CLUSTAL format seed alignment for MF_01694

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

BIOB_FRAT1       -----------------------------------------------------MTLQQIK
BIOB_FRATT       -----------------------------------------------------MTLQQIK
BIOB_FRATN       -----------------------------------------------------MTLQQIK
BIOB_FRATW       -----------------------------------------------------MTLQQIK
BIOB_FRATM       -----------------------------------------------------MTLQQIK
BIOB_FRATF       -----------------------------------------------------MTLQQIK
BIOB_FRATH       -----------------------------------------------------MTLQQIK
BIOB_FRATO       -----------------------------------------------------MTLQQIK
BIOB_FRAP2       -----------------------------------------------------MTLEQIK
BIOB_COXB1       ------------------------------------------------MKGRNWNQASVA
BIOB_COXB2       ------------------------------------------------MKGRNWNQASVA
BIOB_COXBN       ------------------------------------------------MKGRNWNQASVA
BIOB_COXBR       ------------------------------------------------MKGRNWNQASVA
BIOB_COXBU       ------------------------------------------------MKGRNWNQASVA
BIOB_LAWIP       -------------------------------------------------MRNDWTFKEAK
BIOB_RICFE       --------------------------------------------------MKKWTFDEAK
BIOB_NEOSM       -------------------------------------------------MAKVWQFSEAE
BIOB_ANAMF       ------------------------------------------------MIRNNWTLEEAL
BIOB_ANAMM       ------------------------------------------------MIRNNWTLEEAL
BIOB_ANAPZ       ------------------------------------------------MIRNNWTLEETL
BIOB_EHRCJ       -------------------------------------------MSTFTPTRNDWQLDEIL
BIOB_EHRCR       -------------------------------------------MNTCTTIRNNWQLDEIL
BIOB_EHRRG       ---------------------------------------------MCTSIRHDWQLPEVL
BIOB_EHRRW       ---------------------------------------------MCTSIRHDWQLPEVL
BIOB_AGRRK       ----------------------------MAADG---------------TIRHDWAIDEIV
BIOB_AGRVS       ---------------------------MSEAAG---------------EIRNDWSVEEIV
BIOB_RUEPO       ------------------------------MAE---------------AIRSDWSVDEVE
BIOB_BEII9       -------------------------MNAPFVVS---------------PVRHDWSRHEIK
BIOB_METSB       -------------------------MTHQAADP---------------FTRHDWTLSEII
BIOB_ZYMMO       -----------MVSVGTQSHSGRDQAEQNPSVE---------------NVRYDWQLDEAL
BIOB_METC4       ------------------MSDTVVSLTASPAA-----------------IRHDWTLAEIQ
BIOB_METEP       ------------------MSDTVVSLTASPAA-----------------IRHDWTLAEIQ
BIOB_METPB       ------------------MSDTVVSLASSQAPDAVRQ-----------DIRHDWTLAEIQ
BIOB_METRJ       ------------------MSATSLPGSQQPDLG---------------EIRHDWSVAEIR
BIOB_METNO       ----------------------MTTTTERPDA----------------PIRHDWTVAEIQ
BIOB_METS4       -----------------------MTTTERSDP----------------AIRHDWTVAQVQ
BIOB_PROM2       --------------------MANSNNQLLKEI------------------RFDWNKEEIL
BIOB_PROM9       --------------------MPNSNNQLLKEI------------------RFDWNKEEIL
BIOB_PROMS       --------------------MINSNNQVLSEI------------------RFDWNKKEIL
BIOB_PROM0       --------------------MANSNNQLLKEI------------------RYDWNREEIL
BIOB_PROM5       --------------------MINSDNQKFSKI------------------RFDWARDEIL
BIOB_PROMP       --------------------MINSDNQKFSEI------------------RFDWERDEIL
BIOB_PROM1       ------------------MTLINPNIQESNKLKFKDESYLDFNSINGGDIRHDWSSEEIK
BIOB_PROMT       ------------------MTLINPNIQESNKLKFKDESYLDFNSIKGGDIRHDWSSEEIK
BIOB_PROM4       ------------------MTLINYKAADQKEVQL----------------RYDWSFSEVE
BIOB_PROMA       ------------------MTLLNPNIPIRQEVKV----------------RFDWSLEEIQ
BIOB_PROM3       ------------------MTVLIAKDLTFEPVVH----------------RYDWTVDEVR
BIOB_PROMM       ------------------MTVLIAKDLTFEPVVH----------------RYDWTVDEVR
BIOB_SYNPW       ---------------------------MSEQVDL----------------RHDWTLAEIE
BIOB_SYNS3       ---------------------------MTEAVEV----------------RHDWTRSEIE
BIOB_SYNPX       -----------------------------MTFTI----------------RHDWTIAEIQ
BIOB_SYNSC       -----------------------------MTLSI----------------RHDWTTEEIQ
BIOB_SYNS9       -----------------------------MTITT----------------RHDWTTEEIQ
BIOB_SYNR3       -----------------------------MSALI----------------RHDWDLAEIE
BIOB_SYNE7       ----------------------------MEAI------------------RHDWTLEEIE
BIOB_SYNP6       ----------------------------MEAI------------------RHDWTLEEIE
BIOB_SORC5       ---------------------MLEGIEREAAEHSNGCSGPAGHAPPAGAPRHDWTVQQAV
BIOB_MYXXD       ---------------------MPDTATVSSESEFSGHAHVAAPPPAGVDVRHDWSLSEVR
BIOB_GLOVI       ----------------------------------------------MCRAPMPSTVSEIS
BIOB_SYNJA       ---------------------------------------------------MAIALEYVR
BIOB_NOSS1       --------------------------MSVGRI------------------RYDWHKAEIR
BIOB_TRIV2       --------------------------MSVGRI------------------RYDWHTAEIR
BIOB_NOSP7       ----------------------------MVGI------------------RYDWQELEIR
BIOB_CHLAB       ----------------------------METH------------------SELWSLEAIK
BIOB_CHLFF       ----------------------------MNTR------------------HEQWSLETIK
BIOB_CHLPN       ----------------------------MREE------------------TVSWSLEDIR
BIOB_FLAJ1       ---------------------------MSMTT------------------KHNWTKDEII
BIOB_FLAPJ       ----------------------------MSVM------------------RNNWTKEEII
BIOB_GRAFK       -----------------------------MAL------------------KHDWTKEEIL
BIOB_CYTH3       ----------------------------MTEI------------------RNNWTKEEIS
BIOB_HYDCU       --------------------------MALGDV------------------RNDWTLEEIK
BIOB_BRUA1       ----------------------------MPD--------RGGENGASCSV-GRWSAEEAR
BIOB_BRUA2       ----------------------------MPD--------RGGENGASCSV-GRWSAEEAR
BIOB_BRUAB       ----------------------------MPD--------RGGENGASCSV-GRWSAEEAR
BIOB_BRUC2       ----------------------------MPD--------RGGENGASCSV-GRWSAEEAR
BIOB_BRUMB       ----------------------------MPD--------RGGENGASCSV-GRWSAEEAR
BIOB_BRUME       ----------------------------MPD--------RGGENGASCSV-GRWSAEEAR
BIOB_BRUSI       ----------------------------MPD--------RGGENGASCSV-GRWSAEEAR
BIOB_BRUSU       ----------------------------MPD--------RGGENGASCSV-GRWSAEEAR
BIOB_BRUO2       ----------------------------MPD--------RGGENGASCSV-GRWSAEEAR
BIOB_OCHA4       -------------------------MLNMVQS-NP----KGVEKTASKSEQDAWTLASAR
BIOB_AGRFC       ----------------------------MDQLATQ----IDGKPASIPAVETSSSLEEAK
BIOB2_PARDP      ----------------------------MPQ-----------------------QSRSAA
BIOB_LEGPA       ----------------------------MSE------------------EKKQWSISDIE
BIOB_LEGPH       ----------------------------MSE------------------EKKQWSISDIE
BIOB_LEGPL       ----------------------------MSE------------------EKKQWSISDIE
BIOB_LEGPC       ----------------------------MSE------------------ENKQWSISDIE
BIOB_RUTMC       ----------------------------------------------MEELRNDWTLKEVE
BIOB_VESOH       ----------------------------------------------MTQQRHNWTLKEVE
BIOB_HAEI8       --------MLAEKLQINSIT---------------PHPS-----------VEYWSVCKVE
BIOB_HAEIE       --------MLAEKLQINSIT---------------PHPS-----------VEYWSVCKVE
BIOB_HAEIN       --------MLAEKLQINSIT---------------PHPS-----------VEYWSVCKVE
BIOB_HAEIG       --------MLAEKLQINSIT---------------PHPS-----------VEYWSVCKVE
BIOB_HAES1       --------MTIITINIPSLT---------------PHPC-----------VEYWSVCKVE
BIOB_HISS2       --------MTITTINIPSLT---------------PHPC-----------VEYWSVCKVE
BIOB_PASMU       -------MTTATAFEIRTLT---------------PHPT-----------LEYWSVCKIE
BIOB_ACTSZ       ---------METTLQLYSNT---------------PHPQ-----------AQYWSVCKVE
BIOB_MANSM       ---------MKTTLQLYSNT---------------PHPQ-----------VEYWSVCKVE
BIOB_ACTP7       -----MTTYNLRLKAKSELT---------------PHPT-----------AQYWRKCQVE
BIOB_ACTPJ       -----MTTYNLRLKAKSELT---------------PHPT-----------AQYWRKCQVE
BIOB_ACTP2       -----MTTYNLRLKAKSELT---------------PHPT-----------AQYWRKCQVE
BIOB_HAEDU       -----MTTYNLRLKAKDELT---------------PHPS-----------VQYWRKCQVE
BIOB_HAEPS       -----MTTYSLRLKAKNELT---------------PHPT-----------AQYWRKCQVE
BIOB_NEIG1       -----MTVSPVALRRKTECK---------------PHPT-----------ARYWKKCDVE
BIOB_NEIG2       -----MTVSPVALRRKTECK---------------PHPT-----------ARYWKKCDVE
BIOB_NEIM0       -----MTVSPVALRRKTECK---------------PHPT-----------ARYWKKCDVE
BIOB_NEIMF       -----MTVSPVALRRKTECK---------------PHPT-----------ARYWKKCDVE
BIOB_NEIMA       -----MTVSPVALRRKTECK---------------PHPT-----------ARYWKKCDVE
BIOB_NEIMB       -----MTVSPVALRRKTECK---------------PHPT-----------ARYWKKCDVE
BIOB_CHRVO       -------MHSATMVFKRAAT---------------PHPE-----------KAEWSVDDVE
BIOB_METSK       -----MRDSVIDIRGLDRVQ-----RARVQA-------KEEA--------PKRWSVDDIV
BIOB_METFK       -----MRDSVIDIRGLDRVQ-----RARVQA-------KEEA--------PKRWSVDDIV
BIOB_THIDA       ----------------------------MND-------MTPP--------VPRRSVSEIE
BIOB_NITEC       ------MESRTDLISEKQCG-----CTYSNP---DLAVQQES--------SSRWLVADVE
BIOB_NITEU       ------MESATSLISEKQCE-----CAHPNS---DSAVQG-S--------SLRWSIAAIE
BIOB_NITMU       -----MSQSASGIVNIETSS-----GGAVDSFADKLSGISAD--------FRRWDVRRVE
BIOB_ACISJ       -----MTSATTAPHTTQT---------LQFHPRVAESVATQR--------GEGWSIQAVQ
BIOB_ACIET       -----MTSATTAPHTTQT---------LQFHPRVAESVATQR--------GEGWSIQAVQ
BIOB_DELAS       -----MTACSTTPTTSATSAQPAAGSPLQWHARPSKSDTLPF--------EGAWSVQAIQ
BIOB_ACIAC       -----MTATLSDIRPEAPA--------VPVQLHRPARTPAPA--------AGTWSVQAVQ
BIOB_METPP       -------MTATQPVHLVR---------------PAPVHVHPS--------SERWSVEAIE
BIOB1_POLSJ      -----MSSVLTQPLAFHP---------------PRPAVQPRE--------HGRWSVDEIE
BIOB_HERAR       ------MSSQP-----------------VTFQAPVAPIV-----------PTAWPVDDVL
BIOB_JANMA       ------MSSQP-----------------VTFQAPVAPII-----------PTAWPVDDVL
BIOB_RHOFT       ------MSPNPSQQSSA-----------VAFHPSAAPITLPE--------SATWPLADVL
BIOB_POLAQ       -----MLDAQTVEKPLT-----------HIKSKADLRKEVDA--------SGEWTVSQIE
BIOB_BORBR       --------------MHTAYI-------------PVPTPVRP-------PSAERWPLAAVA
BIOB_BORPA       --------------MHTAYI-------------PVPTPVRP-------PSAERWPLAAVA
BIOB_BORPE       --------------MHTAYV-------------PVPAPVRP-------PSAERWPLAAVA
BIOB_BORPD       --------------MHISTI-------------PVSDIAKPN-----APAAGAWQADDVL
BIOB_BORA1       --------------MQTIPL-------------PIR------------PTAGRWRTADVV
BIOB_BURCM       -----MTQAQTA-TVQPDAI-------------PVAAPA-----------SQRWRVADVV
BIOB_BURL3       -----MTQAQTAATVQPDAI-------------PVAAPV-----------SQRWRVADVV
BIOB_BURA4       -----MTQVQTA-AVQPDAI-------------PVAAPA-----------PQRWRVADVV
BIOB_BURVG       -----MTQAQTA-AVQPDAI-------------PVAAPT-----------PQRWRVADVV
BIOB_BURM1       -----MTQAQTA-AAQPDAI-------------PVAAPS-----------PQRWRVADVV
BIOB_BURCA       -----MTQAQTA-AVQPAAI-------------PVAAPA-----------SQRWRVADVV
BIOB_BURCC       -----MTQAQTA-AVQPAAI-------------PVAAPA-----------SQRWRVADVV
BIOB_BURCH       -----MTQAQTA-AVQPAAI-------------PVAAPA-----------SQRWRVADVV
BIOB_BURCJ       -----MTQAQTV-AVQSDAI-------------PMAAPA-----------PQRWRVADVV
BIOB_BURM7       -----MTEAQTA--CATTET-------------PVAAPA-----------APRWRVADVI
BIOB_BURM9       -----MTEAQTA--CATTET-------------PVAAPA-----------APRWRVADVI
BIOB_BURP6       -----MTEAQTA--CATTET-------------PVAAPA-----------APRWRVADVI
BIOB_BURMA       -----MTEAQTA--CATTET-------------PVAAPA-----------APRWRVADVI
BIOB_BURMS       -----MTEAQTA--CATTET-------------PVAAPA-----------APRWRVADVI
BIOB_BURP0       -----MTEAQTA--CATTET-------------PVAAPA-----------APRWRVADVI
BIOB_BURPS       -----MTEAQTA--CATTET-------------PVAAPA-----------APRWRVADVI
BIOB_BURP1       -----MTEAQTA--CATTET-------------PVAAPA-----------APRWRVADVI
BIOB_BURTA       -----MTEAQTA--CPTTET-------------PVAAPV-----------APRWRVADVI
BIOB_PARPJ       -----MTQLNIA--PTPADT-------------AAANNNANA--AAGAKQVARWRVADIV
BIOB_PARXL       -----MTQLNIA--PASTDT-------------AAASNN-NA--AAGTKQLARWRVADIV
BIOB_PARP8       -----MSQIQTA--PLPVMP-------------SQAAAAADA--AA-----SRWKVADVA
BIOB_CUPTR       -----MTQAHT---VTTISA-------------ESLRQTAR---PHALPDDAKWRVDDVA
BIOB_CUPNH       -----MTQAHTATTVTTVSV-------------DSLRQSAR---SHALPDDAAWRVDDVA
BIOB_CUPPJ       -----MNQAAQ--TVATISA-------------EALRQTARN--THALPEDARWRVDDVA
BIOB_CUPMC       -----MTQQAN-QTVATISA-------------EALRQSARNIAAAAPKEGDAWRVDDVA
BIOB_POLNA       ----MTSITTIPLSTLRSSL-------------PARPDAAAA--------PQRWRVADIE
BIOB2_POLSJ      -----MSIATIPVSSLRRA--------------PAPTTAPQA--------PLRWQVEDIA
BIOB_LEPCP       -----MTTATISLSTLQASR-------------PSVAARADA--------AARWRVADVE
BIOB_RALPJ       -----MQSTPLNFVPNAAKA-------------PVTPGQAP---------DARWSREAIE
BIOB_RALSO       -----MQHAPLNFVPDAAKV-------------PPTPGQSP---------NARWSREAIE
BIOB_AZOSB       -----MTTTLTAPTPAAAEAP-----------------------------RKKWTVAEVQ
BIOB_AROAE       -----MTSAPAAERPAAPAVP-----------------------------RIKWTVVEAV
BIOB_DECAR       ----MQASSLAAVSSASPSAP-----------------------------ARRWTVEEVL
BIOB_GLUDA       -------------------------------------------------MRTDWTRDEIA
BIOB_GLUOX       -------------------------------------------------MRHDWTRDEVE
BIOB_GRABC       -----------------------------------------------MVIRHDWSREEVR
BIOB_ACICJ       -----------MSIALDSSTA-------------------------TAAAAPSPTRARIA
BIOB_STRM5       --------------------M-------------------------AAAIRHDWQHDELQ
BIOB_STRMK       --------------------M-------------------------AAAIRHDWQHDELQ
BIOB_XANAC       --------------------M-------------------------SVVLRHDWDRKELQ
BIOB_XANC5       --------------------M-------------------------SVVVRHDWDRKELQ
BIOB_XANOM       --------------------M-------------------------SVVVRHDWDHKELQ
BIOB_XANOP       --------------------M-------------------------SVVVRHDWDHKELQ
BIOB_XANOR       --------------------M-------------------------SVVVRHDWDHKELQ
BIOB_XANC8       --------------------M-------------------------SVVVRHDWDRKELH
BIOB_XANCB       --------------------M-------------------------SVVVRHDWDRKELH
BIOB_XANCP       --------------------M-------------------------SVVVRHDWDRKELH
BIOB_XYLF2       --------------------M-------------------------SSIIRYDWTAEELH
BIOB_XYLFT       --------------------M-------------------------SSIIRYDWTAEELH
BIOB_XYLFM       --------------------M-------------------------SSVIRYDWTAEELH
BIOB_XYLFA       --------------------M-------------------------SSIIRYDWTAEELH
BIOB_AZOC5       -----MSAAIAATARPA-------------------------------------AEMRTR
BIOB_XANP2       MTTSTGTTTGTGTARAAEG----------------------------SLLRSDWTEAEAR
BIOB_RHOS1       ------------MIRPA--------------------------------LRTDWTVEEAR
BIOB_RHOS4       ------------MIRPA--------------------------------LRTDWTLEEAR
BIOB_RHOSK       ------------MIPSD--------------------------------LRTDWTVEEAR
BIOB1_PARDP      ----------------M--------------------------------IRTDWTMAEAW
BIOB_BRASB       -MSEVRRPSSSQPAADGA-------------------------------IRHDWTREEAE
BIOB_BRASO       -------------MQGAP-------------------------------LRHDWTREEAE
BIOB_NITHX       MD-AASVSFGSGHDLSSQ-------------------------------PRHDWTRSEAE
BIOB_NITWN       MK-SDPVSFDSSHDLMAR-------------------------------PRHDWTRVEAE
BIOB_OLICO       MNISMGISSLSVINGSAL-------------------------------PRHNWAREEAQ
BIOB_BRADU       MDAAVQVQ-RKKASNGAQ-------------------------------VRNHWNVEEAK
BIOB_RHOPA       -----MNSIAHSTLAAA-----------------------------SPTIRHDWTREEAA
