVRFFVAGSGLFTLHV-GDK-VYEIECVKDDLIAVPDGTTHWFDMG
MTND_XANAC       RAKFLDEHFHKED-EVRFFVAGSGLFTLHV-DAK-VYEIECVKDDLIAVPDGTLHWFDMG
MTND_XANC5       RAKFLDEHFHKED-EVRFFVAGSGLFTLHV-DAK-VYEIECVKDDLIAVPDGTLHWFDMG
MTND_XANOR       RAKFLDEHFHKED-EVRFFVAGSGLFTLHV-DAK-VYEIECVKDDLIAVPDSTLHWFDMG
MTND_XANOM       RAKFLDEHFHKED-EVRFFVAGSGLFTLHV-DAK-VYEIECVKDDLIAVPDSTLHWFDMG
MTND_XANOP       RAKFLDEHFHKED-EVRFFVAGSGLFTLHV-DAK-VYEIECVKDDLIAVPDSTLHWFDMG
MTND_XANCP       RAKFLDEHFHKED-EVRFFVAGSGLFTLHV-DAQ-VYEIECVKDDLIAVPDSTLHWFDMG
MTND_XANC8       RAKFLDEHFHKED-EVRFFVAGSGLFTLHV-DAQ-VYEIECVKDDLIAVPDSTLHWFDMG
MTND_XANCB       RAKFLDEHFHKED-EVRFFVAGSGLFTLHV-DAQ-VYEIECVKDDLIAVPDSTLHWFDMG
MTND_XYLF2       RAKFLEEHFHKED-EVRFFVAGSGLFTVHS-GNK-VYEIECVKNDLIAIPDGTLHWFDMG
MTND_XYLFT       RAKFLEEHFHKED-EVRFFVAGSGLFTVHS-GNK-VYEIECVKNDLIAIPDGTLHWFDMG
MTND_XYLFM       RAKFLEEHFHKED-EVRFFVAGSGLFTVHS-GNK-VYEIECVKNDLIAIPDGTLHWFDMG
MTND_XYLFA       RAKFLEEHFHKED-EVRFFVAGSGLFTVHS-GNK-VYEIECVKNDLIAIPDGTQHWFDMG
MTND_PARL1       RQKFLAEHTHDDD-EVRFFVEGAGAFYLRK-DGR-VYRVVCERNDLISVPAGTTHWFDTG
MTND_BRASB       RGKFLQEHVHVED-EVRFFVEGTGAFYLHL-DDK-VYQLVGEAGDLLSVPHGVKHWFDGG
MTND_FRAAA       RARFLAEHTHDDD-EIRFFAAGSGVFYLHV-DER-VQAVRCEAGDLISVPKGTTHWFDMG
MTND_STRAW       RAKFLQEHTHDDDDEVRFFVSGSGIFYLHV-NGE-VHAVYCEKGDLLGVPRGTTHWFDMG
MTND1_NOCFA      RGRFLDEHRHTEH-EVRFFVEGRGCFYLHL-GDK-VYALVCEAGDLVSVPAGTTHWFDMG
MTND2_NOCFA      RTKFLDEHRHAED-EVRFFAAGRGCFYLHL-GAE-VLAVVCEGGDLMSVPAGTLHWFDMG
MTND_SACEN       REKFLSEHTHDDD-EDRFFARGAGVFYLHI-GDR-VYAMLCEAGDLLSVPANTTHWFDMG
MTND1_PECAS      REKFLQEHTHSED-EVRFFVRGSGAFFVPI-GEQ-VFQLTCEAGDLLRVPANTPHWFDCG
MTND_SYNP2       REKFLAEHTHSED-EVRFFVAGQGLFWFNL-DGTAVFNVCCEAGDLISVPQGTKHWFDAG
MTND_BACLD       LKNFKQEHHHTDD-EVRFIVSGHGIFAIEG-KDGTFFDVLLNPGDLISVPENTRHYFTLQ
MTND_BACSU       LENFKREHHHTDD-EVRFIVSGHGIFVIQG-QDGTFFDVRLNPGDLISVPENIRHYFTLQ
MTND_BACVZ       LKNFQREHHHTDD-EVRFIVSGHGIFVIQG-KDGTFFDVRLNPGDLISVPENIRHYFTLQ
MTND_BACP2       LQNFQREHHHTDD-EVRFIVSGHGIFAIQG-KDGVFFDVRLNPGDLISVPPHIRHYFTLQ
MTND_BACCZ       LINFQKEHHHTDD-EVRFIVSGHGIFAIEG-KDGTFFDVELEPGDLISVPENARHYFTLQ
MTND_BACAH       LINFQKEHHHTDD-EVRFIVSGHGIFAIEG-KDGTFFDVELEPGDLISVPENARHYFTLQ
MTND_BACAN       LINFQKEHHHTDD-EVRFIVSGHGIFAIEG-KDGTFFDVELEPGDLISVPENARHYFTLQ
MTND_BACC1       LINFQKEHHHTDD-EVRFIVSGHGIFAIEG-KDGTFFDVELEPGDLISVPENARHYFTLQ
MTND_BACHK       LINFQKEHHHTDD-EVRFIVSGHGIFAIEG-KDGTFFDVELDPGDLISVPENARHYFTLQ
MTND_BACCR       LINFQKEHHHTDD-EVRFIVSGHGIFAIEG-KDGKFFDVELEPGDLISVPENARHYFTLQ
