CLUSTAL format seed alignment for MF_01683

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

MTNK_GEOKA            ----------------------MTTVQTSVYEPLTEPKAVALAVRL------GLFRDGTP
MTNK_GEOTN            ----------------------MAIIQSSAYEPLTEQKATALAVRL------GLFRDGTP
MTNK_BACAH            ----------------------------MGYYSLTEVTAVQYAKEH------GYFEKKAN
MTNK_BACCZ            ----------------------------MGYYSLTEVTAVQYAKEH------GYFEKKAN
MTNK_BACHK            ----------------------------MGYYSLTEVTAVQYAKEH------GYFEKKAN
MTNK_BACC1            ----------------------------MGYYALTETTAIQYAKEH------GYFEKKAN
MTNK_BACCR            ----------------------------MGYYSLTEITAVQYAKDY------GYFEEKAN
MTNK_BACMK            ----------------------------MGYYSLTETTAIQYAKEH------GYFEKKAN
MTNK_BACCN            ----------------------------MGYYALTEETAVQYVKEQ------GYFEKEAT
A0A2C2UTJ6_BACCE      ----------------------------MGYRSLTIETAAQYVKEH------GYFRTDAK
D5DZB6_BACMQ          ----------------------MSTTKTEKYQPLTEISAIKLVKKL------GLFDATEA
MTNK_BACVZ            ----------------------MSATKTSLYEQLTESSAAALAVKL------GLFQSKST
A0A5C8IWL2_BACAM      ----------------------MSATKTSLYEQLTESSAAALAVKL------GLFQSKST
MTNK_BACSU            ----------------------MGVTKTPLYETLNESSAVALAVKL------GLFPSKST
MTNK_BACLD            ----------------------MTVTKTAAYETLTESSAAALAVRL------GLFPSKST
MTNK_BACP2            -----------------------MVTLTASYEELTESSAVALAIRL------GLIQESSH
A0A1N6YGA6_9BACI      ---------------------------MSSYQSLTIDSAAALVKKL------GLFDESES
A0A172ZBE9_9BACL      ----------------------MTTTADSIYEPLTEETAIQLARRL------NLFDAEAD
W1SQU7_9BACI          ----------------------MSLLKQTTYQPLTETSATELALAL------NLFSDNPE
I3E801_BACMM          ----------------------MALLQQQNYETLNEVSAAKLAKKL------HLFHEDAE
U5LA21_9BACI          ----------------------MTLVKNK-YAPLTEKTAAELAVSL------GQFPGNAS
A0A2A4BIB2_9BACI      -----------------------MTQNHSNFKRLTNETAITLAKKL------GLVNADAS
A0A1B3XQ14_9BACI      -----------------------MTQNHSNFKRLTSVTAIILAKKL------GLVDADAN
MTNK_EXIS2            ----------------------------MGYQAFTVQDAIERVRTL------GLIG-NEP
C4KZ49_EXISA          ----------------------------MAYEAFTEQSVVDHVRQL------GLLE-EGI
A0A2B8TP98_9BACI      -------------------MNLVTVIERKEYRPLTEQTAITYLQKL------GYFK-NER
A0A087N2G1_9BACI      ------------------------MTTATQYEALTNTTAIAYAKDN------NLLS--GS
A0A078M781_9BACL      ------------------------MTTATQYKELTNTTAIAYAKDN------SLLN--GN
D3FZB4_ALKPO          ---------------------MSTSIATTSYEPLTEETAIAYIEKLNQKL--GLFPAPSL
W4QXV8_BACA3          ----------------------MTTQLEQVYEPLNTKTAIELSKNL------QLFDLHDE
A0A0V8JCC5_9BACI      ----------------------MATSTKQAYTPLNEQTVIELSQKL------GLFSDYRS
A0A0C2V366_9BACL      ----------------------MMNVRENIYEPFTEQSVLVYLEQK------GLITDRRN
MTNK_YERPB            ---------------------------MSRYHTFTAADAVEYARQFG-----QVADPQAL
MTNK_YERP3            ---------------------------MSRYHTFTAADAVEYARQFG-----QVADPQAL
MTNK_YERPY            ---------------------------MSRYHTFTAADAVEYARQFG-----QVADPQAL
MTNK_YERE8            ---------------------------MSRYHTFTAADAVEYARQFG-----QIADPLAL
MTNK_SERP5            ---------------------------MSHYRTFTAADAVEYARQYG-----QLADPQAL
MTNK_PECAS            ---------------------------MSLYRTFTADDAVEYARQYG-----GVSQPQTL
MTNK_ENT38            ---------------------------MSQYRTFTAQDAVEYAKQFG-----GLDNPSSL
MTNK_CITK8            ---------------------------MSQYRTFTAQDAVEYARTFG-----GIDDPSTL
MTNK_KLEP7            ---------------------------MSQYHTFTAHDAVAYAQQFA-----GIDNPSEL
MTNK_CROS8            ---------------------------MSQYRTFTASDAVAYAQQFG-----GLSAPEAL
S3IRJ8_9ENTR          ---------------------------MSQYRTFNAADAVAYAQQFG-----GLASPSEL
D4GKZ6_PANAM          MYRRLNGLLRKINQVRLAPAFVDEERSMSQYRTFTAADAVEYAKTFG-----GMDDPSVL
H3R9J1_PANSE          ---------------------------MSQYRTFTAADAVEYAKQFG-----GLEDPSVL
MTNK_ERWT9            ---------------------------MSQYRTFAAADAVEYARQFG-----GVDNPNSL
D8MNJ9_ERWBE          ---------------------------MSQYRTFTAADAVDYARQFG-----GVENPESL
A0A1Y0LAF1_TATCI      ---------------------------MSQYQTFTATDAVEYARKFS-----GLKHPETL
A0A2A5JMV5_PSEO7      ---------------------------MSSYIEFDADKVIDYITNLG-----SFFEKNAT
A0A3R8U321_9GAMM      ---------------------------MSGYVAFDAEKVIDYVTHLG-----HFFAEGET
A0A2N5LR45_9GAMM      ---------------------------MTNYVAFNAQRAIDYVSTLIESKQCNFFAPGQA
I1E0Q6_9GAMM          ---------------------------MAEYHTFSTEDAMRFADEHS-----GLFGDHSK
A0A3M8FJJ0_9GAMM      ---------------------------MNKYQKLNAEKAIEYVKQYN-----IFFTHYEH
A0A364K0S0_9BACL      ---------------------------MENYRPFTEKDVVAYMQSFS-----QFFPNHAE
A0A2N5MFU1_9BACI      ----------------------------MGYHALNEMEAIQYVRKIA-----GIFPENAQ
C0ZL37_BREBN          ----------------------------MAYRALTEQEAVEYVKGIP-----GLFSEGAE
H6NEP3_9BACL          ---------------------------MSAYHPLTEAEAIEYARRLP-----DLFHAESE
I3DTV0_BACMM          ---------------------------MTNYHALTQAEAVEYAHGIE-----DVFPDGAQ
C6D8Q5_PAESJ          ---------------------------MSAYHALTEQEAIEIAGGIE-----GFFPADAK
D3EDI4_GEOS4          ---------------------------MSAYHPLNADEAIQLARSIP-----GRFPDHAE
A0A3S9H3F6_9FIRM      ---------------------------MTKYKPLKEKEAIEYVKGIEG-----LFDDDAE
A0A2G6KIB8_9BACT      ----------------------------MGYRSLDSHTAVDYVKSLD------LFPQDAT
MTNK_ECO45            ----------------------MTDSIPSGYKPLTCDTLPGYLSSRLTPSC-EPGGLPEE