BIOB_RHOPT       -----MNSIAHSTLAAA-----------------------------SPTIRHDWTREEAA
BIOB_RHOPS       -----MNSIDLPSLAQALADS-------------------------TPTIRHNWTREEAA
BIOB_RHOP2       -----MNSIDLASLAAA-----------------------------TPTLRHDWTREQAA
BIOB_RHOP5       -----MNSIDLPSLAEA-----------------------------TPTIRHDWTREEAA
BIOB_RHOPB       -----MNTIDLPSLAQA-----------------------------TPTIRHDWTREEAA
BIOB_CAUVN       ---------MSEITAS---------------------------------PRHDWTLAEVE
BIOB_CAUVC       ---------MSEITAS---------------------------------PRHDWTLAEVE
BIOB_CAUSK       ---------MTQINAQLAH-----------------------------EPRHDWTLPQVE
BIOB_PHEZH       -----MNAHVRPVDPANVDP---------------------------AQPRHDWTLEEVE
BIOB_HYPNA       ---------MTSSDLT---------------------------------PRQNWTREEIA
BIOB_MARMM       ------MSLLNDIDQLS-------------------------------QVRTDWTRETAG
BIOB_ERYLH       ---------------MT-------------------------------PIRTNWSRDEIA
BIOB_NOVAD       MQETALLERESAGTGNA-------------------------------PVRTDWTREEIA
BIOB_SPHAL       -------------------------------------------------MRTDWTREEIA
BIOB_SPHWW       --------MNAHANPRP-------------------------------AVRSDWTREEIA
BIOB_PARL1       ---------MTARTDPG-------------------------------ALRHDWTREELQ
BIOB_ACIF2       ------MNNSTALQTL----------------------------------------DAIL
BIOB_ACIF5       ------MNNSTALQTL----------------------------------------DAIL
BIOB_NITOC       ------MTYFPPAAEICDSP------------------------------RHDWSIPEVL
BIOB_THISH       ------MSPASPMSEI----------------------------------RHDWQVDEIL
BIOB_ALKEH       ------MTATTQTPRH------------------------------------DWSKDEVL
BIOB_HALHL       ---------MTETDTW------------------------------------HWDQPQIH
BIOB_ALCBS       ---MPAIASSPQSRSTDMAV------------------------------RHDWKRSEID
BIOB_METCA       --------MTNQERAEEPVL------------------------------RHDWTQGEAE
BIOB_MAGSA       -----MTAQAALATAANDGE-----------------------------LRHDWSAEEIE
BIOB_ACIB3       -----------------------------------------------MTLRNDWTREEIQ
BIOB_ACIB5       -----------------------------------------------MTLRNDWTREEIQ
BIOB_ACIBY       -----------------------------------------------MTLRNDWTREEIQ
BIOB_ACIBC       -----------------------------------------------MTLRNDWTREEIQ
BIOB_ACIBT       -----------------------------------------------MTLRNDWTREEIQ
BIOB_ACIBS       -----------------------------------------------MTLRNDWTREEIQ
BIOB_ACICA       -----------------------------------------------MTLRNDWTRDEIQ
BIOB_ACIAD       -----------------------------------------------MTLRNDWTRDEIQ
BIOB_PSYA2       -----------------MSALLNITEPNNNTNTKNDHFLASLTTDATQSTASKYSREQIA
BIOB_PSYCK       -----------------MSALLNITEPNNNTNSNDNDFLASLTTDAPQAIASKYSREQIA
BIOB_PSYWF       -----------------MSFLATLKEPGTSVCLKNEPAQSPSLHDHAPSTAA-ISREYIA
BIOB_CELJU       -----------------------------------MNASFAPSSSFVAGLRHDWSRAEIK
BIOB_SACD2       -------------------------------------------MSNPSLVRSNWTRKEVE
BIOB_HAHCH       ---------------------------------------------MQSPIRHDWSLEEVE
BIOB_MARHV       --------------------------------------------MTATATRHDWTLQEAR
BIOB_CHRSD       -----------------------------MTAQSRDPAWTDASPTFQPTMRHDWSLEEIE
BIOB_PSE14       -----------------------------------------MSASTTDTLRHDWTLAEVR
BIOB_PSEU2       -----------------------------------------MSASTTATLRHDWTLAEVR
BIOB_PSESM       -----------------------------------------MSASTTATLRHDWTLAEVR
BIOB_PSEF5       -----------------------------------------MSASTTATLRHDWTLAEVK
BIOB_PSEPF       -----------------------------------------MSASTTATLRHDWTLAEVK
BIOB_PSEP1       -----------------------------------------MSASTTATTRHDWSLAEVK
BIOB_PSEPK       -----------------------------------------MSASTTATTRHDWALAEVK
BIOB_PSEPG       -----------------------------------------MSASTTATTRHDWSLAEVK
BIOB_PSEPW       -----------------------------------------MSASTTATTRHDWSLAEVK
BIOB_PSEE4       -----------------------------------------MSASAIATTRHDWSLAEVK
BIOB_PSEA8       -----------------------------------------MSATASVATRHDWSLAEVR
BIOB_PSEAE       -----------------------------------------MSATASVATRHDWSLAEVR
BIOB_PSEAB       -----------------------------------------MSATASVATRHDWSLAEVR
BIOB_PSEA7       -----------------------------------------MSASAAVATRHDWSLAEVR
BIOB_PSEMY       -----------------------------------------MSATAAITTRHDWTLAEVR
BIOB_PSEU5       -----------------------------------------MSATSASVTRHDWSLAEVK
BIOB_IDILO       ----------------------------------------------MPQIRNDWTIEEVQ
BIOB_COLP3       ---------------------------------------------MNSILRHNWNLKEVE
BIOB_PSYIN       -------------------------------------------MINNTEIRQNWTVAEVD
BIOB_MARMS       -----------------------------------------MSINNISAPRFDWTHAEIK
BIOB_PSEHT       --------------------------------------------MELAPVRHNWTHSEVK
BIOB_SHEB2       --------------------------------------------MSQLQVRHDWKREEIE
BIOB_SHEB5       --------------------------------------------MSQLQVRHDWKREEIE
BIOB_SHEB8       --------------------------------------------MSQLQVRHDWKREEIE
BIOB_SHEB9       --------------------------------------------MSQLQVRHDWKREEIE
BIOB_SHESA       --------------------------------------------MSQLQVRHDWKREEIE
BIOB_SHESM       --------------------------------------------MSQLQVRHDWKREEIE
BIOB_SHESR       --------------------------------------------MSQLQVRHDWKREEIE
BIOB_SHEON       --------------------------------------------MSQLQVRHDWKREEIE
BIOB_SHEPC       --------------------------------------------MSQLQVRHDWKREEIE
BIOB_SHESW       --------------------------------------------MSQLQVRHDWKREEIE
BIOB_SHEHH       --------------------------------------------MSEVQLRNNWKREEIE
BIOB_SHEPA       --------------------------------------------MPEVQLRNNWKREEIE
BIOB_SHEPW       --------------------------------------------MSDVQVRNNWKRDEIE
BIOB_SHEDO       --------------------------------------------MSLFEVRHDWKKAEIE
BIOB_SHEFN       --------------------------------------------MSLAEVRHDWQKAQIE
BIOB_SHESH       --------------------------------------------MSDIQLRHDWKHDEIE
BIOB_SHEWM       --------------------------------------------MSEIQLRHDWKRDEIE
BIOB_SHELP       --------------------------------------------MSELALRHDWQRDEIE
BIOB_SHEAM       --------------------------------------------MSSFAVRHDWSRQEVE
BIOB_AERHH       ---------------------------------------MNAVTAGAHALRHDWTLAEVQ
BIOB_AERS4       ---------------------------------------MNAHTAGGHALRHDWTLSEVQ
BIOB_ALTMD       ------------------------------------MTLAYAPTAQTITIRNDWTKAEVE
BIOB_PSEA6       ----------------------------------MSVNVDATSSSGASEVRHDWTLAEVN
BIOB_ALIF1       -----------------------------------------------MEVRHNWTVAEVQ
BIOB_ALIFM       -----------------------------------------------MEVRHNWTVAEVQ
BIOB_ALISL       -----------------------------------------------MEVRHNWTVVEVK
BIOB_VIBC3       -----------------------------------------------MEVRHNWTVAEVK
BIOB_VIBCH       -----------------------------------------------MEVRHNWTVAEVK
BIOB_VIBTL       -----------------------------------------------MEVRHDWTVAEVR
BIOB_VIBCB       -----------------------------------------------MEVRHNWTHAEVR
BIOB_VIBPA       -----------------------------------------------MEVRHNWTHAEVR
BIOB_VIBVU       -----------------------------------------------MEVRHNWTHAQVR
BIOB_VIBVY       -----------------------------------------------MEVRHNWTHAQVR
BIOB_PHOPR       -----------------------------------------------MEVRHDWTVAEVQ
BIOB_BUCA5       -----------------------------------------------MKKK--WTLEETK
BIOB_BUCAT       -----------------------------------------------MKKK--WTLEETK
BIOB_BUCAI       -----------------------------------------------MKKK--WTLEETK
BIOB_BUCAP       -----------------------------------------------MKRK--WNLEDTK
BIOB_BUCBP       -----------------------------------------------MKTQ--WNFEKVK
BIOB_WIGBR       -----------------------------------------------MKNKSIWNLKNTK
BIOB_BAUCH       -----------------------------------------------MQVTQRWNREQAI
BIOB_PECAS       -----------------------------------------------MADRIYWTLEQAQ
BIOB_ERWT9       -----------------------------------------------MATR--WTLSQAQ
BIOB_SERMA       -----------------------------------------------MADRIHWTVGQAQ
BIOB_SERP5       -----------------------------------------------MADRIHWTVGLAQ
BIOB_YERPA       -----------------------------------------------MATYHHWTVGQAL
BIOB_YERPB       -----------------------------------------------MATYHHWTVGQAL
BIOB_YERPE       -----------------------------------------------MATYHHWTVGQAL
BIOB_YERPG       -----------------------------------------------MATYHHWTVGQAL
BIOB_YERPN       -----------------------------------------------MATYHHWTVGQAL
BIOB_YERPP       -----------------------------------------------MATYHHWTVGQAL
BIOB_YERPS       -----------------------------------------------MATYHHWTVGQAL
BIOB_YERPY       -----------------------------------------------MATYHHWTVGQAL
BIOB_YERP3       -----------------------------------------------MATYHHWTVGQAL
BIOB_YERE8       -----------------------------------------------MANYLRWTVGQAQ
BIOB_PSEVU       -----------------------------------------------MAHHARWTLSQVT
BIOB_ENT38       -----------------------------------------------MAHHPRWTMSQVT
BIOB_KLEP3       -----------------------------------------------MAHRARWTMSQVT
BIOB_KLEP7       -----------------------------------------------MAHQPRWTMSQVT
BIOB_SALPB       -----------------------------------------------MARHPRWTLSQVT
BIOB_SALPC       -----------------------------------------------MARHPRWTLSQVT
BIOB_SALNS       -----------------------------------------------MARHPRWTLSQVT
BIOB_SALTY       -----------------------------------------------MARHPRWTLSQVT
BIOB_SALCH       -----------------------------------------------MARHPRWTLSQVT
BIOB_SALA4       -----------------------------------------------MARHPRWTLSQVT
BIOB_SALTI       -----------------------------------------------MARHPRWTLSQVT
BIOB_SALHS       -----------------------------------------------MARHPRWTLSQVT
BIOB_SALPA       -----------------------------------------------MARHPRWTLSQVT
BIOB_SALDC       -----------------------------------------------MARHPRWTLSQVT
BIOB_SALEP       -----------------------------------------------MARHPRWTLSQVT
BIOB_SALSV       -----------------------------------------------MARHPRWTLSQVT
BIOB_SALPK       -----------------------------------------------MARHPRWTLSQVT
BIOB_SALG2       -----------------------------------------------MARHPRWTLSQVT
BIOB_SALAR       -----------------------------------------------MARHPRWTLSQVT
BIOB_CITK8       -----------------------------------------------MAHHPRWTLSQVT
BIOB_SHIB3       -----------------------------------------------MAHRPRWTLSQVA
BIOB_SHIBS       -----------------------------------------------MAHRPRWTLSQVA
BIOB_ECO81       -----------------------------------------------MAHRPRWTLSQVT
BIOB_ECOL6       -----------------------------------------------MAHRPRWTLSQVT
BIOB_ECOK1       -----------------------------------------------MAHRPRWTLSQVT
BIOB_ECOUT       -----------------------------------------------MAHRPRWTLSQVT
BIOB_ECO45       -----------------------------------------------MAHRPRWTLSQVT
BIOB_ECOL5       -----------------------------------------------MAHRPRWTLSQVT
BIOB_SHIF8       -----------------------------------------------MAHRPRWTLSQVT
BIOB_SHIFL       -----------------------------------------------MAHRPRWTLSQVT
BIOB_ECO57       -----------------------------------------------MAHRPRWTLSQVT
BIOB_ECO5E       -----------------------------------------------MAHRPRWTLSQVT
BIOB_SHISS       -----------------------------------------------MAHRPRWTLSQVT
BIOB_ECOLI       -----------------------------------------------MAHRPRWTLSQVT
BIOB_ECOSM       -----------------------------------------------MAHRPRWTLSQVT
BIOB_ECOLU       -----------------------------------------------MAHRPRWTLSQVT
BIOB_ECOLC       -----------------------------------------------MAHRPRWTLSQVT
BIOB_ECOHS       -----------------------------------------------MAHRPRWTLSQVT
BIOB_ECODH       -----------------------------------------------MAHRPRWTLSQVT
BIOB_ECO8A       -----------------------------------------------MAHRPRWTLSQVT
BIOB_ECO7I       -----------------------------------------------MAHRPRWTLSQVT
BIOB_ECO55       -----------------------------------------------MAHRPRWTLSQVT
BIOB_ECO27       -----------------------------------------------MAHRPRWTLSQVT
BIOB_ECO24       -----------------------------------------------MAHRPRWTLSQVT
BIOB_SHIDS       -----------------------------------------------MAHRPRWTLSQVT
BIOB_ECOSE       -----------------------------------------------MAHRPRWTLSQVT
BIOB_ESCF3       -----------------------------------------------MAHHPRWTLSQVT
BIOB_CROS8       -----------------------------------------------MAHLSRWTLSQVT
BIOB_PHOLL       -----------------------------------------------MIERKQWTIKQAQ
BIOB_PROMH       -----------------------------------------------MSTLKRWTLKEAR
BIOB_SODGM       -----------------------------------------------MSTSQRWTQAQAR
BIOB_METI4       ----------------------------------------------------MKDYCAIE
BIOB_BACSU       -----------------------------------MNQWMELADRVLAG--AEVTDEEAL
BIOB_BACNA       -----------------------------------MNQWMELANRVLAG--AEVTDEEAL
BIOB_BACVZ       -----------------------------------MNQWMDLAERVLDG--AEVTNQEAL
BIOB_BACAM       -----------------------------------MNQWMDLAERVLDG--AEVTNQEAL
BIOB_BACLD       -----------------------------------MNQWMELAERVLDG--GEVTEKEAL
BIOB_BACHD       ------------------------------------MNWIQLAQEVIEG--KRISENEAL
BIOB_GEOKA       -----------------------------------MANWLVLAEQVLGG--HELTDEEAL
BIOB_GEOTN       -----------------------------------MPNWLSLAEQVMEG--YELADEEAL
BIOB_ANOFW       ------------------------------------MDWLLLANRVLDG--ADITDDEAL
BIOB_LYSSH       ------------------------------------MNWLQLADEVIAG--KVISDDEAL
BIOB_LYSSC       ------------------------------------MNFLQVAQEVIDG--KIISNEEAL
BIOB_BACAN       -----------------------------MKQVQTKRDWKKLAYDVVEE--KMITKEDAI
BIOB_BACC0       -----------------------------MKQVQTKRDWKKLAYDVVEE--KMITKEDAI
BIOB_BACCZ       -----------------------------MKQVQTKRDWKKLAYDVVEE--KMITKEDAI
BIOB_BACHK       -----------------------------MKQVQTKRDWKKLAYDVVEE--KMITKEDAI
BIOB_BACAH       -----------------------------MKQVQTKRDWKKLAYDVVEE--KMIAKEDAI
BIOB_BACC7       -----------------------------MKQVQTKRDWKKLAYDVVEE--KVITKEDAI
BIOB_BACCQ       -----------------------------MKQVQTKRDWKKLAYDVVEE--KVITKEDAI
BIOB_BACC1       -----------------------------MKQVQTKRDWKKLAYDVVEE--KVITKEDAI
BIOB_BACC2       -----------------------------MKQVQTKRDWKKLAYDVVEE--KMITKEDAI
BIOB_BACC4       -----------------------------MKQVQTKRDWKKLAYDVVEE--KMITKEDAI
BIOB_BACCR       -----------------------------MKQVQTKRDWKKLAYDVVEE--KMITKEDAI
BIOB_BACMK       -----------------------------MKQVQTKRDWKKLAYDVVEE--KMITKEDAI
BIOB_BACCN       -----------------------------MKQIQTKVDWKKIAFEGIEG--KRITKEDAL
BIOB_BACP2       ------------------------------MGKPITLSWEAITEKALKN--ERITLQEGL
BIOB_STAAM       ---------------------------------------MNLAKRILQG--EQLTKETVL
BIOB_STAAN       ---------------------------------------MNLAKRILQG--EQLTKETVL
BIOB_STAAS       ---------------------------------------MNLAKRILQG--EQLTKETVL