MTND_BACMK       LINFQKEHHHTDD-EVRFIVSGHGIFAIEG-KDGRFFDVELEPGDLISVPENARHYFTLQ
MTND_BACCN       LINFKQEHHHTDD-EVRFIVSGHGIFAIQG-KDGRFFDVELEPGDLISVPENVRHYFTLQ
MTND_EXIS2       LVNFQKEHHHTDD-EVRFIVSGHGVFAIQD-DEVGYYNIELNPGDLISVPVNTRHYFTLQ
MTND_GEOKA       LKKFEQVHIHTED-EVRAITAGHGIFIIKGDKETGYFDVELEAGDVISVPEGNPHYFTLM
MTND_GEOTN       LKKFEQVHIHTED-EVRAITAGHGIFIIKGDKETGYFDVELEAGDVISVPEGNPHYFTLM
MTND_SULSY       MAKFKREHHHIDD-EVRFVVDGSGIFPVKI--EDDIVDIHVEAGELIVVPAGARHWFELD
MTND_NOSS1       IATYAQYHTHTAP-EALYVLAGEMIFGFVKPDGS-QVQLLVQSQDYLHIPSGVEHWCSLT
MTND_TRIV2       IATYAKYHTHTAP-EALYVLAGEMIFGFVKPDGS-QVQLLVQSQDYLHIPSGVEHWCSLT
MTND_MICAE       LAKFERCHTHADD-EVRYIIDGEGVFGFVFPDGS-QGELTIQPQEYINVPAHSEHWFHLT
MTND_MICAN       LAKFERCHTHADD-EVRYIIDGEGVFGFVFADGS-QGELTIQPQEYINVPAHSEHWFHLT
MTND_TRIEI       LSKFDKCHTHADD-EARYIVAGICIFGFVRPDDS-QVELTLQPQEYINIPANTEHWFYLT
MTND_DELAS       LERFDKPHTHADD-EVRYILEGEGLFGFFDAGGQ-ERVLRVQPGDYLRIPAGVEHRFTLT
MTND_LEPBA       LAKFDKLHIHTDE-EVRYIIDGSGIFGFIID-GE-RFEVHVGKGDFISIPANTNHWFTLD
MTND_LEPBP       LAKFDKLHIHTDE-EVRYIIDGSGIFGFIID-GE-RFEVHVGKGDFISIPANTNHWFTLD
MTND_LEPBJ       LAKFDRVHYHTDE-EVRYIVDGSGVFGFVLK-GE-KFLVHVVKDDFISVPRNTNHWFYLD
MTND_LEPBL       LAKFDRVHYHTDE-EVRYIVDGSGVFGFVLK-GE-KFLVHVVKDDFISVPRNTNHWFYLD
MTND_LEPIN       LAKFDKVHYHTDE-EVRYIVDGSGVFGFAFK-DE-KFLVHVYKDDFISVPRNTNHWFYLD
MTND_LEPIC       LAKFDKVHYHTDE-EVRYIVDGSGVFGFAFK-DE-KFLVHVYKDDFISVPRNTNHWFYLD
MTND_RHOPA       ATKFENWHRHAGD-EIRHILDGAGIFGVIVD-GQ-RADLHVGPGDFIVVPAGLEHNFRLT
MTND_RHOPT       ATKFENWHRHAGD-EIRHILDGAGIFGVIVD-GQ-RADLHVGPGDFIVVPAGLEHNFRLT
                    :   * *    *   .  *   * .                : : :*    *     

MTND_CITK8       SEPNFTAIRIFDNPE---------------GWVAQFTGDAIADAYPRLL-----------
MTND_ENT38       SEPNFTAIRIFDNPE---------------GWIAQFTGDAIADAYPRLP-----------
MTND_KLEOX       SEPNFTAIRIFDNPE---------------GWIAQFTGDDIASAYPRLA-----------
MTND_KLEP7       SEPNFTAIRIFDNPE---------------GWIAQFTGDDIASAYPRLA-----------
MTND_CROSK       SEPHFTAIRIFDNPE---------------GWIANFTGSPIAEAYPRLA-----------
MTND_CROS8       SEPHFTAIRIFDNPE---------------GWIANFTGSPIAEAYPRLA-----------
MTND_ERWT9       SSPHFTAIRIFDNQE---------------GWIAKFTGDPIADGYPRLP-----------
MTND_YERPP       SAPNFTAIRVFDNPE---------------GWIARSTGDNIADGYPRLA-----------
MTND_YERPG       SAPNFTAIRVFDNPE---------------GWIARSTGDNIADGYPRLA-----------
MTND_YERP3       SAPNFTAIRVFDNPE---------------GWIARSTGDNIADGYPRLA-----------
MTND_YERPS       SAPNFTAIRVFDNPE---------------GWIARSTGDNIADGYPRLA-----------