                                                    :  :                          

MTNK_GEOKA            LACREIGDGNLNLVFHIVDQ-ETKQGVIIKQALPYAKVVGESWPLTLKRAVIESNALRTF
MTNK_GEOTN            LLCREIGDGNLNLVFHVVDQ-ETKQGIIIKQALPYAKVVGESWPLTLKRAVIESNALRTF
MTNK_BACAH            VVCHEIGDGNLNYVFKLDDG-E--KSIIIKQALPYAKVVGESWPLSIKRATIESKALQIF
MTNK_BACCZ            VVCHEIGDGNLNYVFKLDDG-E--KSIIIKQALPYAKVVGESWPLSIKRATIESKALQIF
MTNK_BACHK            VVCHEIGDGNLNYVFKLDDG-V--KSIIIKQALPYAKVVGESWPLSIKRATIESKALQIF
MTNK_BACC1            VFCHEIGDGNLNYVFKLDDG-E--KSIIIKQALPYAKVVGESWPLSIKRATIESKALKIF
MTNK_BACCR            VICHEIGDGNLNYVFKLDDG-E--KSIIIKQALPYAKVVGESWPLSIKRATIESKALQIF
MTNK_BACMK            VVCHEIGDGNLNYVFKLDDG-E--KSIIIKQALPYAKVVGESWPLSIKRATIESKALQIF
MTNK_BACCN            IVCREIGDGNLNYVFHLHDG-K--RGIIVKQALPYAKVVGESWPLSLNRATIESSALQIF
A0A2C2UTJ6_BACCE      LTCHEIGDGNLNYVFRVHDG-E--SGLIVKQALPYAKVVGESWPLSVRRATIESQALQVF
D5DZB6_BACMQ          LTAREIGDGNLNLVFHIIND-QTNKSIIVKQALPYAKVVGESWPLSLNRATIESNALKQF
MTNK_BACVZ            LTCREIGDGNLNYVFHVYDK-ENKKGLIIKQAIPYAKVVGESWPLTIDRARIESSALIRQ
A0A5C8IWL2_BACAM      LTCREIGDGNLNYVFHVYDK-ENKKGLIIKQAIPYAKVVGESWPLTIDRARIESSALIRQ
MTNK_BACSU            LTCQEIGDGNLNYVFHIYDQ-EHDRALIIKQAVPYAKVVGESWPLTIDRARIESSALIRQ
MTNK_BACLD            LTCREIGDGNLNLVFRVYDK-EQQRGLVIKQAVPYAKVVGESWPLTLDRARIESSALIRQ
MTNK_BACP2            LTCTEIGDGNLNYVFHIFDH-KQEKGLIIKQALPYAKVVGESWPLTLDRARIESAALIKQ
A0A1N6YGA6_9BACI      LTSNEIGDGNLNYVFHIKG---TDNSVIVKQALPYAKVVGESWPLTLERADIENRALRIQ
A0A172ZBE9_9BACL      LVCREIGDGNLNLVFHVTEP-TAGKGVIIKQALPYVRIIGEGWPLTLERARMESEALRIF
W1SQU7_9BACI          LSCKEIGDGNLNLVFHIVDD-KNRKGVIIKQALPYAKVVGESWPLTLKRAKIEADALLTF
I3E801_BACMM          LTSSEIGDGNLNLVFRVKDQ-LSGKSVIIKQALPYAKVVGESWPLTLKRAKIEADALKLF
U5LA21_9BACI          LATEEIGDGNLNLVFRIKEN-GTGKSLIIKQALPFAKVVGESWPLTLKRAAIEAEALKLF
A0A2A4BIB2_9BACI      LKCNEIGDGNLNYVFHITDT-VTNKGLIIKQAVPYAKVLGESWPLTLKRAAIEANALIHF
A0A1B3XQ14_9BACI      LSCKEIGDGNLNYVFHITDT-ATNKGIIIKQAVPYAKVLGESWPLTLKRAAIEANALIHF
MTNK_EXIS2            VTAEEIGDGNLNLVFRIQA---GEKRLILKQALPYAKVVGESWPLSLERAWIEQSALKEF
C4KZ49_EXISA          AECEEIGDGNLNLVFRIRQ---GETSLIVKQALPYAKVVGESWPLTLDRSWIEQLALREF
A0A2B8TP98_9BACI      CESIEIGDGNLNLVFRVKPL-GSEKGLIIKQALPYAKVVGESWPLTLKRATIESNATKIY
A0A087N2G1_9BACI      ITCEEIGDGNLNYVFRLVND-K-GDSIIIKQALPYAKVVGESWPLTLQRATIEAETLKKH
A0A078M781_9BACL      ITCEEIGDGNLNYVFRLVND-I-GDSIIIKQALPYAKVVGESWPLTLQRATIEAETLKKH
D3FZB4_ALKPO          LLCKEIGDGNLNYVFHLSDS-LSGQSLIIKQALPYAKVVGESWPLTLRRAKIEAEALQKA
W4QXV8_BACA3          LTAEEIGDGNLNLVFRILHI-ESGNSIIIKQALPYAKVVGDSWPLTLDRARIESESLQRT
A0A0V8JCC5_9BACI      IEVNEIGDGNLNLVFRLVEP-STQKSVIIKQALPYAKVVGESWPLTLDRARIESDSLKKF
A0A0C2V366_9BACL      VSCKEVGDGNLNYVFIIKDL-QTDKSLVVKQALPYAKVVGESWPLSLDRARIERQALQEA
MTNK_YERPB            VTADEIGDGNLNLVFKIRDT-AGISRVIVKQALPYVRCVGESWPLTLDRARIEAETLLTH
MTNK_YERP3            VTADEIGDGNLNLVFKIRDT-AGISRVIVKQALPYVRCVGESWPLTLDRARIEAETLLTH
MTNK_YERPY            VTADEIGDGNLNLVFKIRDT-AGISRVIVKQALPYVRCVGESWPLTLDRARIEAETLLTH
MTNK_YERE8            VTADEIGDGNLNLVFKIRDA-AGMSRVIVKQALPYVRCVGESWPLTLDRARIEAETLLTH
MTNK_SERP5            VSADEIGDGNLNLVFKIRDR-DGVSRVIVKQALPYVRCVGESWPLTLDRARIEAETLLIH
MTNK_PECAS            VTAEEIGDGNLNLVFKIKDE-AGISRVIVKQALPYVRCVGESWPLTLDRARIEAETLLTH
MTNK_ENT38            VEAQEIGDGNLNLVFKIFDA-QGVSRIIVKQALPYVRCVGESWPLTLDRARLEAQTLVEH
MTNK_CITK8            VEAQEVGDGNLNLVFKIFDT-TGVSRIVVKQALPYVRCVGESWPLTLDRARLEAQTLVAH
MTNK_KLEP7            VSAQEVGDGNLNLVFKVFDR-QGVSRAIVKQALPYVRCVGESWPLTLDRARLEAQTLVAH
MTNK_CROS8            VSAQEVGDGNLNLVFKIFDK-QGISRIVVKQALPYVRCVGESWPLTLDRARLEAQTLVAH
S3IRJ8_9ENTR          VDAQEVGDGNLNLVFKIFDT-QGVSRIIVKQALPYVRCVGESWPLTLDRARIEAQTLVEH
D4GKZ6_PANAM          SSAEEIGDGNLNLVFKIYDN-QGKSRVVVKQALPYVRCVGESWPLTLDRARIEAQTLVEH
H3R9J1_PANSE          RSAEEIGDGNLNQVFKIYDD-QGNSRIVVKQALPYVRCVGESWPLTLDRARIEAQTLVEH
MTNK_ERWT9            VDALEVGDGNLNLVFRIFDT-AGVSRVIVKQALPWVRCVGESWPLTLDRARLEAEVLIEH
D8MNJ9_ERWBE          VESQEIGDGNLNLVFKIFDS-EGVSRVIVKQALPYVRCVGESWPLTLDRARIEAEVLKVH
A0A1Y0LAF1_TATCI      VDALEVGDGNLNLVFKILDQ-QGVSRVIVKQALPYVRCVGESWPLTLDRARLEAETLIGH
A0A2A5JMV5_PSEO7      LTCYEFGDGNLNLVFRVQDT-QKNS-VIVKQALPYARCVGESWPLTLDRARIEANVLQRH
A0A3R8U321_9GAMM      LSCYEFGDGNLNLVFRVQDT-QRNS-IIVKQALPYARCVGESWPLTLDRARIEASVLRRH
A0A2N5LR45_9GAMM      LSAYEFGDGNLNLVFRITDE-QNNS-VILKQALPYARCVGESWPLTLDRARIEAQVLLNH
I1E0Q6_9GAMM          LSCEEFGDGNLNLVFRVSND-KGTS-LIVKQALPYARCVGESWPLTIDRARIEAQVLLKH
A0A3M8FJJ0_9GAMM      LRCEEIGDGNLNLVFRLIND-NDNKSLIIKQALPYARCVGESWPLSLDRARIEAESTQIQ
A0A364K0S0_9BACL      LVCKEIGDGNLNMVFRVIDQ-RSGQSIILKQALPYPRVVGDSWPLTLDRVRIEAEALEIQ
A0A2N5MFU1_9BACI      LICKEIGDGNLNLVFRIMEQGSAGKSIIMKQALPYARIVGDSWPLTLDRARIESEALLIQ
C0ZL37_BREBN          LTSREIGDGNLNLVFDIQEP-ATGKSVIVKQALPFARVVGESWPLTIDRARIESEALRIQ
H6NEP3_9BACL          LVSREIGDGNLNLVFHISEP-STGRSIILKQALPYAKVVGESWPLTLDRARIESEALMIQ
I3DTV0_BACMM          LKSREIGDGNLNLVFHISDP-ASGRALILKQALPYAKVIGESVPLTLDRVRIECEALRIQ
C6D8Q5_PAESJ          LNCREIGDGNLNLVFHITDP-ASGKSLIMKQALPYAKVVGESWPLSLDRARIESESLILQ
D3EDI4_GEOS4          LECREIGDGNLNLVFHVTAK-NTADSIIIKQAVPYAKVVGESWPLSLDRARIERLALETE
A0A3S9H3F6_9FIRM      LSCNEIGDGNLNLVFHITDQ-NSDMGVVIKQALDHVRIA-DDWPLTKERVKFEYTAMKIQ
A0A2G6KIB8_9BACT      LEGSEVGDGNLNLVFKIRDT-QGGKSVIIKQALPYLRCAGESWPLDLHRTILEANVFEIQ
MTNK_ECO45            WKVSEVGDGNLNMVFIVEGT---HKTIIVKQALPWLRAGGEGWPLSLSRAGFEYNVLCQE