BIOB_STAA9       ---------------------------------------MNLAKRILQG--EQLTKETVL
BIOB_STAAB       ---------------------------------------MNLAKRILQG--EQLTKETVL
BIOB_STAAW       ---------------------------------------MNLAKRILQG--EQLTKETVL
BIOB_STAA1       ---------------------------------------MNLAKRILQG--EQLTKETVL
BIOB_STAA2       ---------------------------------------MNLAKRILQG--EQLTKETVL
BIOB_STAAR       ---------------------------------------MNLAKRILQG--EQLTKETVL
BIOB_STAAC       ---------------------------------------MNLAKRILQG--EQLTKETVL
BIOB_STAAT       ---------------------------------------MNLAKRILQG--EQLTKETVL
BIOB_STAA8       ---------------------------------------MNLAKRILQG--EQLTKETVL
BIOB_STAAE       ---------------------------------------MNLAKRILQG--EQLTKETVL
BIOB_STAA3       ---------------------------------------MNLAKRILQG--EQLTKETVL
BIOB_STAEQ       -------------------------------------MTLNLAQRVLNQ--ESLTKDEAI
BIOB_STAES       ---------------------------------------------MLNR--EPLTKEEAL
BIOB_STAHJ       -------------------------------------MRFNLAERILNQ--DVLSKDEAL
BIOB_STACT       ---------------------------------------MDTAHKIING--YALTKQEAY
BIOB_MACCJ       ----------------------------------------MLAQRIING--ENISKEEAL
BIOB_RHOBA       ------MSVADSSAADSVAAPDTADTSSSVGVFSPPGYYDALAQQVLDG--TPITREQAL
BIOB_THEEB       ------MNSISASAIVLWKNTPLPFVVKSYPMSTLTTDWQHLANLALAD--ECLSRDQAR
BIOB_SALRD       -----------------------------------MTAWRTLATQVLNG--TPLSSSQAL
BIOB_STRAW       --------------------------------MDL---LNTLVEKGLRR--ELPSRAEAL
BIOB_STRCO       --------------------------------MDL---LNTLVDKGLRR--ETPTREEAL
BIOB_STRGG       --------------------------------MDL---LNTLVDKGLRR--EPPTREEAL
BIOB2_FRACC      --------------------------------MDLSATLNSLVSKGVSG--QAPTRDEAL
BIOB_NOCSJ       ----------------------------------MQTSFDHLADRILAG--GDATPADAL
BIOB_SACEN       ----------------------------------MNAPFHQLADAILAG--TPATPEDAL
BIOB_KOCRD       ----------------------------------MFKNPAELADRVLAG--TPVTPDEAL
BIOB_RENSM       ---------------------------------------------MLSG--VELSRDEAL
BIOB_CUTAK       -----------------------------------------MTERGLRG--ESITREEAL
BIOB_ACAM1       -----------------------------------------MSEETFP-------QASAL
BIOB_MAGMM       -----------------------------------------MAEAALAG--QLPDAQSGL
BIOB_LEPBA       -------------------------------------MIAEVQEKTISSSPSIISEEEAL
BIOB_LEPBP       -------------------------------------MIAEVQEKTISSSPSIISEEEAL
BIOB_LEPBJ       -------------------------------MSEKMYATLKTAEKIFSEISSVITKQEGL
BIOB_LEPBL       -------------------------------MSEKMYATLKTAEKIFSEISSVITKQEGL
BIOB_LEPIC       --------------------------------------MLKTSEKIFSETPSIITKEEGL
BIOB_LEPIN       --------------------------------------MLKTSEKIFSETPSIITKEEGL
BIOB_THET2       ------------------------------------MAWPDLDPPRLAE--RPLSLQEAL
BIOB_THET8       ------------------------------------MAWPDLDPPRLAE--RPLSLQEAL
BIOB_STRA1       --------------------------------MSFQTNYIHLADEILSGK-TSISYEQAL
BIOB_STRA5       --------------------------------MSFQTNYIHLADEILSGK-TSISYEQAL
BIOB_STRA3       --------------------------------MSFQTNYIHLADEILSGK-TSISYEQAL
BIOB_CORGL       --------------------------------MTIPGTILDTARTQVLEQGIGLNQQQLM
BIOB_CORGB       --------------------------------MTIPATILDTARTQVLEQGIGLNQQQLM
BIOB_COREF       --------------------------------MPNTTSILDTARHQVLGDGIGLDQSQLI
BIOB1_CORDI      ----------------MIIARIFGHLPIATTWEHHVTDILELARTKVLNNGEGLNKEEVL
BIOB_CORU7       ----------------------------MNDISSQTPGILATAREQVLQRGEGLSQEQVL
BIOB_CORJK       ---------MTTAETKPATETGENAGTTGTAGTAATPEILNLARTKVLENGEPLNYEETL
BIOB_MYCBO       -----------------MTQAATRPTNDAGQDGGNNSDILVVARQQVLQRGEGLNQDQVL
BIOB_MYCTU       -----------------MTQAATRPTNDAGQDGGNNSDILVVARQQVLQRGEGLNQDQVL
BIOB_MYCTA       -----------------MTQAATRPTNDAGQDGGNNSDILVVARQQVLQRGEGLNQDQVL
BIOB_MYCTF       -----------------MTQAATRPTNDAGQDGGNNSDILVVARQQVLQRGEGLNQDQVL
BIOB_MYCBP       -----------------MTQAATRPTNDAGQDGGNNSDILVVARQQVLQRGEGLNQDQVL
BIOB_MYCMM       -----------------MTQAATRPSNDAGQDGVTEPDILAVARQQVLERGEGLNQEQVL
BIOB_MYCUA       ----------------MVTQAATRPSNDAGQDGVTEPDILAVARQQVLERGEGLNQEQVL
BIOB_MYCA1       -----------------MTQAATRPTAETGND----EDILAVARRQVLEGGQGLSRDQVL
BIOB_MYCPA       -----------------MTQAATRPTAEIGN-----EDILAVARRQVLEGGQGLSRDQVL
BIOB_MYCLE       -----------------MTQAGTRSTNGDTEN----TDILAQARQQVLERGEGLSRDQVL
BIOB_MYCLB       -----------------MTQAGTRSTNGDTEN----TDILAQARQQVLERGEGLSRDQVL
BIOB_MYCGI       -----------------------------------MSDILAVAREQVLERGVGLDQDQTL
BIOB_MYCVP       -----------------------------------MTDILAVAREQVLVRGEGLDQDQTL
BIOB_MYCSJ       -----------------------------------MSDILAVAREQVLERGVGLNQDQTL
BIOB_MYCSK       -----------------------------------MSDILAVAREQVLERGVGLNQDQTL
BIOB_MYCSS       -----------------------------------MSDILAVAREQVLERGVGLNQDQTL
BIOB_MYCS2       -------------MFEVFRDLFNPQEDGVTQAAINGTDVLDVAREQVLERGVGLDQAQTL
BIOB_MYCA9       ------------------------MTETAELTAATDADVLAVAREQVLEQGVGLTQEQVL
BIOB_NOCFA       -----------------------------MTQAPVQTDILEIAREQVLERGEGLTQDQTL
BIOB_RHOJR       -----------------------------MTSAPVQTDILALAREQVLERGDALNESQVL
BIOB_FRAAA       ----MTAHIAPA-TVPPSAPAAAGQDP---------AALLAHARREVLEAGRGLDEAGVL
BIOB1_FRACC      ----MTASVTTSVTAHPTAPAPASQRPPADQD---GADILTVARREVLDGGRGLDEAGVL
BIOB_FRASN       ----MTAPVTAPTTMPAQTPPTVETDVVTEAPRPLDDDILARARRQVLDEGRGLDEQDVL
BIOB_SALAI       -----------------------------------MPEILDQARTQVLENGVGLDEAGAL
BIOB_SALTO       -----------------------------------MPEILDQARTQVLENGVGLDEAGVL
BIOB_PSECP       -----------------------------MTPTVHTWPILETARTQVLEQGIGLTEDQLV
BIOB_ARTS2       ----------MTIQANVPTGDETSDEASRQTSNEASSEILETARQQVLENGVGLTQAQLE
BIOB_PAEAT       -----------MPVTSTDTVKDMTTRATQAPRETASYAILETAREQVLERGEGLNESQLI
BIOB_ACIC1       -----------------------------------MTDVLASA-ERVLRDGIGLTEPELR
BIOB_CENSY       -------------------------------------MGIAECRDKVLGGGE-LTKDEAR
BIOB_NITMS       ---------------------------------MSTLEFIKECQEKVFSGNH-ITAEDAE
BIOB_HELPY       ------------------------------------------------------------
BIOB_HELPH       ------------------------------------------------------------
BIOB_HELPS       ------------------------------------------------------------
BIOB_HELPG       ------------------------------------------------------------
BIOB_HELPJ       ------------------------------------------------------------
BIOB_HELP2       ------------------------------------------------------------
BIOB_HELAH       ------------------------------------------------------------
BIOB_HELHP       ------------------------------------------------------------
BIOB_WOLSU       ------------------------------------------------------------
BIOB_ARCB4       ------------------------------------------------------------
BIOB_NITSB       ------------------------------------------------------------
BIOB_NAUPA       ------------------------------------------------------------
BIOB_CAMC1       ------------------------------------------------------------
BIOB_CAMC5       ------------------------------------------------------------
BIOB_CAMFF       ------------------------------------------------------------
BIOB_CAMJ8       ------------------------------------------------------------
BIOB_CAMJJ       ------------------------------------------------------------
BIOB_CAMJE       ------------------------------------------------------------
BIOB_CAMJR       ------------------------------------------------------------
BIOB_CAMJD       ------------------------------------------------------------
BIOB_CAMLR       ------------------------------------------------------------
BIOB_SULDN       ------------------------------------------------------------
BIOB_SULNB       ------------------------------------------------------------
BIOB_METM6       -----------------------------MREIKLNPDSLEIYEKSD---SGKLNRNDLI
BIOB_METMP       -----------------------------MKEIKLNSDSLEIYEKSV---SEKLNRNDFI
BIOB_METM5       -----------------------------MKEIKLNSDSLEIYEKSA---SKKLNRNDLI
BIOB_METM7       -----------------------------MKEIELNSDSLEIYEKSA---SEKLNKKDLV
BIOB_METVS       -----------------------------MNERKLNKDFLEIYEMSI---SGKIKKEDAL
BIOB_META3       -----------------------------MEEF---TGIGYFYKKSI---KNQLDKKDAS
BIOB_METJA       ---------------------------------MIFMEIETFLKKSL---KNKIDFDDAL
BIOB_CALBD       -----------------------------MLNFLQSVQFVKEVEKKIIEYDKDIAFNEAI
BIOB_CALS8       -----------------------------MLNFLQSVQFAKEIEKKIIEYEQDIDISEAT
BIOB_AQUAE       -------------------------------MDKVERRLYELYEKAI--NYEPLSKEEAL
BIOB_HYDS0       ----------------------------------MEQVFFDIYQKAK--NDE-ISKEEAL
BIOB_PERMH       ----------------------------------MEDFIKGLAERVL--EGEKLSKEDGL
BIOB_SULSY       -----------------------------------MEILNNLAERVI--SGEKLTKEEGL
BIOB_UNCTG       --------------------------------------MENLILEIIS--GKQVTKEEAL
BIOB_THENN       ------------------------------------------------------------
BIOB_THEP1       ---------------------------------------------------MKLKEILSM
BIOB_THEYD       --------------------------------------MKPEIQSSLEYYSDLIEHMDDS
BIOB_DESDA       -------------------------------------------------MTELYTAANPA
BIOB_ALKMQ       -------------------------MDIK-------------KLPKEIIEGRRLKREEDL
BIOB_CLOB8       ---------------------------ME-------------KLAEEIINGRRLTRSDDL
BIOB_CLOB1       ---------------------------MSNII----------KYKKKILNGDLLTKEE-V
BIOB_CLOBH       ---------------------------MSNII----------KYKKKILNGDLLTKEE-V
BIOB_CLOBK       ---------------------------MSNII----------KYKKKILNGDLLTKEE-V
BIOB_CLOBL       ---------------------------MSNII----------KYKKKILNGDLLTKEE-V
BIOB_CLOBM       ---------------------------MSNII----------KYKKKILNGDLLTKEE-V
BIOB_CLOBA       ---------------------------MNIID----------RFKEKILSGELISKKE-A
BIOB_CLOBB       ---------------------------MNIVD----------KFKEKILSGELISKKE-A
BIOB_BRAHW       ---------------------------MSNIDLIIKKEISLDELREKIIKGYDITKEE-A
BIOB_AKKM8       ---------------------------MSLTS----------SLLSRVLGGGSCSREE-L
BIOB2_CORDI      ---------------------------MTATLNTVQ------DLEASVLAGTAITRDE-A
BIOB_CAMHC       ----------------------------MDLQ----------KIKNQILDGRNLCIED-A
BIOB_FUSNN       --MLKEKNSAGGGKFNFFNFLKEKDNNQAEPS----------NVKEFISYLKNKIINE-K
BIOB_CLOD6       --------------------------MEKYII----------KLKNKVLREKEISYEE-A
BIOB_HUNT2       ---------------------------MDFLT----------LMENKLDEGRMITFEE-A
BIOB_CLOK1       --------------------------MKEFIK----------YLEKNILKEEDIGFKE-A
BIOB_CLOTE       --------------------------MKNIIL----------EIEEKIYSDEDITFNE-A
BIOB_CLONN       ----------------------------MVNR----------LLDKIINEGYDISYDE-A
BIOB_CLOP1       ---------------------------MDFVL----------KMKDKSLKNRKLTREE-G
BIOB_CLOPE       ---------------------------MDFIL----------KMKDKSLKNIKLTREE-G
BIOB_PORG3       ----------------------------MIQ-----------TIENRLINGGEPTFEE-A
BIOB_PORGI       ----------------------------MIQ-----------TIENRLINGGELTLEE-A
BIOB_PARD8       ---------------------------MTIE-----------EAKQHILEGGKITEEQ-A
BIOB_CROS5       --MIQFIRPKTASGKTIVVQLSASPPQTPPPTDTNALKNWLEILSQRIINGDRLTKTEAL
BIOB_RIPO1       --MVQ---------APLSPSLLQTQSISQPPQETEALKAWLEELTQKIIEGDRINKSEAL
BIOB_GLOC7       -----------------MVQASLSSPITP-PKDTQALQEWLHQLADRIISGYRITKVEAL
BIOB_MICAN       -----------------MVQVSTHSATQSIPMEGEALKNWLQTRANQIIAGDRLSKQEAL
BIOB_TRIEI       ------MIAVLKTPLSNHIKANTKALFSSLPKTKNELEISLDDLAKQIISGYRLSREEAI
BIOB_SYNY3       ---------------MVLASSRPPSPTNSPADRQGTLQAWLTGLSQRIIDGDRLTREEAL
BIOB_CYAP4       ------------MVATPLPPTQSPRHPSLQELSLSELQTWLDELAERIITGETLDRATAI
BIOB_SYNP2       ------------MVQVPIKPTPQTPAPTTAIPNGPALEAWLNDWAQRIINGDRLTRTEAL
BIOB_CARHZ       ------------------------------------MFNRIVALTQKVLDGGQINQIEAL
BIOB_CLOAB       ---------------------------------MKNQWNNILSIGEKVLNGEKITADEAL
BIOB_DESAP       -------------------------------MNLQEKTAWITHVARRVIDGDTLSFEEAT
BIOB_PELTS       ---------------------------------------MFNELVKKIKSGLEITFEEAL
BIOB_HELMI       ------------------------------------MQSIIRQTEAALFAGAVLDRETAG
BIOB_DESPS       ----------------------------MYRGLFLISEAVISRIEKKVLSGGKILFAEAC
BIOB_DESRM       ---------------------------------------MFSEIQEKIHSGEGITFQEAA
BIOB_ANAD2       ----------------------------------------MCETASRTLPPGITPISGD-
BIOB_ANASK       ----------------------------------------MCETASTTLPPGITPISGD-
BIOB_ANADE       ----------------------------------------MCETASRTLPPGIEPISGD-
BIOB_ANADF       ----------------------------------------MCETA-RTLPPDIVPITVE-
BIOB_DESVH       ---------------------MHNLLENLRRRLLAQRTPEPLPPTSQGLARPSHDVVRGP
BIOB_DESVV       ---------------------MHNLLENLRRRLLAQRTPEPLPPTSQGLARPSHDVVRGP
BIOB_DESVM       ---------------------MNPLLE----RLCARLSDTIPPGTETPYASPSHARTEEA
BIOB_DESAG       ------------------------------------MTINPDDLCRRIMADPEACATE--
BIOB_GEOMG       ------------------------------------MNKSLETLAGRIIAGE--QLSVE-
BIOB_GEOSL       ------------------------------------MINYPESLANRIIKGS--TLDKD-
BIOB_GEODF       ------------------------------------MKMNLEKLGERIIEGG--DILVE-
BIOB_GEOUR       ------------------------------------MENTIEALTGRIINGE--AITHA-
BIOB_GEOBB       ------------------------------------MEKMINDIAHRIIAGG--SITEA-
BIOB_PELPD       ------------------------------------MRSFILACADRVVEGA--TLGAE-
BIOB_GEOLS       ---------------------------------MIITDTPIDTLAGSILDGA--SISSE-
BIOB_PELCD       ------------------------------------MRNDIVKIVDRIIQGG--RLSEA-
BIOB_SYNAS       ----------------------------------MILDSTVNMLAQKILDEGPQALSFQ-
BIOB_DESAL       -----------------------------------MDLKKCLDMAEAAKAGQLPEISDL-
BIOB_DESOH       ----------------------------------MLHPIQLTDTARRIQAGETPDDDTL-
BIOB_SYNFM       -----------------------------------MKPSTVKNLRRAADRGE--PVSEE-
BIOB_CHLCH       -----------------------------------MLHPAIESAYRVLATGEPLTHGEAL
BIOB_PELPB       -------------------------------MDYRTLHPQIAAAYRVLETGSPISQAEAL
BIOB_CHLP8       --------------------------------MSSRLHPDIERAYRVLETGEPVSLELAS
BIOB_CHLTE       --------------------------------MKSRLHPDIEKAYAVLDTGEPLSLELAS
BIOB_CHLL2       -------------------------------MTSSVIHQAVIDAYRVLDTGEPLDRETAL
BIOB_PELLD       -------------------------------MGVPPLHPEISAAYSVLETGEPIGREAAL
BIOB_CHLPM       -------------------------------MDIKTLHPAIAAAYRVLETGEPISLEEAE
BIOB_CHLPD       -------------------------------MRPVPLHPDILQAYAVLETGEPVCRELAF
BIOB_CHLPB       --------------------------------MTVEMNKSIVKAYSVLETGEPLPFDVAV
BIOB_PROA2       -------------------------------MNGAVIDPLIQEAYGVLETGRSVSYDLAT
BIOB_NATPD       -------------------------------MVYETGNETVDDAVQRALDGERLDRTDGL
                                                                             

BIOB_FRAT1       EIYSRP---------------------------LTELILQALEIHNKNFG-----NDIEL
BIOB_FRATT       EIYSRP---------------------------LTELILQALEIHNKNFG-----NDIEL
BIOB_FRATN       EIYSRP---------------------------LTELILQALEIHNKNFG-----NDIEL
BIOB_FRATW       EIYSRP---------------------------LTELILQALEIHNKNFG-----NDIEL
BIOB_FRATM       EIYSRP---------------------------LTELILQALEIHNKNFG-----NDIEL
BIOB_FRATF       EIYLRP---------------------------LTELILKALEIHNKNFG-----NDIEL