MTND_YERPB       SAPNFTAIRVFDNPE---------------GWIARSTGDNIADGYPRLA-----------
MTND_YERPY       SAPNFTAIRVFDNPE---------------GWIARSTGDNIADGYPRLA-----------
MTND_YERE8       SKPNFTAIRVFDNPE---------------GWVARFTGDKIADSYPRLD-----------
MTND_SERP5       SAPNFTAIRVFDNPE---------------GWVAHFTGDNIADAYPRLD-----------
MTND_SODGM       EAPSFTAIRVFDNPE---------------GWIARFTGDAIADEYPRLVR----------
MTND2_PECAS      PEPHFTAIRLFDNPE---------------GWIAHFTGDKIADVYPKLEC----------
MTND_ALCBS       PEPRFVAIRLFNNPD---------------GWVANFTGSDIAQQFNRLA-----------
MTND_PROM3       SKPQFCAVRFFDNPE---------------GWIASFTGDAIAERFAKLP-----------
MTND_PROMM       SKPQFCAVRFFDNPE---------------GWIANFTGDAIAERFAKLP-----------
MTND_SYNPW       EKPYFCAIRFFNNPN---------------GWVANFTNDPIAERFSKLRD----------
MTND_SYNS9       GQPAFCAVRWFNNAV---------------GWVATFTGNTISERFPTLD-----------
MTND_SYNPX       PTPSFCALRFFNNSE---------------GWVATFTGDSIAERFPRLD-----------
MTND_SYNSC       SQPRFCAVRWFNNPE---------------GWVAQYTGSSISQRFPRLD-----------
MTND_SYNR3       ERPCFSAIRFFNNQD---------------GWVAQFTGDPIAKRYPLLGS----------
MTND_SYNS3       VDPNYCVIRFFKNSG---------------GWAASFTHDPIADHYPGLDQARKQTTQG--
MTND_SYNE7       SQPYFTALRFFNNPRRLGRSVYRQRHRQSVPAPALNSGSERDNFILSLALAC--------
MTND_SYNP6       SQPYFTALRFFNNPE---------------GWVAQFTGSDIASQFPLLP-----------
MTND_PSEAE       EHPHFVAVRLFNNPE---------------GWVAQFTGDDIASRFPLLED----------
MTND_PSEAB       EHPHFVAVRLFNNPE---------------GWVAQFTGDDIASRFPLLED----------
MTND_PSEA7       EHPHFVAVRLFNNPE---------------GWVAQFTGDDIASRFPLLED----------
MTND_PSEU5       EQPSFVAIRLFNNPD---------------GWTAQFTGERIADQFPRLDD----------
MTND_PSEU2       ENPHFVAIRLFNNPE---------------GWVANFTGEDIAGRFPRLED----------
MTND_PSESM       ENPHFVAIRLFNNPD---------------GWVANFTGEDIAGRFPRLED----------
MTND_PSE14       ENPHFVAIRLFNNPE---------------GWVANFTGEDIAGRFPRLED----------
MTND_PSEPF       ENPHFVAIRLFNNPE---------------GWVANFTGEDIAGRFPRLED----------
MTND_PSEF5       ERPNLVAIRMFNNPQ---------------GWNASLTGDAIASQFPRLDD----------
MTND_AQUAE       ENPNFKCIRLFTTPE---------------GWVAEYTGSDIAEKFPKYEEVVNG------
MTND_HYDS0       SKPFFKAIRFFLIPE---------------GWVADFTGSDISLKIPSHDDIASL------
MTND_METCA       AEPCLKCIRLFTTAE---------------GWVADFTGSDIGDRFPRLEDYLKHYA----
MTND_HAHCH       PEPEFTCVRLFTNPE---------------GWVAQFTGDEIASKAPRFEQLIEEA-----
MTND_MARHV       PEPEFTCIRLFSNPE---------------GWVASFTGEDIASRLPRYESLAGGA-----