                          *.****** ** :          ::***:   :   :. **   *  :*       

MTNK_GEOKA            ASYVPQ-YVPKVYYSDESLAITVMEDLSRLQIARKGLIEGKTYPLLSQHIGEFVAKTAFY
MTNK_GEOTN            ASYVPQ-YVPKVYYSDESLAITVMEDLSYLQIARKGLIEGKTYPLLSRHIGEFIAKTAFY
MTNK_BACAH            AKYVPE-YVPVVYSHDEELAVTVIEDLSRLTITRKGLIDGEEYPLLSQHIGRFLANVLFY
MTNK_BACCZ            AKYVPE-YVPVVYSHDEELAVTVIEDLSRLSITRTGLIDGEEYPLLSQHIGRFLAHVLFY
MTNK_BACHK            AKYVPE-YVPVVYSHDEELAVTVIEDLSRLTITRKGLIDGEEYPLLSQHIGRFLANVLFY
MTNK_BACC1            AKYVPD-YVPVVHSHDEELAVTVIEDLSRLTITRKGLIDGEEYPLLSQHIGRFLANVLFY
MTNK_BACCR            AQYVPD-YVPVVYSHDEELAITVIEDLSRLTITRKGLIDGEEYPLLSQHIGRFLAHVLFY
MTNK_BACMK            AKYVPD-YVPVVYSHDEELAVTVIEDLSRLTITRKGLIDGEGYPLLSQHIGRFLAHVLFY
MTNK_BACCN            AKYVPE-FVPKVYGHDKELAVIVMEDLSSLTIVRKGFIEGEEYPLLSEHVGRFLGKVLFY
A0A2C2UTJ6_BACCE      AKYVPE-YVPKVYGHDEELAVTVMEDLSAFTITRKGLVEGEEYPLLSQHIGRFLAHVLFY
D5DZB6_BACMQ          GAFTPE-LVPTVYYHDETLAVTVMEDLSHLTISRAGLIQGESYPLLSQHIGSFLGHIAFK
MTNK_BACVZ            GEHVPH-LVPAVYYSDTEMAVTVMEDLSHLRISRKGLLEGQHYPNLSAHIGEFLGKTLFY
A0A5C8IWL2_BACAM      GEHVPH-LVPAVYYSDTEMAVTVMEDLSHLKISRKGLLEGKHYPNLSAHIGEFLGKTLFY
MTNK_BACSU            GEHVPH-LVPRVFYSDTEMAVTVMEDLSHLKIARKGLIEGENYPHLSQHIGEFLGKTLFY
MTNK_BACLD            AEHVPH-LVPKVYYSDTELAVTVLEDLSHLEIARNGLIDGKDYPHLSEDIGEFLGKTHFY
MTNK_BACP2            SEYTPH-LVPAVYYSDTALAVTAMEDLSHLEIVRKGLIAGKQYPHLSDHVGEFLGKTLFY
A0A1N6YGA6_9BACI      GTFSPH-YTPKVYYSDKDLAITIMEDLSHLEIARTGLINGQDYPHIARHTGEFIARTLYG
A0A172ZBE9_9BACL      ARYAPE-YVPEVYYTDNDYAITVMEDLSHLTIVRTGLAEGAIYPLLSTHIGQYMARTLYG
W1SQU7_9BACI          GSIAPK-YVPEVYYTNDVLAVTVMEDLSHLLIARKGFIKGETYPLLSQHLGEYLSKTLFF
I3E801_BACMM          RELAPE-FVPEVYFSDETFAITVMEDLSHLSIARTGLIQGEEYPLISKHLGKYLAKTLFL
U5LA21_9BACI          KKLAPD-FVPEVFYNDEELAVTVMEDLSHLEISRTGLISGKEYPLLSGHLGNYLARTLFY
A0A2A4BIB2_9BACI      RSYCPE-FVPQVYYSDEQLAITVMEDLSHLKIVRTGLIDGDSYPLLSQHIGEYVAKTAFY
A0A1B3XQ14_9BACI      RSYCPE-FVPQVYYSDEQLAITVMEDLSHLKIVRSGFIDGDPFPLLSQHIGEYVAKTSFY
MTNK_EXIS2            AKVAVP-FVPHVYHASKEEAFTVMEDLSHLTIVRGGLLEGEKYPLLAEHIGSYLARTLFY
C4KZ49_EXISA          SKVVPQ-FVPDVLGSDRELAYTILEDLSAFEIVRTGFLKGESYPNLARHVGTFLGETLFA
A0A2B8TP98_9BACI      NELIPL-HAPKILAHDEEQAVTVMEDLSHLQILRKGLIEKKSYPFLAEHIGEFLAKSLFY
A0A087N2G1_9BACI      GEFVPA-YVPRVLHTDAVLAITVMEDLSHLTVARDGLIAGQHYAHLAKHIGEYLAKTLFF
A0A078M781_9BACL      GEFVPA-YVPRVLHTDAVLAITVMEDLSHLTIARDGLIAGHHYAHLAQHIGEYLAATLFF
D3FZB4_ALKPO          AETVPS-LVPNVIHTDDDLAITIMEDLSDYTILRKGLIDGETYPNLGRHIGIYLAKTIFH
W4QXV8_BACA3          YQLVPK-LTPKVYYNDPKLAVTIMDDLSHLIILRKGLIAGHQYPKLAKDIGTFLAHTLFF
A0A0V8JCC5_9BACI      AEFASE-HVPQVLYTNNDLAVTVMEDLSSHVILRKGLIDGVTYPNLAQHIGTFIAKNLFY
A0A0C2V366_9BACL      AKHVPS-LVPQVFDHDDDYAVTVMEDLSDHVILRKGLIDGNIYKDIAADIGTYLAENLFY
MTNK_YERPB            SQFCPQ-HTVKVLHHDAELAVMVQEDLSDHHIWRHELIQGNYYPQAAEQLGEYLAQTLFH
MTNK_YERP3            SQFCPQ-HTVKVLHHDAELAVMVQEDLSDHHIWRHELIQGNYYPQAAEQLGEYLAQTLFH
MTNK_YERPY            SQFCPQ-HTVKVLHHDAELAVMVQEDLSDHHIWRHELIQGNYYPQAAEQLGEYLAQTLFH
MTNK_YERE8            GQFCPQ-HTVNVLHHDAELAVMVQEDLSDHEIWRSELVKGKYYPQAAGQLAEYLAQTLFH
MTNK_SERP5            GGFCPR-HTVKVLHHDAELAVMVQEDLSDHHIWRSELVKGHYYPLAAGQLAEYLAQTLFH
MTNK_PECAS            ARFCPQ-HTVTVLYHDPELAVMVQEDLSDHRIWRSELVRGADYPQAAAQLGEYLAQTLFH
MTNK_ENT38            YQHSPQ-HTVKIHHYDPELAVMVMEDLSSHKIWRGELISGVYYPQASRQLGEYLAHTLFH
MTNK_CITK8            YQHCPQ-HTVKIHHFDPELAVMVMEDLSDHNIWRGELIKGAWYPQAARQLGEYLAQTLFH
MTNK_KLEP7            YQHSPQ-HTVKIHHFDPELAVMVMEDLSDHRIWRGELIANVYYPQAARQLGDYLAQVLFH
MTNK_CROS8            YQHCPA-HTVKIHHYDPTLAVMVMEDLSDHRIWRGELIKGVHYPQAARQLGEYLAQTLFH
S3IRJ8_9ENTR          YRHSPE-HTVNVVHYDAELAVMVMEDLSSHRIWRGELVKGAYYPQAASQLGDYLAKTLFH
D4GKZ6_PANAM          YKYCPQ-HTVKVTHYDADLAVMVMEDLSSHRIWRSELVKGAYYPEAPRQLGEYLAQTLFH
H3R9J1_PANSE          YKYCPQ-HTVNVTHYDADLAVMIMEDLSSHRIWRSELVKGAYYPEAPRQLGEYLAQTLFH
MTNK_ERWT9            GKFCPQ-HTVNILHYDPLLAVTVMEDLSDHAIWRADLVKGIDWPQAAGQLGDYLAQTLFH
D8MNJ9_ERWBE          GTFCPA-HTVKILHYDPVLAVMVMEDLSSHAIWRGEQVKGVDYPQAASQLGEYLAQTLFH
A0A1Y0LAF1_TATCI      YRFCPE-HTVNVTHYDPELAVMMMEDLSDYKIWRGELVRGRYYPRAAAQLGHYLASVLFS
A0A2A5JMV5_PSEO7      GKICPD-TTAKVLHHNTELAVTVLEDLGHLRILRSELNQANTFSKLAEDVADYLAKTSFY
A0A3R8U321_9GAMM      GEICPT-TTAKVLHHNSELAVTILEDLGQLHILRGELNQAHTFPQLSQDIATYLAKTSFY
A0A2N5LR45_9GAMM      GAICPT-YTARVLHYSEMQALTILEDLGNLQILRTAQNNAEQFPKLAQHVATYLSHTGFY
I1E0Q6_9GAMM          RKLCPE-HTVEVLHYDAEQAAILMEDLKHYRILRTELISGKQFAHLAPQMASYLANTLFY
A0A3M8FJJ0_9GAMM      ANICPG-YVPKIYHTDNTLALTIMEDLSDHVVLRNGLISGQSYPELPQQIGSFLAHTLFY
A0A364K0S0_9BACL      AHYAPG-LVPKLYHYDEKFALVVMEDLSDHIILRKSLITGKIYPQIANDLAEYLANTLFF
A0A2N5MFU1_9BACI      NSICPG-LVPKVYHYDNEMALTIMEDLSTHIIMRKGLTARNRYPYFARQIGTFLARTLFF
C0ZL37_BREBN          HKYVPD-LVPQVYHFDGELALTVMENVGDHIIMRKGLIEGKRYPLFAKQIGRFLAQTLFF
H6NEP3_9BACL          ESLCPD-LVPHVHVYEPDLALTVMQDLSDHVIMRRGLIEGNRYPLFAGHIGRFLAHTLFY
I3DTV0_BACMM          GELCPD-LTPKVYAYEPDLALMVMEDLSDHIVMRRGLMERGRYPLFAGHIGSFLARTLFF
C6D8Q5_PAESJ          NKLAPG-LVPVVYRYDAELALTIMEDLSDHLIMRQGLVKGIRYPKFAEDISTFMANTLFF
D3EDI4_GEOS4          YSLCPD-LVPKVYGYSDELAYTVMEDLSEYTIMRKGLIEGIAYPKFAEHIGRFLARTLFY
A0A3S9H3F6_9FIRM      DELTDG-MVPKVYKYDDEMALIVMEDLSSMKVMRKGLISGIKYPHFAEQISTFLSKTLFY
A0A2G6KIB8_9BACT      NKLAPG-LVPKLYHKDEELSLLIMEDLSHLGVMRPGTLEMRKYPRFADHISTFMANTLFY
MTNK_ECO45            AKYAGHTLIPQVYFYDPEMALFAMEYLTPHVILRKELINGKKFPKLAEDIGRFLAQTLFN
                                 :   .   :    : :    : *        :     . . ::.   : 