BIOB_FRATH       EIYLRP---------------------------LTELILKALEIHNKNFG-----NDIEL
BIOB_FRATO       EIYLRP---------------------------LTELILKALEIHNKNFG-----NDIEL
BIOB_FRAP2       EIYSRP---------------------------LTELILQALEIHNKNFG-----NDIEL
BIOB_COXB1       KLFELP---------------------------FFELLYKAYETHRSHFD----VRDMEL
BIOB_COXB2       KLFELP---------------------------FFELLYKAYETHRSHFD----VRDMEL
BIOB_COXBN       KLFELP---------------------------FFELLYKAYETHRSHFD----VRDMEL
BIOB_COXBR       KLFELP---------------------------FFELLYKAYETHRSHFD----VRDMEL
BIOB_COXBU       KLFELP---------------------------FFELLYKAYETHRSHFD----VRDMEL
BIOB_LAWIP       QIFNLP---------------------------LLELLYKAQTIHRKYFD----PNKIQI
BIOB_RICFE       EIFSFS---------------------------FMELVYQAQTIHRANFD----PNKIQI
BIOB_NEOSM       ELFHLP---------------------------FLDLLYSAQHVHRENFP----HNEVQL
BIOB_ANAMF       ELFRMP---------------------------FSDLILKAHSVHVQNFR----NNEVQV
BIOB_ANAMM       ELFRMP---------------------------FSDLILKAHSVHVQNFR----NNEVQV
BIOB_ANAPZ       ELFGLP---------------------------FNDLLFKAHMVHREYFR----HNEVQV
BIOB_EHRCJ       ELFHTA---------------------------FNDLILQSHLLHRQFFS----NNEVQI
BIOB_EHRCR       ELFNTP---------------------------FNDLILRSHLTHRQFFN----NNEIQL
BIOB_EHRRG       ELFNIP---------------------------FNDLILNAHLIHRKFFN----SNEIQI
BIOB_EHRRW       ELFNLP---------------------------FNDLILNAHLIHRKFFN----SNEIQI
BIOB_AGRRK       ALHNLP---------------------------LLELVGRANAVHRMHHD----PNKVQK
BIOB_AGRVS       TLHNLP---------------------------LLELIGHANAVHGRHHN----PNVVQK
BIOB_RUEPO       ALLRLP---------------------------LLDLVGRANGVHRAHHA----PDDIQK
BIOB_BEII9       ALYDLP---------------------------LLELIARASQIHALYHD----PNDLQK
BIOB_METSB       EIYKSP---------------------------LLELIARANAIHREFHD----VNDVQK
BIOB_ZYMMO       AIYNLP---------------------------LLELIGRANSVHRRYHD----AGHLQK
BIOB_METC4       AIHDMP---------------------------LLDLVHRAGVVHRAHND----PADIQR
BIOB_METEP       AIHDMP---------------------------LLDLVHRAGVVHRAHND----PADIQR
BIOB_METPB       AIHDMP---------------------------LLDLVHRAGTVHRAHND----PADIQR
BIOB_METRJ       AIHDLP---------------------------LMDLVFRAAQVHRRHND----PADIQR
BIOB_METNO       AIYDLP---------------------------LLDLVHRASLVHRAHHD----PADIQR
BIOB_METS4       AIHDMP---------------------------LLDLVHRASLVHRAHHD----PSDIQR
BIOB_PROM2       EILNMP---------------------------LIDLMWESQTIHRKFNK-----YDIQL
BIOB_PROM9       EILDMP---------------------------LIDLMWESQTVHRKFNK-----YNIQL
BIOB_PROMS       EILNMP---------------------------LIDLMWESQIVHRKFNS-----YNIQL
BIOB_PROM0       QILNMP---------------------------LIDLMWEAQIVHRKFNK-----YDIQL
BIOB_PROM5       EILNYP---------------------------LVDLMWEAQIIHRRFNE-----YKVQL
BIOB_PROMP       EILNYP---------------------------LIDLMWEAQIIHRRFNQ-----YKVQL
BIOB_PROM1       EILDLP---------------------------LMDLLWRAQIVHRSYNP----GYKVQL
BIOB_PROMT       EILDLP---------------------------LMDLLWRAQIVHRSYNP----GYKVQL
BIOB_PROM4       SLLQKP---------------------------LMDLLWDAQRVHRLTNP----GYKVQL
BIOB_PROMA       EILEKP---------------------------LFELLWEAQNVHRSVNP----EYKVQL
BIOB_PROM3       ELLERP---------------------------LMDLLWQAQLVHRTANP----GYRVQL
BIOB_PROMM       ELLERP---------------------------LMDLLWQAQLVHRTANP----GYRVQL
BIOB_SYNPW       ALLQSP---------------------------LMDLLWKAQAVHRSANP----GYKVQL
BIOB_SYNS3       ALLDLP---------------------------LMDLLWRAQGVHRASNP----GYHVQL
BIOB_SYNPX       ALLELP---------------------------LMELLWQAQYVHRAANP----GYRVQL
BIOB_SYNSC       TLLELP---------------------------LMELLWEAQTVHRKANP----GYRVQL
BIOB_SYNS9       TLLELP---------------------------LMDLLWQAQTVHRDANP----GYRVQL
BIOB_SYNR3       ALLELP---------------------------LVDLLWHAQQVHRDAHPA---GYHVQL
BIOB_SYNE7       DLLNTP---------------------------LLELVHRAQTVHRDYQP----ANAIQL
BIOB_SYNP6       DLLNTP---------------------------LLELVHRAQTVHRDYQP----ANAIQL
BIOB_SORC5       ALHDLP---------------------------LFELIDRARAVHRAFHG----EHEVQL
BIOB_MYXXD       ALYELP---------------------------LLDLVHKAQTVHRAVFV----DNKVQL
BIOB_GLOVI       RIYHQP---------------------------LPDLLFEAQRVHRAHHD----PREVQL
BIOB_SYNJA       EIYYRP---------------------------LLQLVYEAQTVHRQHHP----PGRVQL
BIOB_NOSS1       AVYDTP---------------------------LLELIYQAASVHRQFHN----PKQIQV
BIOB_TRIV2       AVYDMP---------------------------LLELIYQAASVHRQFHN----PKQIQV
BIOB_NOSP7       AIYNTP---------------------------LLELIYQAASVHRQYHD----PTKIQV
BIOB_CHLAB       EVYNTP---------------------------IFELIHRANAILRSNFP----HSELQT
BIOB_CHLFF       EVYNTP---------------------------IFELIHRANAILRSNFP----HSELQT
BIOB_CHLPN       EIYHTP---------------------------VFELIHKANAILRSNFL----HSELQT
BIOB_FLAJ1       AIYNKP---------------------------LMDLLYEAATIHRQQHD----PNVVQV
BIOB_FLAPJ       AIYNKP---------------------------LMDLLYEAASIHREYHD----PNVVQV
BIOB_GRAFK       EIYNKP---------------------------FMELLYDAATIHREHHD----PNTVQV
BIOB_CYTH3       AIYNSP---------------------------ILDLMYRGATVHREFHD----PQEVQV
BIOB_HYDCU       DIMNQP---------------------------FNDLMFQAQTVHRQHFN----PNEIQT
BIOB_BRUA1       AIYNLP---------------------------FNDLLFRAHGLHRENFD----PNRIQL
BIOB_BRUA2       AIYNLP---------------------------FNDLLFRAHGLHRENFD----PNRIQL
BIOB_BRUAB       AIYNLP---------------------------FNDLLFRAHGLHRENFD----PNRIQL
BIOB_BRUC2       AIYNLP---------------------------FNDLLFRAHGLHRENFD----PNRIQL
BIOB_BRUMB       AIYNLP---------------------------FNDLLFRAHGLHRENFD----PNRIQL
BIOB_BRUME       AIYNLP---------------------------FNDLLFRAHGLHRENFD----PNRIQL
BIOB_BRUSI       AIYNLP---------------------------FNDLLFRAHGLHRENFD----PNRIQL
BIOB_BRUSU       AIYNLP---------------------------FNDLLFRAHGLHRENFD----PNRIQL
BIOB_BRUO2       AIYNLP---------------------------FNDLLFRAHGLHRENFD----PNRIQL
BIOB_OCHA4       LLYDLP---------------------------FNDLLFEAQNVHRANFD----PNRVQL
BIOB_AGRFC       IIYNLP---------------------------FNDLLFRAQQVHRCHFD----ANAIQM
BIOB2_PARDP      EIYHQP---------------------------LMDLLFQAQTVHRAHFD----PNVVQC
BIOB_LEGPA       AIYQQP---------------------------FNDLLYQAHTIHRTYHD----PNSLQF
BIOB_LEGPH       AIYQQP---------------------------FNDLLYQAHTIHRTYHD----PNSLQF
BIOB_LEGPL       AIYQQP---------------------------FNDLLYQAHAIHRTYHD----PNSLQF
BIOB_LEGPC       AIYQQP---------------------------FNDLLYQAHTIHRTYHD----PNSLQF
BIOB_RUTMC       ILFSLP---------------------------FNDLLFQAHRIHRQNFD----PNQIQV
BIOB_VESOH       ALFTLP---------------------------FNDLLFQAHSIHRKNFD----PNQVQI
BIOB_HAEI8       ALFETP---------------------------FLELVYRATQVHRKHFN----PRAIQL
BIOB_HAEIE       ALFETP---------------------------FLELVYRATQVHRKHFN----PRAIQL
BIOB_HAEIN       ALFETP---------------------------FLELVYRATQVHRKHFN----PRAIQL
BIOB_HAEIG       ALFETP---------------------------FLELVYRAAQIHRKHFN----SRTIQL
BIOB_HAES1       ALFETP---------------------------FLELVYQAAQVHRKHFN----PQTIQL
BIOB_HISS2       ALFETP---------------------------FLELVYQAAQVHRKHFN----PQTIQL
BIOB_PASMU       ALFETP---------------------------FLDLVYRAAQVHRENFN----PKAIQL
BIOB_ACTSZ       ALFETP---------------------------FLELVHRAAIVHREHFN----PQAVQL
BIOB_MANSM       ALFETP---------------------------FLELVHRAALVHRENFN----PQAIQL
BIOB_ACTP7       ELFEMP---------------------------FMELIFKAAQVHREHFD----PQAIQL
BIOB_ACTPJ       ELFEMP---------------------------FMELIFKAAQVHREHFD----PQAIQL
BIOB_ACTP2       ELFEMP---------------------------FMELIFKAAQVHREHFD----PQAIQL
BIOB_HAEDU       ELFAMP---------------------------FMELVFKAAQVHREHFD----PQAIQL
BIOB_HAEPS       ELFDLP---------------------------FMDLVFRAAEIHRQHFD----PNAIQL
BIOB_NEIG1       ALFGLP---------------------------FLELVYQAAEVHRQNFN----PREIQL
BIOB_NEIG2       ALFGLP---------------------------FLELVYQAAEVHRQNFN----PREIQL
BIOB_NEIM0       ALFGLP---------------------------FLELVHQAAEVHRQNFN----PREIQL
BIOB_NEIMF       ALFGLP---------------------------FLELVHQAAEVHRQNFN----PREIQL
BIOB_NEIMA       ALFGLP---------------------------FLDLIYQAAEIHRQNFN----PREIQL
BIOB_NEIMB       ALFGLP---------------------------FLDLIYQAAEIHRQNFN----PREIQL
BIOB_CHRVO       ALLGLP---------------------------FMELVFRAAEIHRQFFD----PTKVQL
BIOB_METSK       ALFELP---------------------------FSDLMHRAQSVHRENFD----PNGVQV
BIOB_METFK       ALFELP---------------------------FSDLMHRAQSVHRENFD----PNGVQV
BIOB_THIDA       ALFALP---------------------------FADLMYQAQGVHRAHFD----PNRIQL
BIOB_NITEC       SLLGLP---------------------------FNDLIFQAQTVHRQYHD----ANGVQL
BIOB_NITEU       SLLDLP---------------------------FSDLIFQAQTVHRQYHD----ANAVQL
BIOB_NITMU       ALLDLP---------------------------FSDLIHRAQLVHRQYHD----PNGVQL
BIOB_ACISJ       ELLDLP---------------------------FMELLWRAQATHRTHWP----QGDIEL
BIOB_ACIET       ELLDLP---------------------------FMELLWRAQATHRAHWP----QGDIEL
BIOB_DELAS       ELLDKP---------------------------FMDLMFQAQSVHREHWP----AGDIEL
BIOB_ACIAC       ELLDLP---------------------------FMELLWRAQSVHREHWP----AGDVEL
BIOB_METPP       ALFALP---------------------------FNDLIFRAQQVHREHFD----ANAVQR
BIOB1_POLSJ      ALFNLP---------------------------FPELMHRAQTVHRENFD----PTRVEF
BIOB_HERAR       ALFNLP---------------------------FNELMFRAQTVHREHFD----PSEVEL
BIOB_JANMA       ALFNLP---------------------------FNDLIFRAQTVHRENFD----PTEVEL
BIOB_RHOFT       ALFELP---------------------------FNDLMFQAQQTHRAHFP----KGDVEL
BIOB_POLAQ       ALFALP---------------------------FNELMFKAQQAHEANFP----EGDVEL
BIOB_BORBR       ELFELP---------------------------FLDLLHRAQQVHRQHFD----ANTVQL
BIOB_BORPA       ELFELP---------------------------FLDLLHRAQQVHRQHFD----ANTVQL
BIOB_BORPE       ELFELP---------------------------FLDLLHRAQQVHRQHFD----ANTVQL
BIOB_BORPD       ALYELP---------------------------FMDLLYRAQQVHRQHFD----ASAIQL
BIOB_BORA1       ALYELP---------------------------FPELLHRAQSVHREHFD----ATEIQL
BIOB_BURCM       ALFELP---------------------------FNDLIFRAQQVHREHFD----ANAVQL
BIOB_BURL3       ALFELP---------------------------FNDLLFRAQQVHREHFD----ANAVQL
BIOB_BURA4       ALFELP---------------------------FNDLMFRAQQVHREHFD----ANAVQL
BIOB_BURVG       ALFELP---------------------------FNDLMFRAQQVHREHFD----ANAVQL
BIOB_BURM1       ALFELP---------------------------FNDLIFRAQQVHREHFD----ANAVQL
BIOB_BURCA       ALFELP---------------------------FNDLMFRAQQVHREHFD----ANAVQL
BIOB_BURCC       ALFELP---------------------------FNDLMFRAQQVHREHFD----ANAVQL
BIOB_BURCH       ALFELP---------------------------FNDLMFRAQQVHREHFD----ANAVQL
BIOB_BURCJ       ALFELP---------------------------FNDLMFRAQQVHREHFD----ANAVQL
BIOB_BURM7       ALYELP---------------------------FNDLLFRAQQTHREHFD----ANAIQL
BIOB_BURM9       ALYELP---------------------------FNDLLFRAQQTHREHFD----ANAIQL
BIOB_BURP6       ALYELP---------------------------FNDLLFRAQQTHREHFD----ANAIQL
BIOB_BURMA       ALYELP---------------------------FNDLLFRAQQTHREHFD----ANAIQL
BIOB_BURMS       ALYELP---------------------------FNDLLFRAQQTHREHFD----ANAIQL
BIOB_BURP0       ALYELP---------------------------FNDLLFRAQQTHREHFD----ANAIQL
BIOB_BURPS       ALYELP---------------------------FNDLLFRAQQTHREHFD----ANAIQL
BIOB_BURP1       ALYELP---------------------------FNDLLFRAQQTHREHFD----ANAIQL
BIOB_BURTA       ALYELP---------------------------FNDLLFRAQQTHREHFD----ANAIQL
BIOB_PARPJ       ALYELP---------------------------FNDLMFKAQQTHREHFD----ANTVQL
BIOB_PARXL       SLYELP---------------------------FNDLMFQAQQTHREHFD----ANTVQL
BIOB_PARP8       ALYELP---------------------------FNDLLFRAQQVHREHFD----ANTVQL
BIOB_CUPTR       ALFALP---------------------------FNDLLFRAQQVHREHFD----ANTVQL
BIOB_CUPNH       ALFALP---------------------------FNDLLFRAQQVHREHFD----ANTVQL
BIOB_CUPPJ       ALFALP---------------------------FNDLLFRAQQVHRENFD----ANTVQL
BIOB_CUPMC       ALFALP---------------------------FNDLLFRAQQVHREHFD----ANTVQL
BIOB_POLNA       ALYALP---------------------------FMDLLFRAQQVHRANFD----ANQVQL
BIOB2_POLSJ      ALYELP---------------------------FMDLLFRAQQVHREHFD----ANEVQL
BIOB_LEPCP       ALYALP---------------------------FMDLLFQAQQVHRAHFD----ANEVQL
BIOB_RALPJ       ALFALP---------------------------FNDLLFQAQQVHRANFD----ANAVQL
BIOB_RALSO       ALFALP---------------------------FNDLLFQAQQVHRAHFD----ANAVQL
BIOB_AZOSB       ALFDLP---------------------------FLDLVFQAQQVHRAHFA----ANEVQR
BIOB_AROAE       ELFEQP---------------------------FMDLLFRAQQVHRAHFD----PNAVQR
BIOB_DECAR       GLYDMP---------------------------LMDLIWRAQGVHRENFD----PNAIQR
BIOB_GLUDA       ALIALP---------------------------FPELMFRAQSVHRARFD----PTEIQI
BIOB_GLUOX       ALISLP---------------------------FPELMYRAQTLHRRYFD----PTKVQI
BIOB_GRABC       SLLDLP---------------------------FPELLFRAAAIHRACFD----PREVQI
BIOB_ACICJ       ALLALP---------------------------LPELIFQAQTVHRQHFD----PTQVQI
BIOB_STRM5       ALFDLP---------------------------FPELLFRAAAVHREHFD----PAQVQV
BIOB_STRMK       ALFDLP---------------------------FPELLFRAAAVHREHFD----PAQVQV
BIOB_XANAC       ALFDLP---------------------------FPELLHRAASVHRAHFD----PAQVQV
BIOB_XANC5       ALFDLP---------------------------FPELLHRAASVHRAHFD----PAQVQV
BIOB_XANOM       ALFDLP---------------------------FPELLHRAASVHRAHFD----PAEVQV
BIOB_XANOP       ALFDLP---------------------------FPELLHRAASVHRAHFD----PAEVQV
BIOB_XANOR       ALFDLP---------------------------FPELLHRAASVHRAHFD----PAEVQV
BIOB_XANC8       ALFALP---------------------------FPELLHRAASVHRAHFD----PAEVQV
BIOB_XANCB       ALFALP---------------------------FPELLHRAASVHRAHFD----PAEVQV
BIOB_XANCP       ALFALP---------------------------FPELLHRAASVHRAHFD----PAEVQV
BIOB_XYLF2       ALFDLS---------------------------LPELLYRAASVHRQHFD----PAEIQV
BIOB_XYLFT       ALFDLS---------------------------LPELLYRAASVHRQHFD----PAEIQV
BIOB_XYLFM       ALFDLS---------------------------LPELLYRAASVHRQHFD----PAEIQV
BIOB_XYLFA       ALFDLS---------------------------LPELLYRAASVHRQHFD----PAEIQV
BIOB_AZOC5       ALYDLP---------------------------LPELMFRAQAVHRAHFD----ACSVET
BIOB_XANP2       ALYDLP---------------------------FPELMFRAQSVHRRHFD----PTTVET
BIOB_RHOS1       AIHALP---------------------------FPELMHRAQTLHRAHFD----PTAIET
BIOB_RHOS4       AIHALP---------------------------FPELMHRAQTLHRAHFD----PTAIET
BIOB_RHOSK       AIHALP---------------------------FPDLMHRAQTLHRAHFD----PTAIET
BIOB1_PARDP      AIHALP---------------------------FADLMHRAQTLHRAHFD----PNAIET
BIOB_BRASB       ALYALP---------------------------FPDLMFRAQSVHRRHFD----PTRLET
BIOB_BRASO       VLYALP---------------------------FPDLMFLAQATHRRHFD----PTRLET
BIOB_NITHX       TLYNLP---------------------------FADLIFQAQTLHRRHFD----PNHVET
BIOB_NITWN       TLYTTP---------------------------FPDLLFQAQTIHRRHFD----PNHVET
BIOB_OLICO       ALYDLP---------------------------FPDLVFQAQSIHRTSFD----PNHVET
BIOB_BRADU       ALYDLP---------------------------FADLMLQAQRAHRKNFD----PNHVET
BIOB_RHOPA       AIYHAP---------------------------FADLMFRAQTIHRQTFD----PNQVQC
BIOB_RHOPT       AIYHAP---------------------------FADLMFRAQTIHRQTFD----PNQVQC
BIOB_RHOPS       AIYHAP---------------------------FADLIFRAQTIHRQSFD----ANAVQC
BIOB_RHOP2       AIYNLP---------------------------FADLIFRAQTIHRQSFD----ANEVQC
BIOB_RHOP5       AIYHAP---------------------------FADLMFRAQTIHRQSFD----PNAVQC
BIOB_RHOPB       AIYYAP---------------------------FMDLMFRAATIHRQSFD----PNKVQC
BIOB_CAUVN       ALFALP---------------------------FMELVFQAANVHRAHFD----PSEIQL
BIOB_CAUVC       ALFALP---------------------------FMELVFQAANVHRAHFD----PSEIQL
BIOB_CAUSK       ALFDLP---------------------------FMELMFQAATVHRAWFD----PSELQL