MTND_SORC5       PEPSFTCIRWFSDPK---------------GWVAEHTGSDIASRFPRLEA----------
MTND_GLUDA       LSPDVVALRVFTDTT---------------GWIADYTGDDIARRFPVS------------
MTND_GLUOX       PSPDVVALRVFTDTT---------------GWIAQYTGDDIANRFPAEVPVEASGNS---
MTND_GRABC       ETPFVTALRVFTDTT---------------GWVAHYTGDPIADHFPAA------------
MTND_ACICJ       STPDFIALRIFTDTS---------------GWVAHFTGDQISARFPVAA-----------
MTND_STRMK       DEPSFVAIRFFTEPD---------------GWVGHFTGTDIAQKFPRYVPTQAS------
MTND_STRM5       DEPSFVAIRFFTEPD---------------GWVGHFTGTDIAQKFPRYVPTQAS------
MTND_XANAC       PEPHFVAIRFFTEPD---------------GWVGHFTGTEIAKQFPRYAPKKPHKAS---
MTND_XANC5       PEPHFVAIRFFTEPD---------------GWVGHFTGTEIAKQFPRYAPEKPHKAS---
MTND_XANOR       PEPHFVAIRFFTEPD---------------GWVGHFTGTEIAKQFPRYAPEKPHKAS---
MTND_XANOM       PEPHFVAIRFFTEPD---------------GWVGHFTGTEIAKQFPRYAPEKPHKAS---
MTND_XANOP       PEPHFVAIRFFTEPD---------------GWVGHFTGTEIAKQFPRYAPEKPHKAS---
MTND_XANCP       PEPHFVAIRFFTEPD---------------GWVGHFTGTEIAKQFPRYAPEKPPKAS---
MTND_XANC8       PEPHFVAIRFFTEPD---------------GWVGHFTGTEIAKQFPRYAPEKPPKAS---
MTND_XANCB       PEPHFVAIRFFTEPD---------------GWVGHFTGTEIAKQFPRYAPEKPPKAS---
MTND_XYLF2       AAPYFVAIRFFTEPD---------------GWVGHFTGTDIAQRFPRYIPEGCQSAH---
MTND_XYLFT       AAPYFVAIRFFTEPD---------------GWVGHFTGTDIAQRFPRYIPEGCQSAH---
MTND_XYLFM       AAPYFVAIRFFTEPD---------------GWVGHFTGTDIAQRFPRYIPEGCQSAH---
MTND_XYLFA       AAPYFVAIRFFTEPD---------------GWVGHFTGTDIAQRFPRYIPEGCQSAH---
MTND_PARL1       AAPHFCAIRIFTSPE---------------GWVGHFTGDDIATRFPKFESEPQ-------
MTND_BRASB       PEADFTCIRLFTNQE---------------GWVAHFTGDAISDAFPKYEIAA--------
MTND_FRAAA       VEPDFAAVRFFRAED---------------GWVGAFTGSDIATRIPDFDALARRSSSAAQ
MTND_STRAW       TRPAFTAIRFFHEED---------------GWIGSFTGSTIASRFPDYDTIHAGHVGSAA
MTND1_NOCFA      AQPHFCAIRFFERED---------------GWIGDFTGSPIASTMPTLDELVG-------
MTND2_NOCFA      ERPDFIAVRFFEEAD---------------GWVGDFTGDRISAGFPTLDDLLTAP-----
MTND_SACEN       TEPDFVAIRFFHDDD---------------GWVGAFLNTDTAEKFPTFDELMASR-----
MTND1_PECAS      EFPDFVAIRIFTNPE---------------GWVGHFTGRETFH-----------------
MTND_SYNP2       PVPNVKAIRIFSDTA---------------GWTPHYTGSQVEQQYRAITL----------
MTND_BACLD       EDRKVVAVRIFVTTE---------------GWVPIYEKENVNQS----------------
MTND_BACSU       EDRKVVAVRIFVTTE---------------GWVPIYEKDSVNQ-----------------
MTND_BACVZ       EDRRVVAIRIFVTTE---------------GWVPIYENESVQN-----------------
MTND_BACP2       EDRKVVSVRIFVTTE---------------GWVPIYEEETV-------------------