MTNK_GEOKA            TSDFGMNQQEKKKLAQSFV-NPELCKITEDLVFTDPFFDHETNNFEDELRPDVEA-LWRD
MTNK_GEOTN            TSDFGMNQQEKKKLAQSFV-NPELCKITEDLVFTDPFFDHDSNNFEDELHLDVET-LWND
MTNK_BACAH            TSDFGLQSEEKRVLEGTFV-NPDLCKITEDLVFTDPFGHYDTNDYEPELQLTIDE-LWSD
MTNK_BACCZ            TSDLGLESEEKRVLEGTFV-NPDLCKITEDLVFTDPFGHYDTNDYEPELQLTIDE-LWSD
MTNK_BACHK            TSDFGLQSEEKRVLEGTFV-NPDLCKITEDLVFTDPFGHYDTNDYESELQLAVDE-LWSD
MTNK_BACC1            TSDFGLQSEEKRGLEGTFV-NPDLCKITEDLVFTDPFGHYDTNDYEPELQLAVDE-LWSD
MTNK_BACCR            TSDFGLQSEEKRILEGTFV-NPDLCKITEDLVFTDPFGHYDTNDYEPDLQLVVDE-LWSD
MTNK_BACMK            TSDFGLQSEEKRVLEGTFV-NPDLSKITEDLVFTDPFGHYDTNDYESDLQSVIDE-LWSD
MTNK_BACCN            TSDFGLNTEEKRVLDGKFI-NPDLCKITEDLVFTDPFGNYETNDYERELQSVIEE-LWCD
A0A2C2UTJ6_BACCE      TSDFGLLAEEKRVLDGKFV-NPDLCKITEDLVFTDPFGNYETNDYEKELQPVLDE-LWCD
D5DZB6_BACMQ          TSDFALKPQDKKEEVVKYS-NPDLCNITEDLVFTDPFFDIDTNEFEKALRPDVEE-LWND
MTNK_BACVZ            SSDYALDAKVKQQLAKQFT-NPELCNITERLVFTEPFLDHETNDFEEELRPYAEK-VWNN
A0A5C8IWL2_BACAM      SSAYALDAKVKQQLAKQFT-NPELCNITERLVFTEPFLDHETNDFEEELRPYAEK-IWNN
MTNK_BACSU            SSDYALEPKVKKQLVKQFT-NPELCDITERLVFTDPFFDHDTNDFEEELRPFVEK-LWNN
MTNK_BACLD            SSEYALDPTVKERLVKQFT-NPDLCDITESLVFTDPFFDHETNDFEEELRDEAEV-LWGN
MTNK_BACP2            TSDFATNPKIKKQFVKQFT-NPDLCDITEKLVFTDPFFDSSTNDFEEELREAAEA-LWAD
A0A1N6YGA6_9BACI      TSDFALGPQEKKKLQHTFS-NPELCDITEGLVFTDPFFDAETNDFEEALRPEVES-LWGD
A0A172ZBE9_9BACL      TSDYALGAEARRELALQFH-NPELCKITENFVFTYPLIDHESNVVEEGLRPLAEQ-IWRD
W1SQU7_9BACI          TSDYGLGPSIKKEQVQKFI-NPELCKITEDLIFNDPFFDAETNEFEAGLRTTVEA-LWKD
I3E801_BACMM          TSDFGLEPSDKKELVQKFI-NPELCKITEDLVFTDPFFDSETNSFEEELIDEVKK-LWSD
U5LA21_9BACI          TSDYGLLQADKKKLAKDFY-NPELCKITEDLIFADPYFNSPTNDFEEELKGDAEA-LWAD
A0A2A4BIB2_9BACI      TSDYHLEPSSKKEVARHFT-NPELCKITEVFIFTDPFFEELPGDFEVELKDAAQK-IWND
A0A1B3XQ14_9BACI      TSDYHLEPSAKKEVARHFT-NPELCKITEVFIFTDPFFEELPGDFEVELTDAAKT-IWDD
MTNK_EXIS2            TSDFAVGPVAKKQIARQYY-NPDLCDITEKLIFTDPFYDAETNAIEAGLEAEVDR-IWND
C4KZ49_EXISA          TSDYANGPLVKKQIEKEYY-NPELCDITEKLIFTDPYRDADSNQIEAALRPDVEQ-LWSD
A0A2B8TP98_9BACI      TSDFGASPAKKKELEYLFN-NPELCDITENLVFTDPFFNSETNSFEEELTDEIQV-LWND
A0A087N2G1_9BACI      TSDFALHPFEKKRLQVAFS-NPELCKITEDLIFTDPYYDAPTNDFEEGLRSSVEA-LWQD
A0A078M781_9BACL      TSDFALHPFEKKRLQVAFS-NPELCKITEDLIFTDPYYDAPTNDFEENLRSTVEA-LWQD
D3FZB4_ALKPO          SSPFGESQQEIKEISVRFT-NPELCKITEDLVFTDPFFDHDTNDFEDHLKDTVNE-LWKN
W4QXV8_BACA3          NSDYGMNQQEKKIQSSRFI-NPELCKITEDLVFTDPFFDHDTNNIEAELKSFVEHVIWAD
A0A0V8JCC5_9BACI      TSDFYLHPFEKKRLVQQFT-NPELCKITEDLVFTDPFYDIETNDYPAELQDAVSE-LWND
A0A0C2V366_9BACL      SSDEALGPVEKKKLARQFV-NPDLCDITEKLVFTDPYYNAESNAYPENLQESVES-LWHD
MTNK_YERPB            TSDFYQSAQAKKAAVSRYT-NPELCQITEDLFFTDPYIDHERNNFDPVLLPEVLS-LRQD
MTNK_YERP3            TSDFYQSAQAKKAAVSRYT-NPELCQITEDLFFTDPYIDHERNNFDPVLLPEVLS-LRQD
MTNK_YERPY            TSDFYQSAQAKKAAVSRYT-NPELCQITEDLFFTDPYIEHERNNFDPVLLPEVLS-LRQD
MTNK_YERE8            TSDFYQSAQAKKAAVSRYT-NPELCQITEDLFFTDPYIDHERNNFDPALLPEVLA-LRQD
MTNK_SERP5            TSDFYQTAQEKKAEVSRFS-NPELCQITEDLFFTDPYIDHERNQFDPALLPQVLE-LRND
MTNK_PECAS            TSDFYQHPHEKKAAVSQFT-NPELCEITEDLFFTDPYIDHERNQFDAALTPDVQT-LRDD
MTNK_ENT38            TSDFYLHPHAKKAQVAKYI-NPEMCEITEDLFFNDPYQIHERNNYPAELEADVAA-LRSD
MTNK_CITK8            TSDFYLHPHDKKAQVATFI-NPEMCEITEDLFFNDPYQIHERNSYPAEIEGDVAA-LRSD
MTNK_KLEP7            TSDFYLHPHEKKAQVAQFI-NPAMCEITEDLFFNDPYQIHERNNYPAELEADVAA-LRDD
MTNK_CROS8            TSDFYLHPHAKKAEVARFI-NPEMCEITEDLFFNDPYQVHERNNYPAELEADVAA-LRDD
S3IRJ8_9ENTR          TSDFYLHPHAKKALVGRFI-NPEMCEITEDLFFNDPYQVHERNNYPADLEPQVAA-LRND
D4GKZ6_PANAM          TSDFILHPHHKKAEVARFI-NPELCEITEDLFFNDPYTDHERNSYPDALEPLVAS-LRTD
H3R9J1_PANSE          TSDFILHPHVKKAEVARFI-NPELCEITEDLFFNDPYTDHVRNSYPEALEPLVAS-LRTD
MTNK_ERWT9            TSDFFQHPHQKKADVIRFT-NPELCDITEELFFNEPYEVHARNAYPRALEPLAES-LRED
D8MNJ9_ERWBE          TSDFHQHPHQKKADVIRFT-NPELCQMTEDLFFDEPYEIHERNAYAPALEPLVAS-LRTD
A0A1Y0LAF1_TATCI      GSDFALHAHEKKARVAQFI-NPEMCEITEDLFFNDPYTEHPRNDYPQALEPLVAS-LRDD
A0A2A5JMV5_PSEO7      HSSFYLTPSEKKALVIEFT-NPELCAITEDLFFDDPYRNAERNNFSAALQETVEA-LRSN
A0A3R8U321_9GAMM      FSSFYLEPSEKKALVTEFT-NPELCAITEDLFFDDPYRDTERNHFPSALQTSVNA-LRHN
A0A2N5LR45_9GAMM      NSDFYLTAQTKKALVSQFT-NPELCQITEDLFFSDPYIEHERNNYPKQLQSEVDA-IHKN
I1E0Q6_9GAMM          TSDFALTGPNKKQQVGKFL-NPELCLITEDLFFTDPYCNHERNNIHAEIRQQAQQ-LWHD
A0A3M8FJJ0_9GAMM      TSNLYLDSHLKKQYLRQFI-NPDLCKITEDLVLTDPFFGSERNHYDQDIQAQVTE-LQNN
A0A364K0S0_9BACL      TSDYYLKSEQKKIKQAQFI-NPEMCKMTEKLVFTDPYFNAETNSFNPLIQRHIEK-IWKS
A0A2N5MFU1_9BACI      SSDLMLDSHHKKQKVRQFI-NPELCKITEELVFTDPFYDAETNQFNPLIKDDIKD-IWGN
C0ZL37_BREBN          TSDLGAHPYDKKTLVGTFI-NPELCKITEDLVFTDPYENAPTNDFNPLIRREVEA-IWNN
H6NEP3_9BACL          TSDLGLNQQEKKERVKRFI-NPELCKITEDLIFDDPYTDSPNNNVPPAIRDAVGA-VWGD
I3DTV0_BACMM          TSDLAMDQQEKKLRVKSFI-NPELCNITEDLILYAPYTKSRMNIFEPHIRDAVER-IWAD
C6D8Q5_PAESJ          TSDLGMNQQDKKQRVKEFI-NPDLCKITEDLIFDDPYTVSSNNNIEPAIEDAAAA-LRED
D3EDI4_GEOS4          TSDLGMNQQKKKELAGRFV-NPDLCKITEDLIFEDPYRESANNNYEQSIADEAEA-LRAD
A0A3S9H3F6_9FIRM      TSDLYMAPKDKKERVKNFI-NPELCDITEVLVFTDPYFDAESNNINPELRPYLEKEFWRK
A0A2G6KIB8_9BACT      TSDLYMDPYEKKAMVKKFM-NPELCKITEDLICSDPYYDSEQNNINPPLRPYLEQVFWKK
MTNK_ECO45            TSDIGMSAEQKKALTAEFALNHELCKITEDLIFTEPYYNAERNNWTSPELDDAVHKAWAD
                       *         .     :  *  :. :** :.   *      .                .