BIOB_PHEZH       ALFELP---------------------------FTELVFRAAEVHRRWFD----PTELQL
BIOB_HYPNA       AIYDLP---------------------------LDQLFARALAVKAAHWA----DGAVQK
BIOB_MARMM       EIYRAP---------------------------FNDLIFAAQSVHRQCHP----ANQVQT
BIOB_ERYLH       ALFEQP---------------------------FTELLFQAATVHRAYHP----PEQVQL
BIOB_NOVAD       ALFDLP---------------------------FTELLFRAAEVHRAHHR----AGEVQL
BIOB_SPHAL       ALFDLP---------------------------FDELMWEAQGVHRRHHA----RGEIQL
BIOB_SPHWW       ALFDLP---------------------------FNDLLWQAQAAHRAAHA----ANEVQL
BIOB_PARL1       ALFDLP---------------------------FNDLLFEAQLVHRRWFK----ADEVQM
BIOB_ACIF2       EIYARP---------------------------FNDLIYAAQQVHRLHFD----PNAIQC
BIOB_ACIF5       EIYARP---------------------------FNDLIYAAQQVHRLHFD----PNAIQC
BIOB_NITOC       ALFELP---------------------------FVELIYRAQTVHRQHFN----PNQVQM
BIOB_THISH       ELMGRP---------------------------FNDLLFAAHTVHRAHFD----PNAVQV
BIOB_ALKEH       ALFEQP---------------------------FNDLLHQAQTTHRAHFD----PNTVQV
BIOB_HALHL       ALFELP---------------------------LPELLFRAQEVHRRHFN----PGQVQA
BIOB_ALCBS       ALFALP---------------------------FNDLLFQAAALHRAHFD----PNAVQV
BIOB_METCA       ALFALP---------------------------FNELLFQAQTIHRRHFD----PNEVQV
BIOB_MAGSA       ALFALP---------------------------FNDLMFEAQKVHRAHFD----ANRVQV
BIOB_ACIB3       ALYEQP---------------------------FLDLVFKAQQVHREHFT----ANTIQV
BIOB_ACIB5       ALYEQP---------------------------FLDLVFKAQQVHREHFT----ANTIQV
BIOB_ACIBY       ALYEQP---------------------------FLDLVFKAQQVHREHFT----ANTIQV
BIOB_ACIBC       ALYEQP---------------------------FLDLVFKAQQVHREHFT----ANTIQV
BIOB_ACIBT       ALYEQP---------------------------FLDLVFKAQQVHREHFT----ANTIQV
BIOB_ACIBS       ALYEQP---------------------------FLDLVFKAQQVHREHFT----ANTIQV
BIOB_ACICA       ALYDQP---------------------------FLDLVFEAQSVHRQHFQ----ANTIQV
BIOB_ACIAD       ALYDQP---------------------------FLDLVFQAQQVHREHFS----ANTIQV
BIOB_PSYA2       QLFDLP---------------------------LMDLLLQAQTIHRQNFT----ANEVQI
BIOB_PSYCK       QLFDLP---------------------------LMDLLLQAQTIHRQNFN----ANEVQI
BIOB_PSYWF       NLFDMP---------------------------FMDLLLKAQGVHRQHFT----ANAVQI
BIOB_CELJU       ALFELP---------------------------FSDLMFQAQSVHRAWFN----PNEVQV
BIOB_SACD2       ALFALP---------------------------FNDLLFEAQTIHRQFFN----ANEVQV
BIOB_HAHCH       ALFALP---------------------------FNDLLFQAQVTHRRNFD----PNEVQV
BIOB_MARHV       ELFNLP---------------------------FNDLLFRAQSIHREHFD----PNEVQV
BIOB_CHRSD       ALFALP---------------------------FNDLLFRAQQVHRAHFD----PNAVQV
BIOB_PSE14       ALFVQP---------------------------FNDLLFQAQTVHRAHFD----ANRVQV
BIOB_PSEU2       ALFVQP---------------------------FNDLLFQAQTVHRAHFD----ANRVQV
BIOB_PSESM       ALFVQP---------------------------FNDLLFQAQTLHRAHFD----ANRVQV
BIOB_PSEF5       ALFVQP---------------------------FNDLLFQAQTVHRAHFD----ANRVQV
BIOB_PSEPF       ALFVQP---------------------------FNDLLFQAQTVHRAHFD----ANRVQV
BIOB_PSEP1       ALFQQP---------------------------FNDLLFQAQTVHRAHFN----PNRVQV
BIOB_PSEPK       ALFQQP---------------------------FNDLLFQAQTVHRAHFD----PNRVQV
BIOB_PSEPG       ALFQQP---------------------------FNDLLFQAQTVHRAHFD----PNRVQV
BIOB_PSEPW       ALFQLP---------------------------FNDLLFQAQTVHRAHFD----PNRVQV
BIOB_PSEE4       ALFQQP---------------------------FNDLLFQAQTMHRAYFD----PNRVQV
BIOB_PSEA8       ALFEQP---------------------------FNDLLFQAQTVHRAHFD----PNRVQV
BIOB_PSEAE       ALFEQP---------------------------FNDLLFQAQTVHRAHFD----PNRVQV
BIOB_PSEAB       ALFEQP---------------------------FNDLLFQAQTVHRAYFD----PNRVQV
BIOB_PSEA7       ALFEQP---------------------------FNDLLFQAQTVHRAYFD----PNRVQV
BIOB_PSEMY       ALFEQP---------------------------FNDLLFQAQSVHRQHFD----PNRVQV
BIOB_PSEU5       ALFEQP---------------------------FNDLLFQAQTVHRQHFD----PNRVQV
BIOB_IDILO       NLLQMP---------------------------LNDLVFEAQTVHRQHFN----PNEVQV
BIOB_COLP3       ALFAMP---------------------------FNDLMFKAQTIHRENFN----PNEVQV
BIOB_PSYIN       QLFEMP---------------------------FMDLVFQAQTTHRANFP----LNEVQV
BIOB_MARMS       ALFDLP---------------------------FMDLMFRAQTVHRENFA----PNEVQV
BIOB_PSEHT       AIFEMP---------------------------FNDLLFKAASVHRANFN----PNEVQI
BIOB_SHEB2       ALFALP---------------------------MNDLLFKAHSIHREVYD----PNEVQI
BIOB_SHEB5       ALFALP---------------------------MNDLLFKAHSIHREVYD----PNEVQI
BIOB_SHEB8       ALFALP---------------------------MNDLLFKAHSIHREVYD----PNEVQI
BIOB_SHEB9       ALFALP---------------------------MNDLLFKAHSIHREVYD----PNEVQI
BIOB_SHESA       ALFALP---------------------------MNDLLFKAHSIHREVYD----PNEVQI
BIOB_SHESM       ALFALP---------------------------MNDLLFKAHSIHREVYD----PNEVQI
BIOB_SHESR       ALFALP---------------------------MNDLLFKAHSIHREVYD----PNEVQI
BIOB_SHEON       ALFALP---------------------------MNDLLFKAHSIHREEYD----PNEVQI
BIOB_SHEPC       ALFALP---------------------------MNDLLFKAHSIHREVYD----PNEVQI
BIOB_SHESW       ALFALP---------------------------MNDLLFKAHSIHREVYD----PNEVQI
BIOB_SHEHH       SLFALP---------------------------MNDLLFQAHSIHRQEFD----PNEVQI
BIOB_SHEPA       ALFALP---------------------------MNDLLFQAHSIHRQEFD----PNEVQV
BIOB_SHEPW       TLFALP---------------------------MNDLLFQAHSVHRQEFD----PNEVQI
BIOB_SHEDO       ALFALP---------------------------MNDLLFKAHTIHRESFD----PNEVQI
BIOB_SHEFN       ALFALP---------------------------MNDLLFKAHSIHRETFD----PNEVQI
BIOB_SHESH       ALFALP---------------------------MNDLLFKAHSLHRQVFD----PNEVQI
BIOB_SHEWM       ALFALP---------------------------MNDLLFEAHSIHRQVYD----PNEVQI
BIOB_SHELP       ALFALP---------------------------MNDLLFKAHSIHRQHFD----PNEVQI
BIOB_SHEAM       ALFALP---------------------------MNDLLFRAHSIHREVFD----PNEVQI
BIOB_AERHH       ALFALP---------------------------FNDLLFQAQTVHRAHFD----PNEVQV
BIOB_AERS4       ALFALP---------------------------FNDLLFQAQTIHRAHFD----PNEVQV
BIOB_ALTMD       ALFAMP---------------------------FNDLLFNAQVVHRQHFN----PNEVQV
BIOB_PSEA6       ALFAMP---------------------------FNDLLFKAQCVHRAHFD----PNYVQV
BIOB_ALIF1       TLMDKP---------------------------FMDLIFEAQLVHRKYQQ----ANHVQV
BIOB_ALIFM       TLMDKP---------------------------FMDLIFEAQLVHRKYQQ----ANHVQV
BIOB_ALISL       ALMDKP---------------------------FMDLVFEAQLVHRQYQE----ANYVQV
BIOB_VIBC3       ALLDKP---------------------------FMDLLFEAQQVHRLHHP----HNHVQV
BIOB_VIBCH       ALLDKP---------------------------FMDLLFEAQQVHRLHHP----HNHVQV
BIOB_VIBTL       ALLEKP---------------------------FMDLMFEAQVVHRQYQE----HNHVQV
BIOB_VIBCB       DLMEKP---------------------------FMDLLFEAQLVHRQYQQ----TNYVQV
BIOB_VIBPA       DLMEKP---------------------------FMDLLFEAQLVHRQYQQ----TNHVQV
BIOB_VIBVU       ELMEMP---------------------------FMDLLFEAQQVHRQYHP----KNYVQV
BIOB_VIBVY       ELMEMP---------------------------FMDLLFEAQQVHRQYHP----KNYVQV
BIOB_PHOPR       ALFEKP---------------------------FMDLVFEAQQVHRQYHE----PNKVQV
BIOB_BUCA5       MLFKKP---------------------------FFNLMFQAQEEHRKNFD----PNTIQI
BIOB_BUCAT       MLFKKP---------------------------FFNLMFQAQEEHRKNFD----PNTIQI
BIOB_BUCAI       MLFKKP---------------------------FFNLMFQAQEEHRKNFD----PNTIQI
BIOB_BUCAP       KLFSKP---------------------------FFDLIFEAQKKHREYFN----PNRIQI
BIOB_BUCBP       ELFDQP---------------------------FFDILFLAQNIHRKNFN----ANQIQI
BIOB_WIGBR       KLFYKP---------------------------FFDLMFKAQKIHRKNFS----SNKIQI
BIOB_BAUCH       SLFNKP---------------------------FFDLLFQAQQVHRKYFR----LGQVQI
BIOB_PECAS       DLFNKP---------------------------FLELMFEAQQIHRQHFD----PRQVQV
BIOB_ERWT9       ALFETP---------------------------FLELMFEAQQIHRHYFD----PRQVQV
BIOB_SERMA       ALFDKP---------------------------LLELLFEAQTVHRQHFD----PRQVQV
BIOB_SERP5       TLFDKP---------------------------LLELLFEAQTVHRQHFD----PRQVQV
BIOB_YERPA       ALFDKP---------------------------LLELLFEAQQVHRQHFD----PRQVQV
BIOB_YERPB       ALFDKP---------------------------LLELLFEAQQVHRQHFD----PRQVQV
BIOB_YERPE       ALFDKP---------------------------LLELLFEAQQVHRQHFD----PRQVQV
BIOB_YERPG       ALFDKP---------------------------LLELLFEAQQVHRQHFD----PRQVQV
BIOB_YERPN       ALFDKP---------------------------LLELLFEAQQVHRQHFD----PRQVQV
BIOB_YERPP       ALFDKP---------------------------LLELLFEAQQVHRQHFD----PRQVQV
BIOB_YERPS       ALFDKP---------------------------LLELLFEAQQVHRQHFD----PRQVQV
BIOB_YERPY       ALFDKP---------------------------LLELLFEAQQVHRQHFD----PRQVQV
BIOB_YERP3       ALFDKP---------------------------LLELLFEAQQVHRQHFD----PRQVQV
BIOB_YERE8       ALFEKP---------------------------LLDLLFEAQQIHRQHFD----PRQVQV
BIOB_PSEVU       ELFDKP---------------------------LLDLLFEAQTIHRQHFD----PRQVQV
BIOB_ENT38       ELFNKP---------------------------FLELMFEAQQIHRQHFD----PRHVQV
BIOB_KLEP3       ELFNKP---------------------------LIDLLFEAQQIHRQHFD----PRQVQV
BIOB_KLEP7       ELFNKP---------------------------LIDLLFEAQQIHRQHFD----PRQVQV
BIOB_SALPB       ELFEKP---------------------------LLELLFEAQQIHRQHFD----PQQVQV
BIOB_SALPC       ELFEKP---------------------------LLELLFEAQQIHRQHFD----PQQVQV
BIOB_SALNS       ELFEKP---------------------------LLELLFEAQQIHRQHFD----PQQVQV
BIOB_SALTY       ELFEKP---------------------------LLELLFEAQQIHRQHFD----PQQVQV
BIOB_SALCH       ELFGKP---------------------------LLELLFEAQQIHRQHFD----PQQVQV
BIOB_SALA4       ELFEKP---------------------------LLELLFEAQQIHRQHFD----PQQVQV
BIOB_SALTI       ELFEKP---------------------------LLELLFEAQQIHRQHFD----PQQVQV
BIOB_SALHS       ELFEKP---------------------------LLELLFEAQQIHRQHFD----PQQVQV
BIOB_SALPA       ELFEKP---------------------------LLELLFEAQQIHRQHFD----PQQVQV
BIOB_SALDC       ELFEKP---------------------------LLELLFEAQQIHRQHFD----PQQVQV
BIOB_SALEP       ELFEKP---------------------------LLELLFEAQQIHRQHFD----PQQVQV
BIOB_SALSV       ELFEKP---------------------------LLELLFEAQQIHRQHFD----PQQVQV
BIOB_SALPK       ELFEKP---------------------------LLELLFEAQQIHRQHFD----PQQVQV
BIOB_SALG2       ELFEKP---------------------------LLELLFEAQQIHRQHFD----PQQVQV
BIOB_SALAR       ELFEKP---------------------------LLELLFEAQQIHRQHFD----PKQIQV
BIOB_CITK8       ELFNKP---------------------------LLDLLFDAQQIHRQHFD----PQQVQV
BIOB_SHIB3       ELFEKP---------------------------LLDLLFEAQQVHRQHFD----PRQVQV
BIOB_SHIBS       ELFEKP---------------------------LLDLLFEAQQVHRQHFD----PRQVQV
BIOB_ECO81       ELFEKP---------------------------LLDLLFEAQQVHRQHFD----PRQVQV
BIOB_ECOL6       ELFEKP---------------------------LLDLLFEAQQVHRQHFD----PRQVQV
BIOB_ECOK1       ELFEKP---------------------------LLDLLFEAQQVHRQHFD----PRQVQV
BIOB_ECOUT       ELFEKP---------------------------LLDLLFEAQQVHRQHFD----PRQVQV
BIOB_ECO45       ELFEKP---------------------------LLDLLFEAQQVHRQHFD----PRQVQV
BIOB_ECOL5       ELFEKP---------------------------LLDLLFEAQQVHRQHFD----PRQVQV
BIOB_SHIF8       ELFEKP---------------------------LLDLLFEAQQVHRQHFE----PRQVQV
BIOB_SHIFL       ELFEKP---------------------------LLDLLFEAQQVHRQHFE----PRQVQV
BIOB_ECO57       ELFEKP---------------------------LLDLLFEAQQVHRQHFD----PRQVQV
BIOB_ECO5E       ELFEKP---------------------------LLDLLFEAQQVHRQHFD----PRQVQV
BIOB_SHISS       ELFEKP---------------------------LLDLLFEAQQVHRQHFD----PRQVQV
BIOB_ECOLI       ELFEKP---------------------------LLDLLFEAQQVHRQHFD----PRQVQV
BIOB_ECOSM       ELFEKP---------------------------LLDLLFEAQQVHRQHFD----PRQVQV
BIOB_ECOLU       ELFEKP---------------------------LLDLLFEAQQVHRQHFD----PRQVQV
BIOB_ECOLC       ELFEKP---------------------------LLDLLFEAQQVHRQHFD----PRQVQV
BIOB_ECOHS       ELFEKP---------------------------LLDLLFEAQQVHRQHFD----PRQVQV
BIOB_ECODH       ELFEKP---------------------------LLDLLFEAQQVHRQHFD----PRQVQV
BIOB_ECO8A       ELFEKP---------------------------LLDLLFEAQQVHRQHFD----PRQVQV
BIOB_ECO7I       ELFEKP---------------------------LLDLLFEAQQVHRQHFD----PRQVQV
BIOB_ECO55       ELFEKP---------------------------LLDLLFEAQQVHRQHFD----PRQVQV
BIOB_ECO27       ELFEKP---------------------------LLDLLFEAQQVHRQHFD----PRQVQV
BIOB_ECO24       ELFEKP---------------------------LLDLLFEAQQVHRQHFD----PRQVQV
BIOB_SHIDS       ELFEKP---------------------------LLDLLFEAQQVHRQHFD----PRQVQV
BIOB_ECOSE       ELFEKP---------------------------LLDLLFEAQQVHRQHFD----PRQVQV
BIOB_ESCF3       ELFEKP---------------------------LLDLLFEAQQVHRQHFD----PRQVQV
BIOB_CROS8       ELFEKP---------------------------LLDLLFEAQQVHRQHFD----PRQVQV
BIOB_PHOLL       ELFDKP---------------------------FFELLFQAQQVHRIYFD----PQQVQV
BIOB_PROMH       ALFDMP---------------------------FLDLVFQAQQVHRQHFD----PSQIQV
BIOB_SODGM       ALFDKP---------------------------FLELLFEAQQVHRQHFT----PGEVQV
BIOB_METI4       QIYHRP---------------------------LDELLGEALQAKKLSGR-----NGVQF
BIOB_BACSU       SILHCPD------------------------EDILLLMHGAFHIRKHFY-----GKKVKL
BIOB_BACNA       SILHCPD------------------------EDILLLMHGAFHIRKHFY-----GKKVKL
BIOB_BACVZ       AILNCPD------------------------EDLLLLMHAAFHIRKRFY-----GKKVKL
BIOB_BACAM       AILNCPD------------------------EDLLLLMHAAFHIRKRFY-----GKKVKL
BIOB_BACLD       SILECPD------------------------DDVLLLMHAAFQIRKRYY-----GKKVKL
BIOB_BACHD       AILNSPD------------------------DELLLLLQGAFTIRQTYY-----GKKVKL
BIOB_GEOKA       AILDCPD------------------------EELLLLLQGAYRIRSAYY-----GNKVKL
BIOB_GEOTN       AILDCPD------------------------DELLLLLQGAYRIRSVYY-----GNKVKL
BIOB_ANOFW       AILNCPD------------------------DELLLLLQGAYRIRKTYY-----GNKVKL
BIOB_LYSSH       AILNSDD------------------------DDILKLMDGAFAIRKHYY-----GKKVKL
BIOB_LYSSC       AILNSKD------------------------DELLQLMDGAFAIRRHYY-----GKKVKL
BIOB_BACAN       AILEADD------------------------TEVLEIMNAAYIIRHHYF-----GKKVKL
BIOB_BACC0       AILEADD------------------------TEVLEIMNAAYIIRHHYF-----GKKVKL
BIOB_BACCZ       AILEADD------------------------TEVLEIMNAAYIIRHHYF-----GKKVKL
BIOB_BACHK       AILEADD------------------------TEVLEIMNAAYIIRHHYF-----GKKVKL
BIOB_BACAH       AILEAED------------------------TEVLEIMNAAYIIRHHYF-----GKKVKL
BIOB_BACC7       AILEADD------------------------TEILEIMNAAYIIRHHHF-----GKKVKL
BIOB_BACCQ       AILEADD------------------------TEILEIMNAAYIIRHHHF-----GKKVKL
BIOB_BACC1       AILEADD------------------------TEILEIMNAAYIIRHHHF-----GKKVKL
BIOB_BACC2       AILEADD------------------------TEVLEIMNAAYIIRHHHF-----GKKVKL
BIOB_BACC4       AILEADD------------------------TEVLEIMNAAYIIRHHHF-----GKKVKL
BIOB_BACCR       AILEADD------------------------TEVLEIMNAAYIIRHHHF-----GKKVKL
BIOB_BACMK       AILEADD------------------------TEVLEIMNAAYIIRHHHF-----GKKVKL
BIOB_BACCN       AILEADD------------------------TEVLEIMNAAYMIRHHYF-----GKKVKL
BIOB_BACP2       DILEADD------------------------RELLSIMHAAYQVRFHFF-----QNKVKL
BIOB_STAAM       KIYEDTN------------------------IDTLDLLNEAYILRKHYF-----GKKVKL
BIOB_STAAN       KIYEDTN------------------------IDTLDLLNEAYILRKHYF-----GKKVKL
BIOB_STAAS       KIYEDTN------------------------IDTLDLLNEAYILRKHYF-----GKKVKL
BIOB_STAA9       KIYEDTN------------------------IDTLDLLNEAYILRKHYF-----GKKVKL
BIOB_STAAB       KIYEDTN------------------------IDTLDLLNEAYILRKHYF-----GKKVKL
BIOB_STAAW       KIYEDTN------------------------IDTLDLLNEAYILRKHYF-----GKKVKL
BIOB_STAA1       KIYEDTN------------------------IDTLDLLNEAYILRKHYF-----GKKVKL
BIOB_STAA2       KIYEDTN------------------------IDTLDLLNEAYILRKHYF-----GKKVKL
BIOB_STAAR       KIYEDTN------------------------IDTLDLLNEAYILRKHYF-----GKKVKL
BIOB_STAAC       KIYEDTN------------------------IDTLDLLNEAYILRKHYF-----GKKVKL