MTND_BACCZ       DDRQVVAIRIFVTTE---------------GWVPIY------------------------
MTND_BACAH       DDRQVVAIRIFVTTE---------------GWVPIY------------------------
MTND_BACAN       DDRQVVAIRIFVTTE---------------GWVPIY------------------------
MTND_BACC1       DDRQVVAIRIFVTTE---------------GWVPIY------------------------
MTND_BACHK       DDRQVVAIRIFVTTE---------------GWVPIY------------------------
MTND_BACCR       DDRQVVAIRIFVTTE---------------GWVPIY------------------------
MTND_BACMK       DDRQVVAIRIFVTTE---------------GWVPIY------------------------
MTND_BACCN       DDRQVVAIRIFVTTA---------------GWVPIY------------------------
MTND_EXIS2       EDRKVVAVRIFVTTD---------------GWVPIYEKDPIETAN---------------
MTND_GEOKA       DDRRVVAVRLFIDPS---------------GWVAHPYEEKEEAVQ---------------
MTND_GEOTN       DDRQVVAVRLFIDPS---------------GWVAHPYEEKEEVNS---------------
MTND_SULSY       ENRKIKCIRVFKTPA---------------GWEAIYNENETATMRD--------------
MTND_NOSS1       ASLNFKAVRYFTAAD---------------GWVPNYTGTRLNDSLNK-------------
MTND_TRIV2       ASLSFKAVRYFTAAD---------------GWVPNYTGTQLNDSLNK-------------
MTND_MICAE       ASKRVKAVRYFTTTA---------------GWVPEYTETVIRFPSLTAV-----------
MTND_MICAN       ASKRVKAVRYFTSTA---------------GWVPEYTETVIRFPSLTAV-----------
MTND_TRIEI       PEKRVKAVRYFSSTE---------------GWTPHYTSTEIHFKKS--------------
MTND_DELAS       ATRRIKALRLFADTA---------------GWVAQYTQRPAAAMEVPA------------
MTND_LEPBA       QTMRIKAVRYFKDNS---------------GWTPVYVDESKVLINA--------------
MTND_LEPBP       QTMRIKAVRYFKDNS---------------GWTPVYVDESKVLINA--------------
MTND_LEPBJ       DKKRIKAVRYFRDMS---------------GWVPNYVEETNSLD----------------
MTND_LEPBL       DKKRIKAVRYFRDMS---------------GWVPNYVEETNSLD----------------
MTND_LEPIN       DKKRIKAVRYFQDMS---------------GWVPNYVEETNSLD----------------
MTND_LEPIC       DKKRIKAVRYFQDMS---------------GWVPNYVEETNSLD----------------
MTND_RHOPA       AARRIKAVRYLSDAE---------------GWSAEFTGRAA-------------------
MTND_RHOPT       AARRIKAVRYLSDAE---------------GWSAEFTGRAA-------------------
                        :* :                                                 

MTND_CITK8       ----------
MTND_ENT38       ----------
MTND_KLEOX       ----------
MTND_KLEP7       ----------
MTND_CROSK       ----------
MTND_CROS8       ----------
MTND_ERWT9       ----------
MTND_YERPP       ----------
MTND_YERPG       ----------
MTND_YERP3       ----------
MTND_YERPS       ----------
MTND_YERPB       ----------