MTNK_GEOKA            DRLHLEAAKLKRKFLTEADVLLHGDLHTGSIFVSAD-ETKVIDPEFAFYGPIGFDLGQFF
MTNK_GEOTN            DRLHLEAAKLKRKFLTEADVLLHGDLHTGSIFASDD-ETKVIDPEFAFYGPIGFDLGHFI
MTNK_BACAH            KTLKLKVAQYKYKFLTRKEALIHGDLHTGSIFSSPS-ETKVIDPEFATYGPFGFDIGQFI
MTNK_BACCZ            KTLKLKVAQYKYKFLTRKEALIHGDLHTGSIFSSPS-ETKVIDPEFATYGPFGFDIGQFI
MTNK_BACHK            KILKLKVAQYKYKFLTRKEALIHGDLHTGSIFSSPS-ETKVIDPEFATYGPFGFDIGQFI
MTNK_BACC1            KTLKLKVAQYKYKFLTRKEALIHGDLHTGSIFSSPS-ETKVIDPEFATYGPFGFDLGQFI
MTNK_BACCR            KTLKLKVAQYKYKFLTRKETLIHGDLHTGSIFSSPS-ETKVIDPEFATYGPFGFDIGQFI
MTNK_BACMK            KTLKLKVAQYKYKFLTRKEALIHGDLHTGSIFSSPS-ETKVIDPEFATYGPFGFDIGQFI
MTNK_BACCN            KNLKLQVAQYKYKFLTRKEALIHGDLHTGSIFASSK-ETKIIDPEFATFGPLGFDLGQFI
A0A2C2UTJ6_BACCE      KKLKLQVAQYKYKFLTRKEALIHGDLHTGSIFSSSS-ETKVIDPEFATFGPLGFDLGQFI
D5DZB6_BACMQ          GDVKLQAAKLKYKFLTNAQTLIHGDLHTGSIFASSQ-ETKVIDPEFAFYGPFGFDLGQFV
MTNK_BACVZ            SRLKEGADELKAIFLNSAETLVHGDLHTGSIFADEH-ETKVIDPEFAFFGPIGFDIGQFI
A0A5C8IWL2_BACAM      SRLKEGADELKAIFLNSAETLIHGDLHTGSIFADEH-ETKVIDPEFAFFGPIGFDIGQFI
MTNK_BACSU            DSVKIEAAKLKKSFLTSAETLIHGDLHTGSIFASEH-ETKVIDPEFAFYGPIGFDVGQFI
MTNK_BACLD            EALKIEAAKLKQRFLSAEETLIHGDLHTGSIFAGEDGETKIIDPEFAFFGPIGFDIGQFI
MTNK_BACP2            LEVQAKAAELKRIFLTSAETLVHGDLHTGSIFASET-ETKIIDPEFAFYGPFGFDIGHFI
A0A1N6YGA6_9BACI      NELKLHAAQLKRLFLTSGDALLHGDLHTGSIFASET-ETKIIDPEFAFYGPFGFDIAHFT
A0A172ZBE9_9BACL      AQLLREGARLKRHFMISAEALLHGDLHTGSIFASET-ETRVIDPEFAFYGPMGYDIGLFI
W1SQU7_9BACI          DELKFHVNVLKKSFLTEAEVLLHGDLHTGSIFANDS-ETKVIDPEFAFYGPAGFDIGQVF
I3E801_BACMM          EKVKLETALLKQSFLTEAESLLHGDLHTGSIFASKT-ETKVIDPEFAFYGPAGFDLGQVI
U5LA21_9BACI          SVLKLEAARLRKIFLNEAEALLHGDLHTGSIFASDA-ETKVIDPEFAFYGPAGFDIGQVI
A0A2A4BIB2_9BACI      QEVILEVAKLKQSFETEQEALLHGDLHTGSIFASET-ETKVIDPEFAFYGPVGFDLGQYT
A0A1B3XQ14_9BACI      QEVILEVAKLKQSFETEQEALLHGDLHTGSIFASET-ETKVIDPEFAFYGPVGFDLGQYT
MTNK_EXIS2            AELKREVAKLEALFITKGDALLHGDLHTGSIFASAE-ETKVIDPEFAFYGPFGFDVGQFI
C4KZ49_EXISA          LALKIEVTKLKVGFVTKHEALLHGDLHTGSIFATRQ-ETKIIDPEFAFYGPFGFDIGQII
A0A2B8TP98_9BACI      ADLQLEVAKLKLDFLSKKEALLHGDLHTGSIFASAT-ETKVIDPEFAFVGPIGFDLGQIQ
A0A087N2G1_9BACI      NDLQREVAKLKRHFLTQAEALVHGDLHTGSIFVDAQ-TTKVIDPEFAFYGPIGFDVGQVI
A0A078M781_9BACL      NDLQREVAKLKRHFLTQAEALVHGDLHTGSIFVDAQ-TTKVIDPEFAFYGPIGFDVGQII
D3FZB4_ALKPO          EELKLEAAKLKYTFLTKSEALIHGDLHTGSVFVTAE-ETKVIDPEFAFYGPAGFDLGLFI
W4QXV8_BACA3          QPLKLEVAKLKKLFLTKAETLVHGDLHTGSIFVSQE-ETFVIDPEFAYYGPIGFDIGAFL
A0A0V8JCC5_9BACI      SALRNKAARLKLKFLTHAEALLHGDLHSGSIFVTEE-STKVIDSEFAYYGPQGFDIAHFF
A0A0C2V366_9BACL      DRLIFEVAKLKKQFLTEGEALLHGDLHTGSVFVTEK-STKVIDPEFAFYGPAGFDIGAFI
MTNK_YERPB            KALKLAVASLKHRFLSQAEALLHGDIHSGSIFVADG-RLKTIDAEFGFYGPIGFDIGTAL
MTNK_YERP3            KALKLAVASLKHRFLSQAEALLHGDIHSGSIFVADG-RLKTIDAEFGFYGPIGFDIGTAL
MTNK_YERPY            KALKLAVASLKHRFLSQAEALLHGDIHSGSIFVADG-RLKTIDAEFGFYGPIGFDIGTAL
MTNK_YERE8            DALKLAVASLKHRFLSKAEALLHGDIHSGSIFVADG-RLKAIDAEFGFYGPIGFDVGTAL
MTNK_SERP5            AALRLAVAGLKHRFLSKAEALLHGDIHSGSVFVAEG-KLKAIDAEFGFYGPIGFDVGTAL
MTNK_PECAS            RALKLAVAGLKHRFLSKAEALLHGDIHSGSIFVAEG-RLKVIDAEFGFYGPMGFDIGTAI
MTNK_ENT38            DQLKIAVASLKHRFFSQAEALLHGDIHSGSIFVAED-SLKAIDAEFGYYGPIGFDIGTAI
MTNK_CITK8            AQLKLAVAALKHRFFSHAEALLHGDIHSGSIFVADG-RLKAIDAEFGYFGPIGFDVGTAI
MTNK_KLEP7            AQLKLAVAALKHRFFAHAEALLHGDIHSGSIFVAEG-SLKAIDAEFGYFGPIGFDIGTAI
MTNK_CROS8            AALKCAVAALKHRFFSHAEALLHGDIHSGSIFVADG-SLKAIDAEFGYFGPVGFDVGTAI
S3IRJ8_9ENTR          RDLRLAVAQLKHKFFSSAEALLHGDIHSGSIFVAEG-SLKAIDAEFGYVGPIGFDIGTAV
D4GKZ6_PANAM          DALRIAVAGLKHVFFSHAEALLHGDIHSGSIFVADG-SLKAIDAEFGYFGPIGFDVGTAL
H3R9J1_PANSE          EALRIAVAGLKHRFFSHAEALLHGDIHSGSIFVADG-SLKAIDAEFGYFGPMGFDVGTAL
MTNK_ERWT9            HELRVAVAGLKHRFYSNAEALLHGDVHSGSIFVAEG-SLKVIDAEFGFYGPIGFDIGSAL
D8MNJ9_ERWBE          DELRLKVAALKHRFLSNAEALLHGDVHSGSIFVAEG-SLKVIDAEFGYYGPIGFDVGSAL
A0A1Y0LAF1_TATCI      GELRLRIAELKFAFLTHAETLLHGDIHSGSIFVTET-GLKAIDAEFGYYGPMGFDIGTAI
A0A2A5JMV5_PSEO7      KNLLVAVAKLKAQFLNAPETLLHGDVHTGSIFVDAT-QTKLIDPEFGFFGPIGFDLGSFI
A0A3R8U321_9GAMM      KALLIEIAKLKAQFLNAPETLLHGDVHTGSIFVSAE-QTKLIDPEFGFFGPIGFDLGSFI
A0A2N5LR45_9GAMM      SALKLEIAKLKANFLSNPQTLLHGDMHSGSIFVDCN-NTKMIDPEFGFFGPIGFDIGSFI
I1E0Q6_9GAMM          EALQAEVAQLKADFLSKPQALLHGDVHSGSIFINEE-NCKVIDAEFGFYGPIGFDVGSLI
A0A3M8FJJ0_9GAMM      QQLQLNVAALKLKFLSSTEALLHGDVHTGSIFVTKN-SMKVFDSEFAYYGPMGFDIGLII
A0A364K0S0_9BACL      HLLKKEIAQLKLAFMTKAQALIHGDLHSGSIMVKEN-STKVIDPEFAFFGPMGFDMGALF
A0A2N5MFU1_9BACI      DELKLEISKLKEKFLTHAQALIHGDLHTGSIMVTET-DTKVIDPEFSFYGPMGFDIGALI
C0ZL37_BREBN          RPLKLEIAKLKYDFLTRSEALLHGDLHTGSIFITEN-SLKAIDPEFAYYGPIGFDIGAII
H6NEP3_9BACL          GELHLEVAILRQKFLTSAQALLHGDLHTGSIFITQE-STKVIDPEFAYYGPMGFDIGAVF
I3DTV0_BACMM          KELHLEVTLLREKFLTKAQALLHGDLHTDNIFIKPD-STKVIDPEFAYYGPMGFDIGTVI
C6D8Q5_PAESJ          KALHLEVALLREKFLTSAQALLHGDLHTGSVFATPE-STKVIDPEFAYYGPIGFDIGAVI
D3EDI4_GEOS4          LPLHFEVALLRHKFLTHAQALLHGDLHTGSIFVTPE-STKVIDPEFAYFGPMGFDIGAVI
A0A3S9H3F6_9FIRM      IELRKEVTVLKEKFMTRAQALIHGDLHTGSIFIDQK-TLKVFDTEFAFYGPSGFDIGAVI
A0A2G6KIB8_9BACT      KALRLEATKYKYAFLTEAQSLVHGDLHTGSIFASEE-ETKVFDPEFAYYGPAAFDSGLLT
MTNK_ECO45            VEMIQVAMRYKYKFMTEAQALLHGDLHSGSIMVTDT-DTKVIDPEFGFMGPMAFDIGNYI
                        :       .  *    : *:***:*:..::         :*.**.  ** .:* .   