BIOB_STAAT       KIYEDTN------------------------IDTLDLLNEAYILRKHYF-----GKKVKL
BIOB_STAA8       KIYEDTN------------------------IDTLDLLNEAYILRKHYF-----GKKVKL
BIOB_STAAE       KIYEDTN------------------------IDTLDLLNEAYILRKHYF-----GKKVKL
BIOB_STAA3       KIYEDTN------------------------IDTLDLLNEAYILRKHYF-----GKKVKL
BIOB_STAEQ       SIFENAE------------------------IDTFDLLNEAYTVRKHYY-----GKKVKL
BIOB_STAES       TIFESSE------------------------LDTFDLLNEAYTVRKHYY-----GKKVKL
BIOB_STAHJ       ALFEDET------------------------IDTFELLNEAYIIRKHFF-----GKKVKL
BIOB_STACT       DLYTDET------------------------IDTFTLLDEAYAVRKHYY-----GKKVKL
BIOB_MACCJ       SLFVDNN------------------------IDTYDLLHEAYQVRKYYY-----GRKVKL
BIOB_RHOBA       AMLEASD------------------------LDVPAIISAGYRIRHQYF-----GNTVQL
BIOB_THEEB       AVLQAPD------------------------TELLNQLAAAYRVRYHYW-----GNRVRL
BIOB_SALRD       DVVHADD------------------------DEVLALLDAAFRVRRHHH-----GRRVRI
BIOB_STRAW       AVLATSD------------------------DDVLDVVAAAGKVRRHWF-----GRRVKL
BIOB_STRCO       AVLVTSD------------------------DDLLDVVAAAGKVRRHWF-----GRRVKL
BIOB_STRGG       AVLATSD------------------------DELLDVVAAAGKVRRQWF-----GRRVKL
BIOB2_FRACC      AVLRSDD------------------------DDLLDVVAAAYRLRRRYF-----GRRVKL
BIOB_NOCSJ       AVLRADE------------------------KDLLHVVAAAGRLRRARF-----GNTVKV
BIOB_SACEN       AVLRADD------------------------AELMSVVAAAGRLRRAHF-----GNTVKV
BIOB_KOCRD       DLLRTDD------------------------PGMLDLVAAAARLRREHF-----GMTVKV
BIOB_RENSM       VLLRSDP------------------------ANYLSLLAAAARLRSAYF-----GNSVKL
BIOB_CUTAK       EILRSSD------------------------DELMSIIAAAGKVRRHFF-----DNRVRL
BIOB_ACAM1       TLLSDPN------------------------IDLLSLVAAAGEVRMTYF-----GRQVML
BIOB_MAGMM       RLLTDPG------------------------IELLPLLQAAFRVRFHHF-----GRGVRI
BIOB_LEPBA       QILKGE-------------------------VPLLPVVAKASEERFRHF-----GNRVRI
BIOB_LEPBP       QILKGE-------------------------VPLLPVVAKASEERFRHF-----GNRVRI
BIOB_LEPBJ       EILNGS-------------------------IPLTTCLDKAFQERNRYF-----YNKVRI
BIOB_LEPBL       EILNGS-------------------------IPLTTCLDKAFQERNRYF-----YNKVRI
BIOB_LEPIC       KILNGV-------------------------IPLTTCLDKAFQERNRYF-----ENKVRI
BIOB_LEPIN       KILNGV-------------------------IPLTTCLDKAFQERNRYF-----ENKVRI
BIOB_THET2       FVLEAPP------------------------EALPALAEAAIRVKEYFF-----GRRLKL
BIOB_THET8       FVLEAPP------------------------EALPALAEAAIRVKEYFF-----GRRLKL
BIOB_STRA1       EILNSD-------------------------ENWWEIYAAALYLKNQVS-----RNNIRL
BIOB_STRA5       EILNSD-------------------------ENWWEIYAAALYLKNQVS-----RNNIRL
BIOB_STRA3       EILNSD-------------------------ENWWEIYAAALYLKNQVS-----RNNIRL
BIOB_CORGL       EVLTLP------------------------EEQIPDLMELAHQVRLKWC-----GEEIEV
BIOB_CORGB       EVLTLP------------------------EEQIPDLMELAHQVRLKWC-----GEEIEV
BIOB_COREF       EILNLP------------------------DEDIPALMELAHQVRLKWC-----GEEIEV
BIOB1_CORDI      QVLQLD------------------------EARIPELLELAHEVRLKWC-----GEEVEV
BIOB_CORU7       EVLNLP------------------------DEQIEELLALAHEVRVKWC-----GEEVEI
BIOB_CORJK       QVLQLG------------------------DEHLDELLDLAHQVRLKWC-----GDAVEM
BIOB_MYCBO       AVLQLP------------------------DDRLEELLALAHEVRMRWC-----GPEVEV
BIOB_MYCTU       AVLQLP------------------------DDRLEELLALAHEVRMRWC-----GPEVEV
BIOB_MYCTA       AVLQLP------------------------DDRLEELLALAHEVRMRWC-----GPEVEV
BIOB_MYCTF       AVLQLP------------------------DDRLEELLALAHEVRMRWC-----GPEVEV
BIOB_MYCBP       AVLQLP------------------------DDRLEELLALAHEVRMRWC-----GPEVEV
BIOB_MYCMM       QVLQLS------------------------EDRLEELLALAHDVRMRWC-----GPEVEV
BIOB_MYCUA       QVLQLS------------------------EDRLEELLVLAHDVRMRWC-----GPEVEV
BIOB_MYCA1       QVLRLP------------------------DDRLDDLLALAHEVRMRWC-----GPEVEV
BIOB_MYCPA       QVLRLP------------------------DDRLDDLLALAHEVRMRWC-----GPEVEV
BIOB_MYCLE       QMLWLP------------------------DDRLEELLALAHDVRMRWC-----GPEVEI
BIOB_MYCLB       QMLWLP------------------------DDRLEELLALAHDVRMRWC-----GPEVEI
BIOB_MYCGI       QVLQLP------------------------DDRLDELLALAHEVRMAHC-----GPDVEV
BIOB_MYCVP       QVLQLP------------------------DDRLDDLLALAHEVRMAWC-----GPDVEV
BIOB_MYCSJ       QVLQLP------------------------DDRLDDLLALAHEVRMAWC-----GPDVEV
BIOB_MYCSK       QVLQLP------------------------DDRLDDLLALAHEVRMAWC-----GPDVEV
BIOB_MYCSS       QVLQLP------------------------DDRLDDLLALAHEVRMAWC-----GPDVEV
BIOB_MYCS2       QVLQLP------------------------DERLDDLLSLAHEVRMRWC-----GPDVEV
BIOB_MYCA9       RVLQLP------------------------DDRLEELLALAHEVRMRWC-----GPEVEV
BIOB_NOCFA       AVLRLG------------------------DDRLEELLGLAHEVRMKWC-----GPEVEV
BIOB_RHOJR       EVLQLP------------------------DDRLEELLALAHDVRMKWC-----GPEVEV
BIOB_FRAAA       AVLRLP------------------------DEYLGDALALAHEVRMRWC-----GPEVEV
BIOB1_FRACC      AVLRLP------------------------DETLTDLLALAHEVRMRWC-----GPEVEV
BIOB_FRASN       AVLQLP------------------------DEALGDLLALAHEVRLRWC-----GPEVEV
BIOB_SALAI       AVLNLP------------------------DEHLPAALQLAHEVRMRWC-----GPEVEV
BIOB_SALTO       AVLNLP------------------------DEHLPAALQLAHEVRMRWC-----GPEVEV
BIOB_PSECP       EVLQLP------------------------DEALPQALELAHQVRLRHC-----GEDVEV
BIOB_ARTS2       EFLRLP------------------------DEALPAALQLAHEVRLKHC-----GEDVEV
BIOB_PAEAT       HILELP------------------------DDAIPEALQLAHEVRLKHC-----GEDVEV
BIOB_ACIC1       AVLDVD------------------------DDSLPRLLDLAHRVRRRWC-----GPGVEI
BIOB_CENSY       GLM---------------------------EADVTELAAAADEITRRFN-----GDGVDV
BIOB_NITMS       KLLNIP------------------------EENLKDLARCANEITRDFN-----GEKVDV
BIOB_HELPY       ------------------------------------------------------MQEIFL
BIOB_HELPH       ------------------------------------------------------MQEIFL
BIOB_HELPS       ------------------------------------------------------MQEIFL
BIOB_HELPG       ------------------------------------------------------MQEIFL
BIOB_HELPJ       ------------------------------------------------------MQEIFL
BIOB_HELP2       ------------------------------------------------------MQEIFL
BIOB_HELAH       ------------------------------------------------------MQEIFL
BIOB_HELHP       --------------------------------------------------MQKISNEIFL
BIOB_WOLSU       ------------------------------------------------------MKDIFL
BIOB_ARCB4       ----------------------------------------------------MSDNKIYL
BIOB_NITSB       -------------------------------------------------------MKVYL
BIOB_NAUPA       ------------------------------------------------------MKKIYL
BIOB_CAMC1       ------------------------------------------------------MKTIML
BIOB_CAMC5       ------------------------------------------------------MKTIML
BIOB_CAMFF       ----------------------------------------------------------ML
BIOB_CAMJ8       -------------------------------------------------------MQIML
BIOB_CAMJJ       -------------------------------------------------------MQIML
BIOB_CAMJE       -------------------------------------------------------MQIML
BIOB_CAMJR       -------------------------------------------------------MQIML
BIOB_CAMJD       -------------------------------------------------------MQIML
BIOB_CAMLR       -------------------------------------------------------MQIML
BIOB_SULDN       -----------------------------------------------------MNQKIFL
BIOB_SULNB       ---------------------------------------------------MSTRKQIFL
BIOB_METM6       DLWN---------------------------LDLNDLLNISCALKKLF-----NKDKIDL
BIOB_METMP       KLWD---------------------------LDLNDLLDISYNLKKLF-----NKEKIDL
BIOB_METM5       DLWN---------------------------LDLNDLLDISYALKKLF-----NKDKIDL
BIOB_METM7       DLWN---------------------------LDLKNLLDISYSLKKLF-----NKEKIDL
BIOB_METVS       EILK---------------------------LDVYDLLHISYHLKKAF-----NKEKIET
BIOB_META3       LLWE---------------------------LPYYTLLYLANCVKKHN-----NSNNIDL
BIOB_METJA       YLYNN--------------------------FSAIDLLYLAFKIKNRIK----NNSKIKL
BIOB_CALBD       ILYEIA------------------------KHDADLVKNLASTINQHY-----FKNTIEL
BIOB_CALS8       MLYEIA------------------------KHDFDLVKNLADTIKRYY-----FKNNIEL
BIOB_AQUAE       YILEVD------------------------DIYVPFLVHLAQKIKKHYF----PENEVEF
BIOB_HYDS0       FILKAE------------------------DKYIPLIVYLTSKLKDEFF----DSQKFEF
BIOB_PERMH       KILSIP------------------------DEYLDLLVQEASKVREAVF-----GDEVEF
BIOB_SULSY       QILSIP------------------------DELVMDLVEEASKVRKYFF-----KNQMEF
BIOB_UNCTG       KFFD---------------------------FELEEIFFAATKIRRKY-----KGNKVKV
BIOB_THENN       -------------------------------------------MVRNS-----R---LDI
BIOB_THEP1       ETKE--------------------------------LILKANRMTSNL-----K---LDL
BIOB_THEYD       HIYS--------------------------------LIFQANSIREKY-----KGKKIEL
BIOB_DESDA       EALKLV------------------------SLPEDELFVGATQLRRAT-----FDNRITL
BIOB_ALKMQ       RFFA--------------------------TANLEELCQGADNIRKVL-----CGDAVNL
BIOB_CLOB8       EFLL--------------------------TCDLKKICDGANKIRKTL-----CGESVDL
BIOB_CLOB1       EELL--------------------------EEDITDLAATANEIRESL-----CGNKFDL
BIOB_CLOBH       EELL--------------------------EEDITDLAATANEIRESL-----CGNKFDL
BIOB_CLOBK       EELL--------------------------EEDITDLAATANEIRESL-----CGNKFDL
BIOB_CLOBL       EEIL--------------------------EEDITDLAATANEIRESL-----CGNKFDL
BIOB_CLOBM       EELL--------------------------EEGITDLAATANEIREFL-----CGNKFDL
BIOB_CLOBA       IILS--------------------------KENVDKLASAANDIRMSL-----CGKKFNL
BIOB_CLOBB       MILS--------------------------KENIDELASAANDIRMSL-----CGKEFNL
BIOB_BRAHW       MQLV--------------------------EAPLEDLCSVANEIRKYF-----CSNTFDM
BIOB_AKKM8       IALS--------------------------REPLEELCQAANAIREHF-----CGNVFDL
BIOB2_CORDI      LSLI--------------------------DAPLDELSAAADRIRAQM-----CGDGFDM
BIOB_CAMHC       YEL--------------------------ENAPLNELLEAANEVRAKF-----CGNYFNF
BIOB_FUSNN       YEITREEAIFLSQ------------IPNNDMETLNILFNAADQIREVF-----CGKYFDL
BIOB_CLOD6       LNLISLDTN--------------------NKNDFDILLKSANEIREYF-----MGRKADL
BIOB_HUNT2       VELAKGKIE--------------------DEK----LFLLADKLCKKN-----MGRRVDL
BIOB_CLOK1       MKLSKCEE----------------------VGDIKQLCHSADNIRDFF-----CGVEVDL
BIOB_CLOTE       ITLFQSSY----------------------DKNLNNLLDAANRIRNKF-----NGNIVDL
BIOB_CLONN       VRLI--------------------------DEDIDKVLQGAKKLRKVF-----CGKHVDL
BIOB_CLOP1       LRLF--------------------------NSNLEELIKEANNIRKEI-----HGDGIDL
BIOB_CLOPE       LRLF--------------------------NSNLEELIKEANNIRKEI-----HGDGIDL
BIOB_PORG3       LLLAS-------------------------SADKEALYETAHRITRHF-----MGDKFDT
BIOB_PORGI       LLLAS-------------------------SADKEALYEAAHRITRYF-----MGDKFDT
BIOB_PARD8       LSLAN-------------------------HPDKEALYEAAHQITRHF-----MGNKFDT
BIOB_CROS5       TLTQ-----------------------IDGQDNILLLCEAADRIRQAC-----CGNVVDL
BIOB_RIPO1       TLTQ-----------------------IEGQDSILLLCEAADRIRQAC-----CGNVVDL
BIOB_GLOC7       ALTE-----------------------IEGQDQILLLCEAADRIRQAC-----CGNRVDL
BIOB_MICAN       ALTA-----------------------IEGQENIFSLCEAADRIRQAC-----CGNTVDL
BIOB_TRIEI       ILTQ-----------------------IAGEEDILLLCEAADRVRQAC-----CGNVVDL
BIOB_SYNY3       QLAA-----------------------IEGEENILLLCEAANRIREAC-----CGNVVDL
BIOB_CYAP4       ALTE-----------------------IEGEEKILALCAAADRVRQAC-----CGNTVDL
BIOB_SYNP2       RLTA-----------------------ITGPENILKLCAAADLIRHEC-----CGNTVDL
BIOB_CARHZ       ELA------------------------QAEGADILILAAMAAKIREKY-----VGDKVEL
BIOB_CLOAB       TLS------------------------KSNGSDIFLLCSFANKLREKF-----NGNHVDL
BIOB_DESAP       ALL------------------------QLPDAVTPFLLGWADVVRKCF-----HGNRVDL
BIOB_PELTS       ALG------------------------GLDEDRLNELFLAALQVNRHF-----HGNRVDL
BIOB_HELMI       KLA------------------------RIEGSDIYTLMDVARRVRDHF-----GAGKVDL
BIOB_DESPS       DLAL-----------------------HCARADLDRLLALARQVGSLH-----HGKSIDL
BIOB_DESRM       YLS------------------------KAENLDILQILSMAAQVTANF-----ANKKIDL
BIOB_ANAD2       --------------------EARRLIHHTSGPELEALLDRAEAVRRAV-----HGDEVAL
BIOB_ANASK       --------------------EARRLIHHTSGPELEALLDRAEAVRRAV-----HGDEVAL
BIOB_ANADE       --------------------EARRLIHHTSGPELEALLDRAEAVRRAV-----HGDEVAL
BIOB_ANADF       --------------------EARTLIRHTGGPALDALLDRADAVRRAV-----HGDEVAL
BIOB_DESVH       CDADIPPDARNTMMPEGITVEEALAVAELPQKHALDILATAQAIRSVH-----KGGPAAL
BIOB_DESVV       CDADIPPDARNTM-PEGITVEEALAVAELPQKHALDILATAQAIRSVH-----KGGPAAL
BIOB_DESVM       PWS-------------GITGEEALAVARLPASDILDILAVAQAVRSAR-----KGPLATT
BIOB_DESAG       --------------------DEALRLLELPAEQTLPLIACAQRIRTAH-----AGP-AFT
BIOB_GEOMG       ---------------------ESIALSASSGTDAFALFLAASRVKEHF-----LGNGVDL
BIOB_GEOSL       ---------------------EANELLLLEGTDANALFLAASRVRDHF-----LGTGVDL
BIOB_GEODF       ---------------------EALELANLRGSALYPLFGAASRIKEHF-----VGDKVFL
BIOB_GEOUR       ---------------------EALELSQMEGSALFPLFCVANRIKEHF-----VGDKVYL
BIOB_GEOBB       ---------------------EAIQLTQVQGTEVYDLFRAATRVKEHF-----VGNEVHL
BIOB_PELPD       ---------------------EALRLAEARGADLHLLFAEASRIRQHF-----TGNSASL
BIOB_GEOLS       ---------------------QALALTALSGASLQSLFAAASRVREHH-----FGNQVSL
BIOB_PELCD       ---------------------EGRSILQAGGASLGWVMAGAQQLRETY-----CGDGVGL
BIOB_SYNAS       ---------------------EACSLTELPARSIPDLFLAACKIRQHY-----QKDDVVL
BIOB_DESAL       -----------------------EELACLPEQHVLDLLPAANAVRKHF-----FGDQVHL
BIOB_DESOH       -----------------------LSLIRMPDDRTFLLFPGADLLREHF-----FGTSVHL
BIOB_SYNFM       ---------------------TAFDILLARPDEIPELMNAATAVRRRH-----FGERLQL
BIOB_CHLCH       QLANLS------------------------GSDLLDLASLAHKVQLRY---AGGVESFHA
BIOB_PELPB       LLAELP------------------------GELVLDLASLANKVKNRYGTGSAGSELLHA
BIOB_CHLP8       ALGRLP------------------------ESEVLDLVSLANKVKNLYAPGEGGG--VHA
BIOB_CHLTE       ALGRLP------------------------DSEVLDLVSLANRVKARHAANHGA---IHA
BIOB_CHLL2       RLAALP------------------------GDAVLDLASLAHKVRLRYA-GEAAS--LHA
BIOB_PELLD       MLAALP------------------------GEHALDIASLANKVRNRWG--KGG---VHA
BIOB_CHLPM       LLASLP------------------------GEFSLDLASLANKVRNRWG--KGG---IHA
BIOB_CHLPD       ALGELH------------------------GPDVLDLASLAHKVKLRHGGSSGS---IHA
BIOB_CHLPB       ELAHLA------------------------GEDVPDLLSLANKVKNRYATLSEGAL--HS
BIOB_PROA2       RLATLR------------------------GEAVVDLLSLANKVKNRFAA-PDGAL--HS
BIOB_NATPD       ALLAQP------------------------VDELAAGADLLRRHFSDGT--------VDA
                                                                             

BIOB_FRAT1       CSLKSIKTGTCPEDCKYCPQSGHYNTS--IEKHKLLDKDSILAEAKNAKDA---------
BIOB_FRATT       CSLKSIKTGTCPEDCKYCPQSGHYNTS--IEKHKLLDKDSILAEAKNAKDA---------
BIOB_FRATN       CSLKSIKTGTCPEDCKYCPQSGHYNTS--IEKHKLLDKDSILAEAKNAKDA---------
BIOB_FRATW       CSLKSIKTGTCPEDCKYCPQSGHYNTS--IEKHKLLDKDSILAEAKNAKDA---------
BIOB_FRATM       CSLKSIKTGTCPEDCKYCPQSGHYNTS--IEKHKLLDKDSILAEAKNAKDA---------
BIOB_FRATF       CSLKSIKTGTCPEDCKYCPQSGHYNTS--IEKHKLLDKDSILAEAKNAKDA---------
BIOB_FRATH       CSLKSIKTGTCPEDCKYCPQSGHYNTS--IEKHKLLDKDSILAEAKNAKDA---------
BIOB_FRATO       CSLKSIKTGTCPEDCKYCPQSGHYNTS--IEKHKLLDKDSILAEAKNAKDA---------
BIOB_FRAP2       CSLKSIKTGTCPEDCKYCPQSGHYNTS--IEKHKLLDKDSILAEAKNAKDA---------
BIOB_COXB1       CTLSSIKTGTCPEDCAYCPQSGHYKTD--VEREKLINLEAVLEQAKVAKEN---------
BIOB_COXB2       CTLSSIKTGTCPEDCAYCPQSGHYKTD--VEREKLINLEAVLEQAKVAKEN---------
BIOB_COXBN       CTLSSIKTGTCPEDCAYCPQSGHYKTD--VEREKLINLEAVLEQAKVAKEN---------
BIOB_COXBR       CTLSSIKTGTCPEDCAYCPQSGHYKTD--VEREKLINLEAVLEQAKVAKEN---------
BIOB_COXBU       CTLSSIKTGTCPEDCAYCPQSGHYKTD--VEREKLINLEAVLEQAKVAKEN---------