MTND_YERPY       ----------
MTND_YERE8       ----------
MTND_SERP5       ----------
MTND_SODGM       ----------
MTND2_PECAS      ----------
MTND_ALCBS       ----------
MTND_PROM3       ----------
MTND_PROMM       ----------
MTND_SYNPW       ----------
MTND_SYNS9       ----------
MTND_SYNPX       ----------
MTND_SYNSC       ----------
MTND_SYNR3       ----------
MTND_SYNS3       ----------
MTND_SYNE7       ----------
MTND_SYNP6       ----------
MTND_PSEAE       ----------
MTND_PSEAB       ----------
MTND_PSEA7       ----------
MTND_PSEU5       ----------
MTND_PSEU2       ----------
MTND_PSESM       ----------
MTND_PSE14       ----------
MTND_PSEPF       ----------
MTND_PSEF5       ----------
MTND_AQUAE       ----------
MTND_HYDS0       ----------
MTND_METCA       ----------
MTND_HAHCH       ----------
MTND_MARHV       ----------
MTND_SORC5       ----------
MTND_GLUDA       ----------
MTND_GLUOX       ----------
MTND_GRABC       ----------
MTND_ACICJ       ----------
MTND_STRMK       ----------
MTND_STRM5       ----------
MTND_XANAC       ----------
MTND_XANC5       ----------
MTND_XANOR       ----------
MTND_XANOM       ----------
MTND_XANOP       ----------
MTND_XANCP       ----------
MTND_XANC8       ----------
MTND_XANCB       ----------
MTND_XYLF2       ----------
MTND_XYLFT       ----------
MTND_XYLFM       ----------
MTND_XYLFA       ----------
MTND_PARL1       ----------
MTND_BRASB       ----------
MTND_FRAAA       PQAEAPAAAS
MTND_STRAW       ----------
MTND1_NOCFA      ----------
MTND2_NOCFA      ----------
MTND_SACEN       ----------
MTND1_PECAS      ----------
MTND_SYNP2       ----------
MTND_BACLD       ----------
MTND_BACSU       ----------
MTND_BACVZ       ----------
MTND_BACP2       ----------
MTND_BACCZ       ----------
MTND_BACAH       ----------
MTND_BACAN       ----------
MTND_BACC1       ----------
MTND_BACHK       ----------
MTND_BACCR       ----------
MTND_BACMK       ----------
MTND_BACCN       ----------
MTND_EXIS2       ----------
MTND_GEOKA       ----------
MTND_GEOTN       ----------
MTND_SULSY       ----------
MTND_NOSS1       ----------
MTND_TRIV2       ----------
MTND_MICAE       ----------
MTND_MICAN       ----------
MTND_TRIEI       ----------
MTND_DELAS       ----------
MTND_LEPBA       ----------
MTND_LEPBP       ----------
MTND_LEPBJ       ----------
MTND_LEPBL       ----------
MTND_LEPIN       ----------
MTND_LEPIC       ----------
MTND_RHOPA       ----------
MTND_RHOPT       ----------