MTNK_GEOKA            ANLLLNALSRS----------ELERQPLFDHIDRTWDVFASVFSNLWRTESVETYA----
MTNK_GEOTN            ANLLLNALSRP----------ESERRPLFDHIDRTWAVFTSVFSELWRTESVETYA----
MTNK_BACAH            ANLLLNALSRE----------EEQRGVLFFHIEKTWSYFVETFTKLWIGEGVEAYT----
MTNK_BACCZ            ANLLLNALSRE----------EEQRGVLFFHIEKTWSYFVETFTKLWIGEGVEAYT----
MTNK_BACHK            ANLLLNALSRE----------EEQRGVLFFHIEKTWSYFVETFTKLWIGEGVEAYT----
MTNK_BACC1            ANLLLNALSRE----------EEQRSVLFFHIEKTWSYFVDTFTKLWIGEGVEAYT----
MTNK_BACCR            ANLLLNALSRE----------EEKRSVLFFHIEKTWSYFVETFTKLWIGEGVEAYT----
MTNK_BACMK            ANLLLNALSRE----------EEKRSVLFFHIEKTWSYFVENFTKLWIGEGVEAYT----
MTNK_BACCN            ANLLLNALSRE-----------EKREVVFFHIEKTWSYFVDTFTKLWILEGVETYT----
A0A2C2UTJ6_BACCE      ANLLLNALARE----------DEKRDILFYHIEKTWSDFVEVFTKLWLLEGIEPYT----
D5DZB6_BACMQ          ANLFLNALSRE-----------TNREPLFAHITNTWNVFKDTFTALWHSENTEPFA----
MTNK_BACVZ            ANLLLNALSRD----------GDDRQPLYDHTAAVWDTFVKTFSEAWEKDCLPSRR----
A0A5C8IWL2_BACAM      ANLLLNALSRD----------GDDRQPLYDHTAAVWDTFVKTFSEAWEKDSLPSCR----
MTNK_BACSU            ANLFLNALSRD----------GADREPLYEHVNQVWETFEETFSEAWQKDSLDVYA----
MTNK_BACLD            ANLLLNALSRE----------ENRRAPLYRHVETVWNTFSRTFSEAWENDAVETCK----
MTNK_BACP2            ANLFLNALSREN---------EHDQQHLFDHVVNVWATFKEVFAKAWKEDSIEAFS----
A0A1N6YGA6_9BACI      ANLLMNALSRA----------ENRREPLYEHVTTVWNVFTQEFTRLWQENNTEAFA----
A0A172ZBE9_9BACL      ANTLLSAFARS----------EHSREELLAHVTNVWDVFAAEFTALWQENNQEPLA----
W1SQU7_9BACI          ANLLFQVIVNE----------QN-HVLFINHLETVWNVFEEQYKHLWNTENKENLA----
I3E801_BACMM          ANLLFQAIANE----------GK-QEGIFSHIRTFWKTFTDEYSSLWTNSNKEPFS----
U5LA21_9BACI          ANLLFQSIANP----------EK-TRLIDHHIETFWGTFSDDFSLLWQKDNKDPFA----
A0A2A4BIB2_9BACI      ANLLFQAVTRN----------GAGKEEIFTLLHEFWNAFEETYTKLWEVQNKSPFR----
A0A1B3XQ14_9BACI      ANLLFQAVTRN----------VAGKEEIFTHLDQFWRSFEKTYTELWNTQNKSPFR----
MTNK_EXIS2            AHLFFAAYPDYD---------RLRDE-RIKDIDTFWLTFASTFKALWEREAVEPFR----
C4KZ49_EXISA          AHLVFSTYA-HP---------LKRFE-RFTEVLTVWETFEKTFRTRFT-QAAEPFN----
A0A2B8TP98_9BACI      ANLLFQLFS-RT---------ELKDE-IFDHILTIEKVFNETFTQLWEEHSVRPFN----
A0A087N2G1_9BACI      ANFTFQWLTRQ----------GEDRQKIATDIATVWQVFDTTYRQLFTKHYEEHYA----
A0A078M781_9BACL      ANFTFQWLTRQ----------GEDRQKTAADIATVWHVFETTYRQLFTEHYEEHYA----
D3FZB4_ALKPO          ANILLNTISKTAID-------EQQHSDLYQTITETVEVFKEEYKKLCQNHHVEAFI----
W4QXV8_BACA3          ANIILNYLSQDAHLSDQPQKKAEFRQYLLDVLTTTWTVFEQEFTSLWISYPQDAFM----
A0A0V8JCC5_9BACI      ANIAMNHIAQRAHIKDG-EKRAEYQLYLSGLIRDTWITFTDTYKELWRNEGVELAT----
A0A0C2V366_9BACL      ANLTLNYIAQQERADDS--RRDEISDYLLETIEQTWAVFEQHYRALLLEKGFDERQ----
MTNK_YERPB            GNLLLNYCGLPGLAGP--RDAAAGREQRLKDVQTVWQTFAARFLALSQEKTQDPAL----
MTNK_YERP3            GNLLLNYCGLPGLAGP--RDAAAGREQRLKDVQTVWQTFAARFLALSQEKAQDPAL----
MTNK_YERPY            GNLLLNYCGLPGLAGP--RDAAAGREQRLNDVQTVWQTFAARFLALSQEKAQDPAL----
MTNK_YERE8            GNLLLNYCGLPGLAGP--RDAAAGREQRLKDIHILWETFSHRFLALCEEKTQDSTL----
MTNK_SERP5            GNLLLNYCGLPGLFGP--RDAAAGREQRLQDVRELWLIFADRFLALCHQQTREAAL----
MTNK_PECAS            GNLLLNYCGLPGLLAP--REAAAGRERRLEDIRTLWQTFSARFLALSESDCREPAL----
MTNK_ENT38            GNLLLNFCGLPGHLGI--RDAAAAREQRLTDIQELWNTFSERFQALATEKTRDAAL----
MTNK_CITK8            GNLLLNFCGLPGHLGI--RDAAAAREQRLTDIQELWNTFAERFQVLATEKTRDAAL----
MTNK_KLEP7            GNLLLNYCGLPGQLGI--RDAAAAREQRLNDIHQLWTTFAERFQALAAEKTRDAAL----
MTNK_CROS8            GNLLLNYCGAPGQLGI--REAADAREQRLIDIATLWHTFAERFQTLAREKTRDAAL----
S3IRJ8_9ENTR          GNLLLNYCALPGHYGP--RDAASHREQRLKDIQELWLTFTERFTVLARSETRDAAL----
D4GKZ6_PANAM          GNLLINYCGLPGLLPP--REAVDAREQRLSDVRDVWNTFATRFLALAESHTQDVAM----
H3R9J1_PANSE          GNLLINYCGLPGLLPP--REAADAREQRLSDVHDVWQTFETRFLALAESKTQDVAM----
MTNK_ERWT9            GNLLISYCAAPGLLPP--REAADAREKRLNDVRQLWQSFAEGFLALAAEKSRDRAL----
D8MNJ9_ERWBE          GNLLLNYCALPGLLAP--REAADVREKRLRDVSAAWKSFAEGFLALAAEKTTDRAL----
A0A1Y0LAF1_TATCI      GNLLLNYCGLPGLLAP--REAADAREQRLADIVTLWQTFSAEFLSRSQ-QTRDIAL----
A0A2A5JMV5_PSEO7      GNLLLNYCAQHARIATP-PKRRNMQVYLLDCIATTLSRFYATWLELAKSETQDLSL----
A0A3R8U321_9GAMM      GNLLLNYCAQHARIEAL-PKRRNMQVYLLDCIASTLSGFYATWLKLAKTQTRDLSL----
A0A2N5LR45_9GAMM      GNLLLNYCAQYGHIEDF-VARRNYQNHLLSTLVECYTLFEQHWLTLINEHTTEGAL----
I1E0Q6_9GAMM          GNLLLNYLGHFGLTQDT-DARQQHQDYLVSQVQSLWQEFSAQFTQLMRSECHEPAL----
A0A3M8FJJ0_9GAMM      GNMVLSLCSHFIQNNL------NSVNYCLNAIEIIWQTFESKFTTLAKEHTQDLAF----
A0A364K0S0_9BACL      ANILLSYISQEAHIANS-HARKEYQSWLLWLIEEIWHRFTEKFRMHWAMYVKDEIF----
A0A2N5MFU1_9BACI      ANLLLSYCSHEGHTLDK-TERLHYQDYLLMTIENIWTIFEEEFKALWQENAKGLYV----
C0ZL37_BREBN          ANLLLNYAGQHGLQKDQ-GEREAYREYLLETVEDVWNEFVSQFVQLWHKHAKERSA----
H6NEP3_9BACL          ANLLLNFAAQEGWSADE-ASRRDFRAYLTGTIRDTWNNFEREFRRLWDAHGVDRMS----
I3DTV0_BACMM          ANLLLNYSGQEGWSTDT-LERTDYRRYLLDTVHDLWTQFELQFRELWNGHAADRMA----