BIOB_LAWIP       SMLLNIKTGNCPENCGYCSQSSHYKTD--LQKEPLVDIDTLISEAKKAKEL---------
BIOB_RICFE       SSLLSIKTGSCPENCKFCPQSSHYKTY--VKKEPLMQIEDVITAAKRAKAA---------
BIOB_NEOSM       AMLLSVKTGGCPENCSYCPQSAHYDTG--LRKEPVMHVEKVLEAAKRAVEL---------
BIOB_ANAMF       AALMNIKTGSCPENCRYCAQSAHYNTG--LEKKSLSTVEEVKTAAKRAKEI---------
BIOB_ANAMM       AALMNIKTGSCPENCRYCAQSAHYNTG--LEKKSLSTVEEVKTAAKRAKEI---------
BIOB_ANAPZ       CALANIKAGGCPENCCYCSQSAHNKTG--LTKKGLSSVEEVRTAARRAKDV---------
BIOB_EHRCJ       SSLLNIKTGGCPENCKYCSQSAHYKTD--LKKESLLDIESIKKAIQTAKKN---------
BIOB_EHRCR       AALLNIKTGGCPENCRYCSQSAHYKTD--LQKEALLDVENIKKAIQTAKNS---------
BIOB_EHRRG       AGLLNIKTGGCPENCKYCSQSAHYKTQ--LKKEDLLNIETIKEAIKKAKVN---------
BIOB_EHRRW       AGLLNIKTGGCPENCKYCSQSAHYKTQ--LKKEDLLNIETIKEAIKKAKVN---------
BIOB_AGRRK       ASLLSIKTGGCPENCAYCPQSAHHREVDLTR-DRLMDPESVVAMAATARAA---------
BIOB_AGRVS       ASLLSIKTGGCPEDCAYCPQSAHHREVKLTK-DRLMQPETVLALAKRAKDA---------
BIOB_RUEPO       ASLLSIKTGGCPEDCAYCPQSAHHREVELTR-EKLMNPDHVVSLARRAQRA---------
BIOB_BEII9       ASLLSIKTGGCSEDCGYCSQSARRDEVHLDR-VEMMSPSDVLAVAAQARDN---------
BIOB_METSB       ASLLSIKTGGCPENCGYCPQSAHHKEVHLDR-IHMMKPDEVLEIAARAKAA---------
BIOB_ZYMMO       SSLLSIKTGGCPEDCGYCSQSAHHD-VELTR-EKLMNPTAVIGLAAKAKKA---------
BIOB_METC4       AALLSIKTGGCPEDCAYCPQSAHHKGANLPR-ERLMPVDAVLKEAAAAKAN---------
BIOB_METEP       AALLSIKTGGCPEDCAYCPQSAHHKGANLPR-ERLMPVDAVLKEAAAAKAN---------
BIOB_METPB       AALLSIKTGGCPEDCAYCPQSAHHKGANLPR-ERLMPVDAVLKEAAAAKAN---------
BIOB_METRJ       ASLLSIKTGGCPEDCAYCPQSAHHKGAGVAR-ERLMPVETVLAEAAAAKAA---------
BIOB_METNO       ASLLSIKTGGCPEDCAYCPQSAHHKEAGIGR-QRLMPVEAVLREAEAAKAA---------
BIOB_METS4       ASLLSIKTGGCPEDCGYCSQSAHHKETGVAR-QRLMPVEAVLREAAAAKAA---------
BIOB_PROM2       ASLFSVKTGGCEENCSYCSQSIYSASEIKSH--PQFQVEEVLARAQIAKKE---------
BIOB_PROM9       ASLFSVKTGGCEENCSYCSQSIYSASEIKSH--PQFQVEEVMARAKIAKNE---------
BIOB_PROMS       ASLFSVKTGGCEENCSYCSQSIYSASEIKSH--PQFQVEEVLARAKIAKNE---------
BIOB_PROM0       ASLFSVKTGGCEENCSYCSQSIYSASEIKSH--PQFQVEEVLARAKVAKNE---------
BIOB_PROM5       ASLFSVKTGGCEENCSYCSQSIYSSSQIKSH--PQFEVEAVLNRAKTAKKE---------
BIOB_PROMP       ASLFSVKTGGCEENCSYCSQSIYSSSQIKSH--PQFEVEAVLNRAKTAKKE---------
BIOB_PROM1       ASLLSVKTGGCSEDCAYCPQSVHNETTVQPN--PVIEVESVLDRARAAKDA---------
BIOB_PROMT       ASLLSVKTGGCSEDCAYCPQSVHNETTVQPN--PVIEVESVLDRARAAKDA---------
BIOB_PROM4       ASLLSVKTGGCEEDCAYCSQSIHNSSDITSY--SDFEVEEVLKRAKTAKDA---------
BIOB_PROMA       ASLLSVKTGGCEEDCSYCSQSIYNSSDVTNQ--SDFDVKGVLEQAKAAKAA---------
BIOB_PROM3       ASLLSVKTGGCQEDCAYCPQSMHNSSDVEGQPDLVVQIQTVLERARAAKDA---------
BIOB_PROMM       ASLLSVKTGGCQEDCAYCPQSMHNSSDVEGQPDLVVQIQTVLERARAAKDA---------
BIOB_SYNPW       ASLLSVKTGGCEEDCAYCPQSMHHSSDVTG--QPDLEVKAVLDRARVAAEA---------
BIOB_SYNS3       ASLLSVKTGGCEEDCAYCPQSMHHSSDVTG--QPELQVAPVLERAKAAKQA---------
BIOB_SYNPX       ASLLSVKTGGCEEDCAYCSQSIHNSSDVTAF-EAQMQVEPVLQRARAAKEA---------
BIOB_SYNSC       ASLLSVKTGGCEEDCAYCSQSIHNSSDVTAF-EAQMQVEPVLQRARAAKEA---------
BIOB_SYNS9       ASLLSVKTGGCEEDCSYCSQSIHNSSDVSGF-EAQMRVEPVLERARAAKEA---------
BIOB_SYNR3       ASLLSVKTGGCEEDCAYCPQSMHHSSDVTAQPELQLQVDGVLQQARSARDA---------
BIOB_SYNE7       ATLLSVKTGGCSENCAYCPQSAHYNTEVDPQ--STLPIETVLEQAERAKAA---------
BIOB_SYNP6       ATLLSVKTGGCSENCAYCPQSAHYNTEVDPQ--STLPIETVLEQAERAKAA---------
BIOB_SORC5       CTLLSVKTGGCPEDCAYCPQSSHYETEVGPE--RMLDVGAVLAAAERAREG---------
BIOB_MYXXD       CSLLSIKTGGCPEDCSYCPQAARYKTGVKAE--KLMAVPDVLDAASKARAA---------
BIOB_GLOVI       CTLSNIKTGLCPENCGYCSQSVHHKSGLAAQ--ELSSLDAVMAEAQAAKAA---------
BIOB_SYNJA       CALVNIKSGRCPEDCAYCPQSARYSTGIETY--PLISLESLRQQAMAAQRA---------
BIOB_NOSS1       CKLISIKTGACPEDCSYCAQSSRYQTEVKPQ--ALLDKQTVVEIAQNAKQK---------
BIOB_TRIV2       CKLISIKTGGCPEDCSYCAQSSRYQTEVKPQ--ALLDKQTVVEIAQNAKQK---------
BIOB_NOSP7       CKLISIKTGGCPEDCSYCAQSSRYKTEVKAE--ALLEKETVVNIAQKAKET---------
BIOB_CHLAB       CYLVSIKTGGCTEDCAYCAQSSRYQTHVKPE--PMMKITEVLDRAKQAIRA---------
BIOB_CHLFF       CYLVSIKTGGCTEDCAYCAQSSRYQTNVKPE--PMMKITEVLERAKHAIES---------
BIOB_CHLPN       CYLISIKTGGCVEDCAYCAQSSRYHTHVTPE--PMMKIVDVVERAKRAVEL---------
BIOB_FLAJ1       STLLSIKTGGCPEDCGYCPQAARYNTGVEGN--DLMTVSQVKAQALRAKSN---------
BIOB_FLAPJ       STLLSIKTGGCPEDCGYCPQAARYHTDIEGN--DLMSVQQVKAQALRAKSS---------
BIOB_GRAFK       STLLSIKTGGCPEDCGYCPQAARYHTDLEGN--DLMSVNQVKAQALRAKAS---------
BIOB_CYTH3       CTLLSIKTGGCPEDCSYCPQAARYHTDVKVE--KLMDVKDVLNSALEAKES---------
BIOB_HYDCU       STLVNIKSGGCAEDCAYCSQSARNQTEVEKE--QMMEVQEVIEQAMAAKEK---------
BIOB_BRUA1       SKLLNIKTGGCPEDCGYCSQSASAENGLKAS--KLMEIETVLEEARKAKAA---------
BIOB_BRUA2       SKLLNIKTGGCPEDCGYCSQSASAENGLKAS--KLMEIETVLEEARKAKAA---------
BIOB_BRUAB       SKLLNIKTGGCPEDCGYCSQSASAENGLKAS--KLMEIETVLEEARKAKAA---------
BIOB_BRUC2       SKLLNIKTGGCPEDCGYCSQSASAENGLKAS--KLMEIETVLEEARKAKAA---------
BIOB_BRUMB       SKLLNIKTGGCPEDCGYCSQSASAENGLKAS--KLMEIETVLEEARKAKAA---------
BIOB_BRUME       SKLLNIKTGGCPEDCGYCSQSASAENGLKAS--KLMEIETVLEEARKAKAA---------
BIOB_BRUSI       SKLLNIKTGGCPEDCGYCSQSASAENGLKAS--KLMEIETVLEEARKAKAA---------
BIOB_BRUSU       SKLLNIKTGGCPEDCGYCSQSASAENGLKAS--KLMEIETVLEEARKAKAA---------
BIOB_BRUO2       SKLLNIKTGGCPEDCGYCSQSASAENGLKAS--KLMEIETVLEEARKAKAA---------
BIOB_OCHA4       SKLLNIKTGGCPEDCGYCSQSAHHASGLKAS--KLMSLDTVLEEAQKAKDS---------
BIOB_AGRFC       SRLLSIKTGGCPEDCSYCSQSARNPTGLKAS--KLMEVERVLAEARKAKEG---------
BIOB2_PARDP      SKLLSIKTGGCPEDCAYCSQSARNGSELSAS--KLMEVQRVLAEARRAKEA---------
BIOB_LEGPA       ATLLSIKTGACPEDCGYCSQSGHYKTHVEKE--KLMSVEEVLQCAKEAKEG---------
BIOB_LEGPH       ATLLSIKTGACPEDCGYCSQSGHYKTHVEKE--KLMSVEEVLQCAKEAKEG---------
BIOB_LEGPL       ATLLSIKTGACPEDCGYCSQSGHYKTHVEKE--KLMSVEEVLQCAKEAKEG---------
BIOB_LEGPC       ATLLSIKTGACPEDCGYCSQSGHYKTHVEKE--KLMSVEEVLQCAKEAKEG---------
BIOB_RUTMC       SSLLNIKTGACPEDCSYCSQSSKYDTG--LEREKLMEIDLVLQQAKEAQDI---------
BIOB_VESOH       SSLLNIKTGACPEDCLYCSQSSKYDTG--LEREKLMEIDLVLKQAKQAQDN---------
BIOB_HAEI8       STLMSIKTGGCPEDCSYCPQSARYHTG--VQNQQLLDVDEIVAKAKIAKAR---------
BIOB_HAEIE       STLMSIKTGGCPEDCSYCPQSARYHTG--VQNQQLLDVDEIVAKAKIAKAR---------
BIOB_HAEIN       STLMSIKTGGCPEDCSYCPQSARYHTG--VQNQQLLDVDEIVAKAKIAKAR---------
BIOB_HAEIG       STLMSIKTGGCPEDCGYCPQSARYHTG--VQNQQLLDVNEIIAKAKIAKAR---------
BIOB_HAES1       STLMSIKTGGCPEDCSYCPQSARYHTG--VQNQQLLCVEEIVEKAKIAKSR---------
BIOB_HISS2       STLMSIKTGGCPEDCSYCPQSARYHTG--VQNQQLLCVEEIVEKAKIAKSR---------
BIOB_PASMU       STLMSIKTGGCPEDCGYCPQSARYHTG--VEKQQLLDVEEIVEKAKIAKAR---------
BIOB_ACTSZ       STLMSIKTGGCPEDCGYCPQSARYRTG--VQKQALLEVEDIVEKAKIAKSR---------
BIOB_MANSM       STLMSIKTGGCPEDCGYCPQSARYQTG--VQKQELLNVEDIVEKAKIAKSR---------
BIOB_ACTP7       STLLSIKTGGCPEECEYCPQSARYDTG--LEKQVMMDVEEIVEKAKIAKAR---------
BIOB_ACTPJ       STLLSIKTGGCPEECEYCPQSARYDTG--LEKQVMMDVEEIVEKAKIAKAR---------
BIOB_ACTP2       STLLSIKTGGCPEECEYCPQSARYDTG--LEKQVMMDVEEIVEKAKIAKAR---------
BIOB_HAEDU       STLLSIKTGGCPEECEYCPQSARYDTG--LEKQVMLDIEEIVEKAKIAKQR---------
BIOB_HAEPS       STLLSIKTGGCAEDCEYCPQSARYDTG--VEKQSMLDVNYIVEKAQIAKAR---------
BIOB_NEIG1       STLLSIKTGGCPEDCAYCPQSAHHNTN--LGKEQMMDVDEIVEKAKIAKSR---------
BIOB_NEIG2       STLLSIKTGGCPEDCAYCPQSAHHNTN--LGKEQMMDVDEIVEKAKIAKSR---------
BIOB_NEIM0       STLLSIKTGGCPEDCAYCPQSAHHNTN--LGKEQMMDVDEIVEKAKIAKSR---------
BIOB_NEIMF       STLLSIKTGGCPEDCAYCPQSAHHNTN--LGKEQMMDVDEIVEKAKIAKSR---------
BIOB_NEIMA       STLLSIKTGGCPEDCAYCPQSAHHNTN--LGKEQMMDVDEIVEKAKIAKSR---------
BIOB_NEIMB       STLLSIKTGGCPEDCAYCPQSAHHNTN--LGKEQMMDVDEIVEKAKIAKSR---------
BIOB_CHRVO       STLVSIKTGGCPEDCGYCPQSVHHDTP--VADQPMMTVDEVVAAARQAKAN---------
BIOB_METSK       STLLSIKTGGCSEDCGYCPQAARYHTD--VEKQD-LHAAGRGTRSRVLPRR---------
BIOB_METFK       STLLSIKTGGCSEDCGYCPQAARYHTD--VEKQDLMQLEEVLAAARAAKEN---------
BIOB_THIDA       STLLSIKTGGCSEDCGYCPQSVHYDAG--VESQGLLDLGDVLKAARAAKDA---------
BIOB_NITEC       STLLSVKTGGCSEDCAYCPQAARYHTG--VENQAILSREEVVMAATKAKES---------
BIOB_NITEU       STLISVKTGGCSEDCAYCPQAARYHTG--VENQAILSREEVVAAATQAKES---------
BIOB_NITMU       STLISVKTGGCPEDCGYCPQAARYHTN--VENQDMLTVEDVIAAAAAAKAQ---------
BIOB_ACISJ       ATLLSVKTGGCPENCGYCPQSAEFDTG--VKAEKLMNVQEVTQAAQAAKDA---------
BIOB_ACIET       ATLLSVKTGGCPENCGYCPQSAEFDTG--VKAEKLMSVQEVTQAAQAAKDA---------
BIOB_DELAS       ATLLSVKTGGCPENCGYCPQAAEFDTG--VKAEKLMSVDEVTRAAQAAKDA---------
BIOB_ACIAC       ATLLSVKTGGCPENCGYCPQSAEFDTG--VKAQKLMSVDEVTTAARAARDA---------
BIOB_METPP       STLLSIKTGGCPEDCAYCPQSVHHDTG--VEADKLMDVATVRQAAQAAAAA---------
BIOB1_POLSJ      ATLLSVKTGGCAEDCGYCPQAARYDTG--VEASKLMEPAEVLAAAQRAQAA---------
BIOB_HERAR       ATLLSIKTGGCPEDCGYCPQAARYDTG--VTAQKILPLEEVLTAAREAKAH---------
BIOB_JANMA       ATLLSIKTGGCPEDCGYCPQAARYDTG--VTAQKILPLEEVLTAAREAKAH---------
BIOB_RHOFT       ATLLSIKTGGCEEDCSYCPQAARYDTG--VEAQKILELEQVLDAAREARAS---------
BIOB_POLAQ       ATLLSIKTGGCPEDCSYCPQAARYDTD--VKAEKLMGLEEVLEAAKAAKAA---------
BIOB_BORBR       SSLLSIKTGGCPEDCAYCPQSAHYDTG--VDADKLMPLDEVVRAARAAQAN---------
BIOB_BORPA       SSLLSIKTGGCPEDCAYCPQSAHYDTG--VDADKLMPLDEVVRAARAAQAN---------
BIOB_BORPE       SSLLSIKTGGCPEDCAYCPQSAHYDTG--VDADKLMPLDEVVRAARAAQAN---------
BIOB_BORPD       SSLLSIKTGGCPEDCAYCPQSAHYDTG--LAADKLMPLEDVLQAARAAQAG---------
BIOB_BORA1       SSLLSIKTGGCPEDCGYCSQSARHDSG--LAAEKLMPLDEVLAEARAAKNA---------
BIOB_BURCM       STLLSIKTGGCEEDCGYCSQSSHHDTG--LKAEKLMDVDAVLDAARAAKAN---------
BIOB_BURL3       STLLSIKTGGCEEDCGYCSQSSHHDTG--LKAEKLMDVDAVLDAARAAKAN---------
BIOB_BURA4       STLLSIKTGGCEEDCGYCSQSSHHDTG--LKAEKLMDVDAVLDAARAAKAN---------
BIOB_BURVG       STLLSIKTGGCEEDCGYCSQSSHHDTG--LKAEKLMDVDAVLEAARAAKAS---------
BIOB_BURM1       STLLSIKTGGCEEDCGYCSQSAHHDTG--LKAEKLMDVDAVLDAARAAKAN---------
BIOB_BURCA       STLLSIKTGGCEEDCGYCSQSSHHDTG--LKAEKLMDVDTVLDAARAAKAN---------
BIOB_BURCC       STLLSIKTGGCEEDCGYCSQSSHHDTG--LKAEKLMDVDTVLDAARAAKAN---------
BIOB_BURCH       STLLSIKTGGCEEDCGYCSQSSHHDTG--LKAEKLMDVDTVLDAARAAKAN---------
BIOB_BURCJ       STLLSIKTGGCEEDCGYCSQSSHHDTG--LKAEKLMDVDTVLDAARAAKAN---------
BIOB_BURM7       STLLSIKTGGCEEDCGYCSQSAHHDTG--LKAEKLMEVDAVLAAARTAKEN---------
BIOB_BURM9       STLLSIKTGGCEEDCGYCSQSAHHDTG--LKAEKLMEVDAVLAAARTAKEN---------
BIOB_BURP6       STLLSIKTGGCEEDCGYCSQSAHHDTG--LKAEKLMEVDAVLAAARTAKEN---------
BIOB_BURMA       STLLSIKTGGCEEDCGYCSQSAHHDTG--LKAEKLMEVDAVLAAARTAKEN---------
BIOB_BURMS       STLLSIKTGGCEEDCGYCSQSAHHDTG--LKAEKLMEVDAVLAAARTAKEN---------
BIOB_BURP0       STLLSIKTGGCEEDCGYCSQSAHHDTG--LKAEKLMEVDAVLAAARTAKEN---------
BIOB_BURPS       STLLSIKTGGCEEDCGYCSQSAHHDTG--LKAEKLMEVDAVLAAARTAKEN---------
BIOB_BURP1       STLLSIKTGGCEEDCGYCSQSAHHDTG--LKAEKLMEVDAVLAAARTAKEN---------
BIOB_BURTA       STLLSIKTGGCEEDCGYCSQSAHHDTG--LKAEKLMEVDAVLAAARTAKEN---------
BIOB_PARPJ       STLLSIKTGGCEEDCAYCPQSVHHDTG--LQADKLMPVDEVLAAAKVAKEN---------
BIOB_PARXL       STLLSIKTGGCEEDCAYCPQSVHHDTG--LQADKLMPVDEVLAAAKVAKEN---------
BIOB_PARP8       STLLSIKTGGCEEDCAYCPQSVHHETG--LKAEKLMEVEEVLAAARVAKEN---------
BIOB_CUPTR       STLLSIKTGGCEEDCGYCPQSAHHDAG--VKAEKLMALEEVLDAARAAKAN---------
BIOB_CUPNH       STLLSIKTGGCEEDCGYCPQSAHHDAG--VKAEKLMALDEVLDAARAAKAN---------
BIOB_CUPPJ       STLLSIKTGGCEEDCGYCPQSAHHDAG--VKAEKLMELDEVLEAARAAKAN---------
BIOB_CUPMC       STLLSIKTGGCEEDCGYCPQSAHHDAG--VKAEKLMDLEAVLDAAKAAKAN---------
BIOB_POLNA       STLLSIKTGGCAEDCGYCPQSSHFETE--VKASKLMALDEVMAAAQAAKDQ---------
BIOB2_POLSJ      STLLSIKTGGCAEDCGYCPQSTHFETE--VKASKLMPLAEVIEAARAAKDQ---------
BIOB_LEPCP       STLLSIKTGGCAEDCGYCPQSAHFDTA--VEASKLMPIDEVLDAANAAKAQ---------
BIOB_RALPJ       STLLSIKTGGCPEDCSYCPQSARYDTG--VEAEKLMPIDAVLEAASRAKQN---------
BIOB_RALSO       STLLSIKTGGCPEDCSYCPQSARYDTG--VEAEKLMPIDTVLEAAARAKQN---------
BIOB_AZOSB       STLLSIKTGGCSEDCGYCSQSARYDTG--LERERLLPLDEVLEHARAAKAK---------
BIOB_AROAE       STLLSIKTGGCSEDCGYCSQSTRHNTG--LDREQLLKVAEVVEHAKAAKAK---------
BIOB_DECAR       STLLSVKTGGCSEDCSYCSQSARYDTD--TERERLMPLDQVVAAAKAAKDK---------
BIOB_GLUDA       STLLSIKTGGCPEDCAYCPQSAKHEDGG-VKASRLMAVEAVLKEARAARDA---------
BIOB_GLUOX       STLLSIKTGGCPEDCAYCPQSALHEKS--VKAERLMAVESVIKEARAAKKA---------
BIOB_GRABC       STLLSIKTGGCPEDCAYCPQAAQYDTG--VEASRLMRVDAVLEEARAAKAA---------
BIOB_ACICJ       STLLSIKTGGCPEDCGYCPQSAEFDVG--VKASKLMDIAPVLEAARRAKEA---------
BIOB_STRM5       STLLSVKTGGCPEDCAYCPQAQRYNTG--VNAQKLMETDAVLAKARQAKAA---------
BIOB_STRMK       STLLSVKTGGCPEDCAYCPQAQRYSTG--VNAQKLMETDAVLAKARQAKAA---------
BIOB_XANAC       STLLSVKTGGCPEDCAYCPQAQRYDTG--VSAQKLMETEEVVAKARQAKAA---------
BIOB_XANC5       STLLSVKTGGCPEDCAYCPQAQRYDTG--VSAQKLMETEEVVAKARQAKAA---------
BIOB_XANOM       STLLSVKTGGCPEDCAYCPQAQRYDTG--VTAQKLLETEEVVAKARQAKAA---------
BIOB_XANOP       STLLSVKTGGCPEDCAYCPQAQRYDTG--VTAQKLLETEEVVAKARQAKAA---------
BIOB_XANOR       STLLSVKTGGCPEDCAYCPQAQRYDTG--VTAQKLLETEEVVAKARQAKAA---------
BIOB_XANC8       STLLSVKTGGCPEDCAYCPQAQRYDTG--VSAQKLMDTEDVVAKARQAKAA---------
BIOB_XANCB       STLLSVKTGGCPEDCAYCPQAQRYDTG--VSAQKLMDTEDVVAKARQAKAA---------
BIOB_XANCP       STLLSVKTGGCPEDCAYCPQAQRYDTG--VSAQKLMDTEDVVAKARQAKAA---------
BIOB_XYLF2       STLLSVKTGGCPEDCSYCPQAQRYDTG--VTAQKLMDVDAVVAKARQAKLA---------
BIOB_XYLFT       STLLSVKTGGCPEDCSYCPQAQRYDTG--VTAQKLMDVDAVVAKARQAKLA---------
BIOB_XYLFM       STLLSVKTGGCPEDCSYCPQAQRYDTG--VTAQKLMDVDAVVAKARQAKLA---------
BIOB_XYLFA       STLLSVKTGGCPEDCSYCPQAQRYDTG--VTAQKLMDVDAVVAKARQAKLA---------
BIOB_AZOC5       AQLLSIKTGGCPEDCGYCSQSAHHDTG--VAATRLMDVEAVLAEARKAKAA---------
BIOB_XANP2       ATLLSIKTGGCAEDCGYCSQSAHHETG--LKATKLMGVEEVLSQAQKAKDG---------
BIOB_RHOS1       ASLLSIKTGGCPEDCGYCSQSAHHDTG--VKATKLMAEEEVLAAARRAKAA---------
BIOB_RHOS4       ASLLSIKTGGCPEDCGYCSQSAHHDTG--VKATKLMGTEEVLAAARRAKAA---------
BIOB_RHOSK       ASLLSIKTGGCPEDCGYCAQSAHHDTG--VKATKLMATEEVLAAARRAKAA---------
BIOB1_PARDP      ASLLSIKTGGCPEDCGYCSQSAHHDTG--VKATKLMGTEEVLAAARRAKAS---------
BIOB_BRASB       ASLLSIKTGGCPEDCGYCSQSAHYDTG--LKATKLMDRDTVVATAQRAKAA---------
BIOB_BRASO       ASLLSIKTGGCPEDCGYCSQSAHYDTG--LKATKLMDQDAVVATARRAKEA---------
BIOB_NITHX       ANLLSIKTGGCPEDCGYCSQSAHYDSG--VKATKLMDREAVIETARRARDA---------
BIOB_NITWN       ASLLSIKTGGCPEDCGYCAQSAHYDAG--VKATKLMDKDAVLETARRAKDA---------
BIOB_OLICO       ASLLSIKTGGCAEDCGYCSQSAHYKTD--VKATKLMAHDDVVATARRAKES---------
BIOB_BRADU       ASLLSIKTGGCPEDCGYCSQSAHYATG--LKATRLMRCADVVATAQRAKDA---------
BIOB_RHOPA       NQLLNVKTGGCAEDCGYCSQSAHHDTA--LPASKLMEPAKVIEAAKAARDA---------
BIOB_RHOPT       NQLLNVKTGGCAEDCGYCSQSAHHDTA--LPASKLMEPAKVIEAAKAARDA---------
BIOB_RHOPS       NQLLNVKTGGCAEDCGYCSQSSHHDTA--LPASKLMDPAKVIEGAKAARDA---------
BIOB_RHOP2       NQLLNVKTGGCAEDCGYCSQSAHHDTA--LPASKLMDPKKVIEGAKAARDA---------
BIOB_RHOP5       NQLLNVKTGGCAEDCGYCSQSAHHDTA--LPASKLMDPKKVIEAAKAARDA---------
BIOB_RHOPB       NQLLNVKTGGCAEDCGYCGQSAHHHTD--LPASKLMAPADVIESAKAAKAG---------
BIOB_CAUVN       SQLLSVKTGGCAENCGYCSQSAHFKTG--LKADKLMAADDVVAKARAARDG---------
BIOB_CAUVC       SQLLSVKTGGCAENCGYCSQSAHFKTG--LKADKLMAADDVVAKARAARDG---------
BIOB_CAUSK       SQLLSVKTGGCAENCGYCSQSAHFKTG--LKAEKLMDAEVVIAKAREARDG---------
BIOB_PHEZH       SQLLSVKTGGCPEDCGYCAQSQKFKTG--LAASKLMEAETVIAAAAEAKAG---------
BIOB_HYPNA       SQLLSIKTGGCAENCGYCSQSASFKTG--LKAEKLLPVEEVVDAARRAKAN---------
BIOB_MARMM       SQLLSIKTGGCAEDCGYCNQSAHFDTG--LKASKLMPLDDVLDAAKKAKDG---------
BIOB_ERYLH       CTLLSIKTGGCPEDCGYCSQSVKADSG--VEATKLMDVQRVLQSAAQAKDA---------
BIOB_NOVAD       CTLLSIKTGGCPEDCGYCSQSVKADSG--VEATKLMEVQKVLQSAAQAKDN---------
BIOB_SPHAL       CTLLSIKTGGCVEDCGYCSQSAHADTG--LKATKLMDVRAVLQAAAQAKDA---------
BIOB_SPHWW       STLLSIKTGGCPEDCGYCNQSVHAETG--LKATKLMDVRAVLQSAAQARDA---------