C6D8Q5_PAESJ          ANLLLNYAGQGHWIPDE-KELADFRGYLLETIRDTWTKFDQKFRALWNEHGVDRMAN---
D3EDI4_GEOS4          GNLLLNYAAQPGWSKDE-QTLAAREARLLEMASSVWTHFENNFRTLWNDDLLDEMS----
A0A3S9H3F6_9FIRM      GNLILNYASWSGKEVS-TEFKADYREYLLDTIEDIWNKFEEKFRKFWDQEAHETTK----
A0A2G6KIB8_9BACT      GNILINYISWDGKDNP-VEKIQDYRNYLITTINDLYTLFDQKFVANWDKDATDVMA----
MTNK_ECO45            GNLLLAYFSRPGWDANE-QRRADYQEWLLQQIVQTWSVFTREFRQLWDNKTQGDAWSTEM
                      .:  :                                 *   :                 

MTNK_GEOKA            ------ATPGLLEDVLRHAFIDAVGFAGCEVIRRTIGLAHVADLDGIEHKDERLVAKRHA
MTNK_GEOTN            ------ATPGLLDDVLRQTFIDAVGFAGCEVIRRTIGLAHVADLDGIEQKDERLAAKRHA
MTNK_BACAH            ------KEKQWLPIILQNIFTDAVGFAGCELIRRTIGLAHVADLDEITNKETRIQAKKQA
MTNK_BACCZ            ------KEKQWLPIILQNIFTDAVGFAGCELIRRTIGLAHVADLDEITNKETRIQAKKQA
MTNK_BACHK            ------KEKQWLPIILQNIFTDAVGFAGCELIRRTIGLAHVADLEEITNKETRIQAKKQA
MTNK_BACC1            ------KEKQWLPIILQNIFTDVVGFAGCELIRRTIGLAHVADLDEIANKEKRIQAKKQA
MTNK_BACCR            ------KEKQWLPIILQNIFTDAVGFAGCELIRRTIGLAHVADLDEIENKETRIQAKKQA
MTNK_BACMK            ------KEKQWLPIILQNIFTDAVGFAGCELIRRTIGLAHVADLDGIANKENRIQAKKQA
MTNK_BACCN            ------KEKQWLPIVLQHIFRDAVGFAGCEVIRRTIGLAHVVDLDGIVEKDRRIQVKKQA
A0A2C2UTJ6_BACCE      ------KEKQWLAIVLQNIFADAVGFAGCEIIRRTIGLAHVVDLDGIKNKSRRIQAKKQA
D5DZB6_BACMQ          ------KDERLLHEILTQTWQDAVGYAGCEIIRRTIGLAHVADLDEISSEERKINAKRTA
MTNK_BACVZ            ------HL---LEDTLKNAFEEAVGFAGCELIRRTIGLAHVADLDEITPFDKRIERKKLA
A0A5C8IWL2_BACAM      ------HL---LEDTLKNTFEEAVGFAGCELIRRTIGLAHVADLDELTPFDKRIERKKLA
MTNK_BACSU            ------NIDGYLTDTLSHIFEEAIGFAGCELIRRTIGLAHVADLDTIVPFDKRIGRKRLA
MTNK_BACLD            ------HENGRLESVLRQAFEDAAGFAGCEMIRRTIGLAHVADLDTIVPFSRRISQKKLA
MTNK_BACP2            ------VSDSFLETTFDRILKEATGFAGCELVRRTIGLAHAADLDAIPSPSKRIQQKKTA
A0A1N6YGA6_9BACI      ------DTDGYLEWLLDDVFKQATGFMGLEMIRRTIGLAHVKDLDGIEDDTARLQAKRRS
A0A172ZBE9_9BACL      ------DAAGYLDDELLRIFQDAIGYAGSEMMRRVIGLAHARDIEAISDKDRRLHIKSSA
W1SQU7_9BACI          ------QTSTFLNYILAKFFEDALGFTGCELIRRTIGLAHVADLDSIEEEKTRLAAKRKT
I3E801_BACMM          ------KTDGYLEKVLKKYFKDMIGFAGCELIRRTIGLAHVADLDGIDDQSKRIHAKIKT
U5LA21_9BACI          ------GTEGFLSAVLQKYWEDAVGFAGCELIRRTIGLAHVADLDGIEDKKARLAAKRAA
A0A2A4BIB2_9BACI      ------HVKGYLPYLLTKFKKDAFGFAGCELIRRTIGLSHVADLNVIEDKETRIAAKTET
A0A1B3XQ14_9BACI      ------HVTGYLPYLLTKFKRDAFGFAGCELIRRTIGLSHVADLNVMEDKETKIAAKTAT
MTNK_EXIS2            ------KADGLVDDVLSTILQDALGFAGCELIRRTIGLALVADLEQISDSTVRLERKRHA
C4KZ49_EXISA          ------TV-GFVDELLPSILSDAIGYAGCELIRRTVGLAGVADLETLPDD-LRIERKRHA
A0A2B8TP98_9BACI      ------QK-ALIKEKLEGYWIDAIGVIGCELIRRSIGLAHVEDFDSLEHH-QKIYAKKKV
A0A087N2G1_9BACI      ------KVAGYLDDHIADIFVDTLGYAGAELIRRTIGLAHVKDLDSIENTALRLQKKQQT
A0A078M781_9BACL      ------KVAGYLDDHIADIFVDTLGYAGAELIRRTIGLAHVKDLDSIENNALRLQKKQQT
D3FZB4_ALKPO          ------QTEGYVDYMLATIFEDAVGFAGCELIRRIIGLAHVADIDNISDCQKRLCAQKNA
W4QXV8_BACA3          ------KVDGFLEQTLADIWKDTVGFAGCKVIRRMIGLAGVEDVESIKDSPARIAVKKQA
A0A0V8JCC5_9BACI      ------KLPGFEDEVLESIFTDMVGFAGCEVIRRTIGLAHVADLDSIADFDEQIILKKKA
A0A0C2V366_9BACL      ------RTEQYADYVIHKIWQDTLGFAGCKTIRRIIGLAHVEDIDGIEDPSGRLQAQQRA
MTNK_YERPB            ------ATEGYATQFLQHVWRDAIGYCGSELIRRTIGLAHVADLDSIDDEEMRRACQRHA
MTNK_YERP3            ------ATEGYAAQFLQHVWRDAIGYCGSELIRRTIGLAHVADLDSIDDEEMRRACQRHA
MTNK_YERPY            ------ATEGYAAQFLQHVWRDAIGYCGSELIRRTIGLAHVADLDSIDDQEMRRACQRHA
MTNK_YERE8            ------ATAGYARLFLQQVWQDAVGYCGSELIRRTIGLAHVADLDSIADDEMRRACQRHA
MTNK_SERP5            ------AVPGYAEQFLQQVWTDAVGYCGSELIRRTIGLAHVADLDSISDAEMRAECQRNA
MTNK_PECAS            ------AESGYAALFLQQVWLDAIGFCGTELIRRTIGLAHVVDLDSIQETDARLACQRHV
MTNK_ENT38            ------SVPGYASQFLKKVWTDAIGFCGTELIRRSVGLSHVADIDTIKDDAMRHECLRHA
MTNK_CITK8            ------RAPGYASEFLKKVWADAIGFCGTELIRRSVGLSHVADIDTIQDAEMRHECLRHA
MTNK_KLEP7            ------AYPGYASAFLKKVWADAVGFCGSELIRRSVGLSHVADIDTIQDDAMRHECLRHA
MTNK_CROS8            ------AEPGYASEFLKKVWADAIGFAGTELIRRSVGLSHVADIDTIRDEEMKLSCLRHA
S3IRJ8_9ENTR          ------ATEGYVEQFLQKVWIDAVGFCGTELIRRSVGLSHVSDLESIEDEATRLACISHA
D4GKZ6_PANAM          ------AYPGYAQAFLRKVWADTIGFCGTELIRRTVGMSHVADMKLIRDDEMRTDCIRNA
H3R9J1_PANSE          ------AYPGYAQAFLRKVWADTIGYCGTELIRRTVGMSHVADMKLIRDEEMRTDCIRNA
MTNK_ERWT9            ------AVPGYASTFLAKIWRDSVGYSGTELIRRTVGMSQVADIKGIQDDAMRVECVRQA
D8MNJ9_ERWBE          ------AYPGYAAAFLQKIWRDTLGFCGVEMIRRTVGISQIADIKTIKDDTMRVECVRQC
A0A1Y0LAF1_TATCI      ------AVPGYAERFLQKVWQDAIGFSGTELIRRTVGMSHVADISEVSDDMMRLDCLRHA
A0A2A5JMV5_PSEO7      ------QADGYAEYFLKKVLQDAIGYCGCELIRRTIGLAHVADIDGIEDESARLAVQKRA
A0A3R8U321_9GAMM      ------QAEGYAEYFLTKVLQDAVGYCGCELIRRTIGLAHVTDIDDIEDDAARLEVQKRA
A0A2N5LR45_9GAMM      ------KVTGYSEYFIKGVLQDAIGYCGAELIRRTIGLAHVTDIDSIGDDKARLIVQKQT
I1E0Q6_9GAMM          ------QNSLYQQRFMQQLWADTLGYAGCELIRRTVGLAHVADLDKISNSTVRGQCEAKA
A0A3M8FJJ0_9GAMM      ------KNDIYINHTIKNIFADTLGYTGCEVIRRIIGLAHVEDLDGMENKTLKNKAEILA
A0A364K0S0_9BACL      ------SVSGFVDEVIRETLQDTAGFAGCKMMRRVIGLASLPDFDVIDDQELRAKLESAA
A0A2N5MFU1_9BACI      ------SIPRYKEDYLLRLLHDTAGFAGCKMMRRVIGLAHVPDLESIKDPELRARGERLA
C0ZL37_BREBN          ------HVEGLWQSYVKRLIQDTAGYAGCKILRRVIGLAGVADLNAIEDDQTRAEAERLA
H6NEP3_9BACL          ------RTAGYQDYYMRTLLQDTFGFTGAKMVRRVHGLAQVADINSLTDEAAKERAQRIA
I3DTV0_BACMM          ------KTRGYQDLYVARLLQDTIGFAGVIMLCRVHGFIHVADIDHIEDAAARERAQRIA
C6D8Q5_PAESJ          ------ETPGYQDLYMSRLLQDAIGYAGCKVVRRIVGLAHVADIDTIPDAAARERAQRLA
D3EDI4_GEOS4          ------RTPGYQDHYVSQILKDAAGFAGCKMIRRIVGLSHVADIDTIADVKARETAQRKA
A0A3S9H3F6_9FIRM      ------AVKGYQDYYLKQLLQDSIGMGGCKTMRRCIGMAHVEDLDGIENLSERARAQIFA
A0A2G6KIB8_9BACT      ------TVSGYQEFYMRKLFVDTIAFAAMVMIRRVHGLAHNIDVDGIEDQERRKDVQISI
MTNK_ECO45            YQQNRAALEDAQDQFFATLLEDSLVNAGMEMNRRIIGFAGVAELKQIENTELRAGCERRA
                                     .     :     .     *  *:    :.. :     :       

MTNK_GEOKA            LRLGRRLIIERRVFTGTEDFRRLFAETEQ---------
MTNK_GEOTN            LRLGRRLIVERAELDGTEDFRRLFVETER---------
MTNK_BACAH            LSLGKELIKYESKNADIQLFRTLFQQTVS-GGIKA---
MTNK_BACCZ            LSLGKELIKYESKNADIQLFRTLFQQTVS-GGIKA---
MTNK_BACHK            ISLGKELIKYESKNADIQLFRTLFQQTVS-GGIKA---
MTNK_BACC1            LYLGKELIKYESKNADIQLFRTLFQQTVS-GGVKA---
MTNK_BACCR            LSLGKELIKYESKSADIQLFRTLFQQTVS-RGVKA---
MTNK_BACMK            LSLGRELIKYEAKCADIQLFRTLFQQTV--GGVKA---
MTNK_BACCN            LYLGRSLLLHQTKGADIQVFKTLFQHIVSEGGIKV---
A0A2C2UTJ6_BACCE      LYLGRELLLHEATNADVRVFQTIFRYIVSGEEARV---
D5DZB6_BACMQ          LKIGRYLLLHQ-QDVSPNEFEHLLR-------------
MTNK_BACVZ            LDIGAYYIENRKELKHITEVLDQFKLRVKE--------
A0A5C8IWL2_BACAM      LEIGACYIENRKELKDITEVLEQFKLRVKE--------
MTNK_BACSU            LETGTAFIEKRSEFKTITDVIELFKLLVKE--------
MTNK_BACLD            LKIGAAFIEKRSGFRTPKDMIEAFRNALKE--------
MTNK_BACP2            LTLGKTFIKQYHAVETASDLVALFQQSVKE--------
A0A1N6YGA6_9BACI      LSIGAHFVKERASYSSAEQLVAAFKEAVK---------
A0A172ZBE9_9BACL      ALLARDLIVNRSHYKRAPQIVEALRQADRNEPILHS--
W1SQU7_9BACI          LELGGILIKQRKEIKNLGAFIGTVKGVL----------
I3E801_BACMM          LNLGKKLIVSRERIRNIDELISNIKDNLK---------
U5LA21_9BACI          LAAGRNLILQRREIADAKDLCRIVSLVSAG--------
A0A2A4BIB2_9BACI      LEIGTFLIKKRGELDVPAVIEALKQRTLPSYSTI----
A0A1B3XQ14_9BACI      LNLGALLIKKREELDVPAVIDLVKQQTLTSYSPI----
MTNK_EXIS2            LRLGAALIKRRTECKTFTDLRNFDVTEELSR-------
C4KZ49_EXISA          LELGTRLIKQRHQIQSIDQL--IPVLSEVRV-------
A0A2B8TP98_9BACI      LIFGVHCIKNRFTIRNIRNL-----LNGLE--------
A0A087N2G1_9BACI      LQAGSFIIKNRRNISSIEGYLAHLEDIR----------
A0A078M781_9BACL      LQAGSFIIKNRRNISSIEGYLAHLEDIR----------
D3FZB4_ALKPO          LELGSTFILKRRNFRTIHQLIQETKDVLK---------
W4QXV8_BACA3          LTLGKHLILNRHELTTIDKLVKVVSSNA----------
A0A0V8JCC5_9BACI      LKLGRDWIKNKQRIKNIEEFITSIRSV-----------
A0A0C2V366_9BACL      IETGRSLIFNRTVWRSPKSLTAYLKGLRK---------
MTNK_YERPB            LSLGRALILVAPHVDDVGGVVARIRQSPSSLTPQRC--
MTNK_YERP3            LSLGRALILVAPHVDDVGGVVARIRQSPSSLTPQRC--
MTNK_YERPY            LSLGRALILVAPHVDDVGGVVARIRQSPSSLTPQRC--
MTNK_YERE8            LSLGRTLILAASRIDSIDDLIARIRQNG----------
MTNK_SERP5            LGLGRALIVNAPQIEHIDALLARIRQNG----------
MTNK_PECAS            LSLGRTLVLAAPHIADVDALLARVRQSGA---------
MTNK_ENT38            ITLGKALIVIADRIDSAEALVARVRQYS----------
MTNK_CITK8            ITLGKALIVIADRIESVEALIARVRQYS----------
MTNK_KLEP7            ITLGRALIVLAERIDSVDELLARVRQYS----------
MTNK_CROS8            IGLGKALILLAPRIENADEFIARVRQYG----------
S3IRJ8_9ENTR          IELGKFLILIAGQVDSVEEFIARVRQKG----------
D4GKZ6_PANAM          ITLGRTLILAAGHVDDVEALIARIRQAG----------
H3R9J1_PANSE          ITLGRTLILAAGHVDDVDALIARIRQAG----------
MTNK_ERWT9            ITLGRSLILLADHVADIDALIARIRQNG----------
D8MNJ9_ERWBE          ITLGRTLILAADHIADSDALIARVRQNG----------
A0A1Y0LAF1_TATCI      ITLGRTLILAAAHIQDADALVARIRQTA----------
A0A2A5JMV5_PSEO7      LQLGEQLILNASKCQTTDDAYQLIISFIN---------
A0A3R8U321_9GAMM      LQLGEQLILNANKCHTTEDVYQLIISFVN---------
A0A2N5LR45_9GAMM      LALGEQLILNAQTCNNKEAFFSLLISQLN---------
I1E0Q6_9GAMM          LQLGRDLIMQRHSLANMAQLMQLLHSLSER--------
A0A3M8FJJ0_9GAMM      LTIGQQFILEQNQLHTIDNVIQKLQGHL----------
A0A364K0S0_9BACL      LLIGQYLVLDRKNISQISDLIAVIEKVKSS--------
A0A2N5MFU1_9BACI      LAVGQVLVLKQGTVSKITDLTTLVRNIDTWEVGDDS--
C0ZL37_BREBN          LSIGEALILGRSGIEESTDITDIVRTITERYYQEATTV
H6NEP3_9BACL          LSIGTTLIKFNRQASSIEQLIEIADKAVQ---------
I3DTV0_BACMM          LEIGVALIKRNRSARSIEEVLDIALKAVN---------
C6D8Q5_PAESJ          LEIGTSLIHLNRRAVSIEQAIDVVLTAEAKQ-------
D3EDI4_GEOS4          LAIGKNLVRHHRSIKSFEDILTLITQASKGNEVSI---
A0A3S9H3F6_9FIRM      LKLGEIMVTRRKRLATITDFIKIVRDLTAWEDTTNM--
A0A2G6KIB8_9BACT      LEIAEELMMYRESFSTIHDVTSFVKARIF---------
MTNK_ECO45            LTMARDLIVNARQFKNMDSVIQSAKVK-----------
                         .   :