BIOB_PARL1       STLLSIKTGGCPEDCGYCAQSSKFDTG--LKASKLMEVEKVLAEARKAKEA---------
BIOB_ACIF2       STLLSIKTGGCPEDCGYCSQSVHHQTA--LQAEPLMDLEQVRAAAREAKAN---------
BIOB_ACIF5       STLLSIKTGGCPEDCGYCSQSVHHQTA--LQAEPLMDLEQVRAAAREAKAN---------
BIOB_NITOC       STLLSIKTGGCPEDCAYCPQSVRYSTP--VKAEPLLPLEEVLTAARNAKAR---------
BIOB_THISH       STLLSIKTGACPEDCGYCPQSAHHEVE--LERERLLPLEEVLEAARNARSH---------
BIOB_ALKEH       STLLSIKTGACPEDCKYCPQSVRYDTG--LEREQILAVEEVVAAARRARDA---------
BIOB_HALHL       CTLVSIKTGACAEDCTYCSQSARYDTG--LEREALIDVETVREAAQRARAS---------
BIOB_ALCBS       STLLSIKTGACPEDCKYCSQSGHYNTE--LEKEKLLEVSRVVEEARAARQN---------
BIOB_METCA       SSLLSIKTGACSEDCAYCPQSAHYETG--VKRESLMSLEDVLEAAQRAREE---------
BIOB_MAGSA       SRLISIKTGSCPEDCSYCPQSAHYATG--LEKEKLLAVEEVVESARQAKEE---------
BIOB_ACIB3       STLLSIKTGKCPEDCKYCSQSAHYDSK--LEAEKRIAVEKVISEAKAAKDS---------
BIOB_ACIB5       STLLSIKTGKCPEDCKYCSQSAHYDSK--LEAEKRIAVEKVISEAKAAKDS---------
BIOB_ACIBY       STLLSIKTGKCPEDCKYCSQSAHYDSK--LEAEKRIAVEKVISEAKAAKDS---------
BIOB_ACIBC       STLLSIKTGKCPEDCKYCSQSAHYDSK--LEAEKRIAVEKVISEAKAAKDS---------
BIOB_ACIBT       STLLSIKTGKCPEDCKYCSQSAHYDSK--LEAEKRIAVEKVISEAKAAKDS---------
BIOB_ACIBS       STLLSIKTGKCPEDCKYCSQSAHYDSK--LEAEKRIAVEKVISEAKAAKDS---------
BIOB_ACICA       STLLSIKTGKCPEDCKYCSQSAHYDSK--LEAEKRIAVDKVISEAQAAKES---------
BIOB_ACIAD       STLLSIKTGKCPEDCKYCSQSAHYDSK--LEAEKRIAVDKVISEAKAAKDS---------
BIOB_PSYA2       STLLSIKTGNCPEDCGYCSQSGHHRDKTELVAEKRIEVSKVIAAAKRAKAT---------
BIOB_PSYCK       STLLSIKTGNCPEDCGYCSQSGHHRDKTKLVAEKRIEVDKVIAAAKRAKAT---------
BIOB_PSYWF       STLLSIKTGNCPEDCGYCSQSGHHRDTTGLQAEKRLEIDKVIAAAKRAKAS---------
BIOB_CELJU       STLCSIKTGACPEDCAYCPQSARYDTG--LEKEKLMAVEKVIEEARAAKAS---------
BIOB_SACD2       STLCSIKTGACPEDCAYCPQSARYDTG--LEREKLMAVEKVLEEAKAAKDS---------
BIOB_HAHCH       STLLSIKTGACPEDCKYCPQSGHYNTG--LEKEKLLEVEKVVNEAKAAKEK---------
BIOB_MARHV       STLLSIKTGACPEDCKYCPQSGHYNTG--LEKEKLLEIEKVVAEARVAREK---------
BIOB_CHRSD       STLLSIKTGACPEDCKYCPQSGHYNTG--LGKEKLLEIEKVVEQARAAKAA---------
BIOB_PSE14       STLLSIKTGACPEDCKYCPQSGHYNTG--LEKEKLLEVQKVLEEAARAKAI---------
BIOB_PSEU2       STLLSIKTGACPEDCKYCPQSGHYNTG--LEKEKLLEVQKVLEEAARAKAI---------
BIOB_PSESM       STLLSIKTGACPEDCKYCPQSGHYNTG--LEKEKLLEVQKVLEEAARAKSI---------
BIOB_PSEF5       STLLSIKTGACPEDCKYCPQSGHYNTG--LEKEKLLEVQKVLEEAARAKAI---------
BIOB_PSEPF       STLLSIKTGACPEDCKYCPQSGHYNTG--LEKEKLMEVQKVLEEAARAKAI---------
BIOB_PSEP1       STLLSIKTGACPEDCKYCPQSGHYNTG--LEKQKLMEVQKVLEEAARAKAI---------
BIOB_PSEPK       STLLSIKTGACPEDCKYCPQSGHYNTG--LEKQKLMEVQKVLEEAARAKAI---------
BIOB_PSEPG       STLLSIKTGACPEDCKYCPQSGHYNTG--LEKQKLMEVQKVLEEAARAKAI---------
BIOB_PSEPW       STLLSIKTGACPEDCKYCPQSGHYNTG--LEKQKLMEVQKVLEEAARAKAI---------
BIOB_PSEE4       STLLSIKTGACPEDCKYCPQSGHYNTG--LEKQKLMEVQKVLEEAARAKAI---------
BIOB_PSEA8       STLLSIKTGACPEDCKYCPQSGHYNTG--LDKEKLMEVQKVLEAAAEAKAI---------
BIOB_PSEAE       STLLSIKTGACPEDCKYCPQSGHYNTG--LDKEKLMEVQKVLEAAAEAKAI---------
BIOB_PSEAB       STLLSIKTGACPEDCKYCPQSGHYNTG--LDKEKLMEVQKVLEAAAEAKAI---------
BIOB_PSEA7       STLLSIKTGACPEDCKYCPQSGHYNTG--LDKEKLMEVQKVLEAAAEAKAI---------
BIOB_PSEMY       STLLSIKTGACPEDCKYCPQSGHYNTG--LDKEKLMEVEKVLQAAAEAKAI---------
BIOB_PSEU5       STLLSIKTGACPEDCKYCPQSGHYNTG--LDKEKLMEVQKVLEAAAEAKAI---------
BIOB_IDILO       STLLSIKTGACPEDCKYCPQSAHYHTG--LDRERLMAVESVLAEAQAAKEK---------
BIOB_COLP3       STLLSIKTGACPEDCKYCSQSARNKTD--LEKESLLAVEKVLEAAQRAKEM---------
BIOB_PSYIN       STLLSIKTGACPEDCKYCPQSARYNTG--LAKEQLIEVAKVVKAAKEAKAT---------
BIOB_MARMS       STLLSIKTGACPEDCKYCPQSGHYNTE--LEKEKLMEVQKVLEEAALAKEK---------
BIOB_PSEHT       STLLSIKTGACPEDCKYCPQSGHYRTD--LERERLIEVEKVVEQARLAKQK---------
BIOB_SHEB2       SRLLSIKTGACPEDCKYCPQSARYDTG--LEKERLLAMETVLTEARSAKAA---------
BIOB_SHEB5       SRLLSIKTGACPEDCKYCPQSARYDTG--LEKERLLAMETVLTEARSAKAA---------
BIOB_SHEB8       SRLLSIKTGACPEDCKYCPQSARYDTG--LEKERLLAMETVLTEARSAKAA---------
BIOB_SHEB9       SRLLSIKTGACPEDCKYCPQSARYDTG--LEKERLLAMETVLTEARSAKAA---------
BIOB_SHESA       SRLLSIKTGACPEDCKYCPQSARYDTG--LEKERLLAMETVLTEARSAKAA---------
BIOB_SHESM       SRLLSIKTGACPEDCKYCPQSARYDTG--LEKERLLAMETVLTEARSAKAA---------
BIOB_SHESR       SRLLSIKTGACPEDCKYCPQSARYDTG--LEKERLLAMETVLTEARSAKAA---------
BIOB_SHEON       SRLLSIKTGACPEDCKYCPQSARYDTG--LEKERLLAMETVLTEARSAKAA---------
BIOB_SHEPC       SRLLSIKTGACPEDCKYCPQSARYDTG--LEKERLLAMETVLTEARSAKAA---------
BIOB_SHESW       SRLLSIKTGACPEDCKYCPQSARYDTG--LEKERLLAMETVLTEARSAKAA---------
BIOB_SHEHH       SRLLSIKTGACPEDCKYCPQSARYDTG--LEKERLLAMETVLTEARSAKAA---------
BIOB_SHEPA       SRLLSIKTGACPEDCKYCPQSARYDTG--LEKERLLAMETVLTEARSAKAA---------
BIOB_SHEPW       SRLLSIKTGACPEDCKYCPQSARYDTG--LEKERLLAMETVLTEARSAKAA---------
BIOB_SHEDO       SRLLSIKTGACPEDCKYCPQSARYDTG--LEKERLLEIEKVLTEAKSAKAA---------
BIOB_SHEFN       SRLLSIKTGACPEDCKYCPQSARYDTG--LEKERLLEIDKVLTEAKSAKAA---------
BIOB_SHESH       SRLLSIKTGACPEDCKYCPQSARYDTG--LEKERLIEIEKVLTEARSAKAA---------
BIOB_SHEWM       SRLLSIKTGACPEDCKYCPQSARYDTG--LEKERLIEIEKVLTEARSAKAA---------
BIOB_SHELP       SRLLSIKTGACPEDCKYCPQSARYDTG--LEKERLIEIEKVLTEARAAKAA---------
BIOB_SHEAM       SRLLSIKTGACPEDCKYCPQSARYDTG--LEKERLLEIEKVLTEARAAKDA---------
BIOB_AERHH       STLLSIKTGACPEDCKYCPQSARYHTG--LEAERLMEVEKVLERAREAKAN---------
BIOB_AERS4       STLLSIKTGACPEDCKYCPQSARYHTG--LETERLMEVEKVLERAREARAN---------
BIOB_ALTMD       STLLSIKTGACPEDCKYCPQSARYDTG--LEKERLLEIEKVIQRAKEAKQV---------
BIOB_PSEA6       STLLSIKTGACPEDCKYCPQSARYDTG--LEKERLMEIEKVIQRAREAKAA---------
BIOB_ALIF1       STLLSIKTGACPEDCKYCPQSAHYRTD--VDRERLMEVESVLDAAKKAKNS---------
BIOB_ALIFM       STLLSIKTGACPEDCKYCPQSAHYRTD--VDRERLMEVESVLDAAKKAKNS---------
BIOB_ALISL       STLLSIKTGACPEDCKYCPQSAHYRTD--VDRERLMEVESVLDAAKKAKDS---------
BIOB_VIBC3       STLLSIKTGACPEDCKYCPQSAHYRTD--VDKERLMEVERVLDAAQKAKNS---------
BIOB_VIBCH       STLLSIKTGACPEDCKYCPQSAHYRTD--VDKERLMEVERVLDAAQKAKNS---------
BIOB_VIBTL       STLLSIKTGACPEDCKYCPQSAHYRTD--VDKERLMEVERVLDAAQKAKNA---------
BIOB_VIBCB       STLLSIKTGACPEDCKYCPQSARYTTD--IEKERLMEVERVLDAAQKAKNA---------
BIOB_VIBPA       STLLSIKTGACPEDCKYCPQSARYTTD--IEKERLMEVERVLDAAQKAKNA---------
BIOB_VIBVU       STLLSIKTGACPEDCKYCPQSARYQTD--VEKERLMEVERVLDAAQKAKNA---------
BIOB_VIBVY       STLLSIKTGACPEDCKYCPQSARYQTD--VEKERLMEVERVLDAAQKAKNA---------
BIOB_PHOPR       STLLSIKTGACPEDCKYCPQSAHYRTD--VERERLLEVEKVLDAAQKAKVS---------
BIOB_BUCA5       STLLSIKTGSCPEDCKYCPQSSRYKTG--LKKEPLLEIEQILSAAKKAKDS---------
BIOB_BUCAT       STLLSIKTGSCPEDCKYCPQSSRYKTG--LKKEPLLEIEQILSAAKKAKDS---------
BIOB_BUCAI       STLLSIKTGSCPEDCKYCPQSSRYKTG--LKKEPLLEIEQILSAAKKAKDS---------
BIOB_BUCAP       STLLSIKTGACPEDCKYCPQSSRYKTG--LKKEPLLEIEQILKAAKKAKSS---------
BIOB_BUCBP       STLLSIKTGACPEDCKYCPQSARYKTN--IKIEKLLTLKQILKSAQQAKKL---------
BIOB_WIGBR       STLLSIKTGLCPEDCKYCSQSSRYKTG--LVSEKLIKIEKVINAAKKAKKS---------
BIOB_BAUCH       STLLSIKTGNCAEDCKYCPQSSHYETK--LDNEPLVQLPQVLAAAKKASDA---------
BIOB_PECAS       STLLSIKTGSCPEDCKYCPQSSRYRTG--IDTERLMQVEQVLDSARQAKAA---------
BIOB_ERWT9       STLLSIKTGACPEDCKYCPQSARYKTG--LEAERLMEVEEVLSSARKAKAA---------
BIOB_SERMA       STLLSIKTGACPEDCKYCPQSPRYKTG--LESERLMQVEQVLESARKAKAN---------
BIOB_SERP5       STLLSIKTGACPEDCKYCPQSSRYKTG--LESERLMQVEQVLESARKAKAN---------
BIOB_YERPA       STLLSIKTGACPEDCKYCPQSSRYKTG--LESERLMQVEQVLESAKKAKAA---------
BIOB_YERPB       STLLSIKTGACPEDCKYCPQSSRYKTG--LESERLMQVEQVLESAKKAKAA---------
BIOB_YERPE       STLLSIKTGACPEDCKYCPQSSRYKTG--LESERLMQVEQVLESAKKAKAA---------
BIOB_YERPG       STLLSIKTGACPEDCKYCPQSSRYKTG--LESERLMQVEQVLESAKKAKAA---------
BIOB_YERPN       STLLSIKTGACPEDCKYCPQSSRYKTG--LESERLMQVEQVLESAKKAKAA---------
BIOB_YERPP       STLLSIKTGACPEDCKYCPQSSRYKTG--LESERLMQVEQVLESAKKAKAA---------
BIOB_YERPS       STLLSIKTGACPEDCKYCPQSSRYKTG--LESERLMQVEQVLESAKKAKAA---------
BIOB_YERPY       STLLSIKTGACPEDCKYCPQSSRYKTG--LESERLMQVEQVLESAKKAKAA---------
BIOB_YERP3       STLLSIKTGACPEDCKYCPQSSRYKTG--LESERLMQVEQVLESAKKAKAA---------
BIOB_YERE8       STLLSIKTGACPEDCKYCPQSSRYKTG--LESERLMQVEQVLESAKKAKAA---------
BIOB_PSEVU       STLLSIKTGACPEDCKYCPQSSRYKTG--LETERLMEVEQVLDSARKAKNA---------
BIOB_ENT38       STLLSIKTGACPEDCKYCPQSARYKTG--LEAERLMEVEQVLDSARKAKNA---------
BIOB_KLEP3       STLLSIKTGACPEDCKYCPQSARYKTG--LETERLMEVEQVLESARQAKNA---------
BIOB_KLEP7       STLLSIKTGACPEDCKYCPQSARYKTG--LEAERLMEVEQVLESARQAKNA---------
BIOB_SALPB       STLLSIKTGACPEDCKYCPQSSRYKTG--LEAERLMEVEQVLDSARKAKNA---------
BIOB_SALPC       STLLSIKTGACPEDCKYCPQSSRYKTG--LEAERLMEVEQVLDSARKAKNA---------
BIOB_SALNS       STLLSIKTGACPEDCKYCPQSSRYKTG--LEAERLMEVEQVLDSARKAKNA---------
BIOB_SALTY       STLLSIKTGACPEDCKYCPQSSRYKTG--LEAERLMEVEQVLDSARKAKNA---------
BIOB_SALCH       STLLSIKTGACPEDCKYCPQSSRYKTG--LEAERLMEVEQVLDSARKAKNA---------
BIOB_SALA4       STLLSIKTGACPEDCKYCPQSSRYKTG--LEAERLMEVEQVLDSARKAKNA---------
BIOB_SALTI       STLLSIKTGACPEDCKYCPQSSRYKTG--LEAERLMEVEQVLDSARKAKNA---------
BIOB_SALHS       STLLSIKTGACPEDCKYCPQSSRYKTG--LEAERLMEVEQVLDSARKAKNA---------
BIOB_SALPA       STLLSIKTGACPEDCKYCPQSSRYKTG--LEAERLMEVEQVLDSARKAKNA---------
BIOB_SALDC       STLLSIKTGACPEDCKYCPQSSRYKTG--LEAERLMEVEQVLDSARKAKNA---------
BIOB_SALEP       STLLSIKTGACPEDCKYCPQSSRYKTG--LEAERLMEVEQVLDSARKAKNA---------
BIOB_SALSV       STLLSIKTGACPEDCKYCPQSSRYKTG--LEAERLMEVEQVLDSARKAKNA---------
BIOB_SALPK       STLLSIKTGACPEDCKYCPQSSRYKTG--LEAERLMEVEQVLDSARKAKNA---------
BIOB_SALG2       STLLSIKTGACPEDCKYCPQSSRYKTG--LEAERLMAVEQVLDSARKAKNA---------
BIOB_SALAR       STLLSIKTGACPEDCKYCPQSSRYKTG--LEAERLMEVEQVLESARKAKNA---------
BIOB_CITK8       STLLSIKTGACPEDCKYCPQSSRYKTG--LEAERLMEVEQVLDSARKAKNA---------
BIOB_SHIB3       STLLSIKTGACPEDCKYCPQSSRYKTG--LEAERLMEVEQVLESARKAKAA---------
BIOB_SHIBS       STLLSIKTGACPEDCKYCPQSSRYKTG--LEAERLMEVEQVLESARKAKAA---------
BIOB_ECO81       STLLSIKTGACPEDCKYCPQSSRYKTG--LEAERLMEVEQVLESARKAKAA---------
BIOB_ECOL6       STLLSIKTGACPEDCKYCPQSSRYKTG--LEAERLMEVEQVLESARKAKAA---------
BIOB_ECOK1       STLLSIKTGACPEDCKYCPQSSRYKTG--LEAERLMEVEQVLESARKAKAA---------
BIOB_ECOUT       STLLSIKTGACPEDCKYCPQSSRYKTG--LEAERLMEVEQVLESARKAKAA---------
BIOB_ECO45       STLLSIKTGACPEDCKYCPQSSRYKTG--LEAERLMEVEQVLESARKAKAA---------
BIOB_ECOL5       STLLSIKTGACPEDCKYCPQSSRYKTG--LEAERLMEVEQVLESARKAKAA---------
BIOB_SHIF8       STLLSIKTGACPEDCKYCPQSSRYKTG--LEAERLMEVEQVLESARKAKAA---------
BIOB_SHIFL       STLLSIKTGACPEDCKYCPQSSRYKTG--LEAERLMEVEQVLESARKAKAA---------
BIOB_ECO57       STLLSIKTGACPEDCKYCPQSSRYKTG--LEAERLMEVEQVLESARKAKAA---------
BIOB_ECO5E       STLLSIKTGACPEDCKYCPQSSRYKTG--LEAERLMEVEQVLESARKAKAA---------
BIOB_SHISS       STLLSIKTGACPEDCKYCPQSSRYKTG--LEAERLMEVEQVLESARKAKAA---------
BIOB_ECOLI       STLLSIKTGACPEDCKYCPQSSRYKTG--LEAERLMEVEQVLESARKAKAA---------
BIOB_ECOSM       STLLSIKTGACPEDCKYCPQSSRYKTG--LEAERLMEVEQVLESARKAKAA---------
BIOB_ECOLU       STLLSIKTGACPEDCKYCPQSSRYKTG--LEAERLMEVEQVLESARKAKAA---------
BIOB_ECOLC       STLLSIKTGACPEDCKYCPQSSRYKTG--LEAERLMEVEQVLESARKAKAA---------
BIOB_ECOHS       STLLSIKTGACPEDCKYCPQSSRYKTG--LEAERLMEVEQVLESARKAKAA---------
BIOB_ECODH       STLLSIKTGACPEDCKYCPQSSRYKTG--LEAERLMEVEQVLESARKAKAA---------
BIOB_ECO8A       STLLSIKTGACPEDCKYCPQSSRYKTG--LEAERLMEVEQVLESARKAKAA---------
BIOB_ECO7I       STLLSIKTGACPEDCKYCPQSSRYKTG--LEAERLMEVEQVLESARKAKAA---------
BIOB_ECO55       STLLSIKTGACPEDCKYCPQSSRYKTG--LEAERLMEVEQVLESARKAKAA---------
BIOB_ECO27       STLLSIKTGACPEDCKYCPQSSRYKTG--LEAERLMEVEQVLESARKAKAA---------
BIOB_ECO24       STLLSIKTGACPEDCKYCPQSSRYKTG--LEAERLMEVEQVLESARKAKAA---------
BIOB_SHIDS       STLLSIKTGACPEDCKYCPQSSRYKTG--LEAERLMEVEQVLESARKAKAA---------
BIOB_ECOSE       STLLSIKTGACPEDCKYCPQSSRYKTG--LEAERLMEVEQVLESARKAKAA---------
BIOB_ESCF3       STLLSIKTGACPEDCKYCPQSSRYKTG--LEAERLMEVEQVLESARKAKAA---------
BIOB_CROS8       STLLSIKTGACPEDCKYCPQSARYKTG--LEAERLMEVEQVLDSARKAKAA---------
BIOB_PHOLL       STLLSIKTGACPEDCKYCPQSSRYKTG--LEKERLMEVEQVIDSARKAKNA---------
BIOB_PROMH       STLLSIKTGACPEDCKYCAQSARYKTG--LEKERLMEVQQVIESAKKAKAA---------
BIOB_SODGM       STLLSIKTGACPEDCKYCPQSARYSTG--LESERLMQVQQVLDAARKARDA---------
BIOB_METI4       CQLLNIKSGGCSEDCKYCAQSAHYRTP--IEKGALLDEEEILQAGLQAKEK---------
BIOB_BACSU       NMIMNAKSGLCPENCGYCSQSAISKA--PIESYRMVNKETLLEGAKRAHDL---------
BIOB_BACNA       NMIMNAKSGLCPENCGYCSQSAISKA--PIESYRMVNKETLLEGAKRAHDL---------
BIOB_BACVZ       NMIMNAKSGLCPENCGYCSQSSISKA--PIESYRMVDKHILLKGAKRAHDL---------
BIOB_BACAM       NMIMNAKSGLCPENCGYCSQSSISKA--PIESYRMVDKHILLKGAKRAHDL---------
BIOB_BACLD       NMIMNAKSGLCPENCGYCSQSSISKA--PIDSYRMVDKTTLLEGAKRAHDL---------
BIOB_BACHD       NMIMNAKSGFCPENCGYCSQSSISKA--PIDAYPMVNKETILEGAKRAHEL---------
BIOB_GEOKA       NMIINAKSGLCPENCGYCSQSAVSTA--PVKTYKMVDKETLLRGAEEAHRL---------
BIOB_GEOTN       NMIMNAKSGLCPENCGYCSQSAVATA--PVKTYKMLDKETLLRGAEEAYRL---------
BIOB_ANOFW       NMIMNAKSGLCPENCGYCSQSSISTA--PIPTYKMVNKETILQGAKRAYEA---------
BIOB_LYSSH       NMIMNAKSGYCPEDCGYCSQSSKSTA--PIEKYPFITKEEILAGAKRAFEN---------
BIOB_LYSSC       NMIMNAKSGYCPEDCGYCSQSSKSTA--PIEKYPFITKEEILAGAKRAFDN---------
BIOB_BACAN       NMIINTKSGLCPEDCGYCSQSIISEA--PIDKYAWLTQEKIVEGAHEAIRR---------
BIOB_BACC0       NMIINTKSGLCPEDCGYCSQSIISEA--PIDKYAWLTQEKIVEGAHEAIRR---------
BIOB_BACCZ       NMIINTKSGLCPEDCGYCSQSIISEA--PIDKYAWLTQEKIVEGAHEAIRR---------
BIOB_BACHK       NMIINTKSGLCPEDCGYCSQSIISEA--PIDKYAWLTQEKIVEGAHEAIRR---------
BIOB_BACAH       NMIINTKSGLCPEDCGYCSQSIISEA--PIDKYAWLTQEKIVEGAHEAIRR---------
BIOB_BACC7       NMIINTKSGLCPEDCGYCSQSIISEA--PIDKYAWLTQEKIVEGAHEAIRR---------
BIOB_BACCQ       NMIINTKSGLCPEDCGYCSQSIISEA--PIDKYAWLTQEKIVEGAHEAIRR---------
BIOB_BACC1       NMIINTKSGLCPEDCGYCSQSIISEA--PIDKYAWLTQEKIVEGAHEAIRR---------
BIOB_BACC2       NMIINTKSGLCPEDCGYCSQSIISEA--PIDKYAWLTQEKIVEGAHEAIRR---------
BIOB_BACC4       NMIINTKSGLCPEDCGYCSQSIISEA--PIDKYAWLTQEKIVEGAHEAIRR---------
BIOB_BACCR       NMIINTKSGLCPEDCGYCSQSIISEA--PIDKYAWLTQEKIVEGAHEAIRR---------
BIOB_BACMK       NMIINTKSGLCPEDCGYCSQSIISEA--PIDKYAWLTQEKIVEGAHEAIRR---------
BIOB_BACCN       NMIINTKSGLCPEDCGYCSQSIVSEA--PIDKYAWLTQEKIVEGAHEAVRR---------
BIOB_BACP2       NMIFNAKSGYCPENCGYCSQSIISNA--PVERYTMLDQKTIVAGAREALKR---------
BIOB_STAAM       NMILNAKSGICPENCGYCGQSR-DIK--QKQRYALIPEEQIIDGAKVAHDN---------
BIOB_STAAN       NMILNAKSGICPENCGYCGQSR-DIK--QKQRYALIPEEQIIDGAKVAHDN---------
BIOB_STAAS       NMILNAKSGICPENCGYCGQSR-DIK--QKQRYALIPEEQIIDGAKVAHDN---------
BIOB_STAA9       NMILNAKSGICPENCGYCGQSR-DIK--QKQRYALIPEEQIIDGAKVAHDN---------
BIOB_STAAB       NMILNAKSGICPENCGYCGQSR-DIK--QKQRYALIPEEQIIDGAKVAHDN---------
BIOB_STAAW       NMILNAKSGICPENCGYCGQSR-DIK--QKQRYALIPEEQIIDGAKVAHDN---------
BIOB_STAA1       NMILNAKSGICPENCGYCGQSR-DIK--QKQRYALIPEEQIIDGAKVAHDN---------
BIOB_STAA2       NMILNAKSGICPENCGYCGQSR-DIK--QKQRYALIPEEQIIDGAKVAHDN---------
BIOB_STAAR       NMILNAKSGICPENCGYCGQSR-EIK--QKQRYALIPEEQIIDGAKVAHDN---------
BIOB_STAAC       NMILNAKSGICPENCGYCGQSR-DIK--QKQRYALIPEEQIIDGAKVAHDN---------
BIOB_STAAT       NMILNAKSGICPENCGYCGQSR-DIK--QKQRYALIPEEQIIDGAKVAHDN---------
BIOB_STAA8       NMILNAKSGICPENCGYCGQSR-DIK--QKQRYALIPEEQIIDGAKVAHDN---------
BIOB_STAAE       NMILNAKSGICPENCGYCGQSR-DIK--QKQRYALIPEEQIIDGAKVAHDN---------
BIOB_STAA3       NMILNAKSGICPENCGYCGQSR-DIK--QKQRYALIPEEQIIDGAKVAHDN---------
BIOB_STAEQ       NMILNAKSGICAEDCGYCGQSV-KMK--EKQRYALVEQDQIKEGAQVATEN---------
BIOB_STAES       NMILNAKSGICAEDCGYCGQSV-KMK--EKQRYALVEQDQIKEGAQVATEN---------
BIOB_STAHJ       NMILNAKSGICSEDCGYCGQSV-KMK--EKQRYALVEPDKIKAGAQVATEN---------
BIOB_STACT       NMILNAKSGICPEDCGYCGQSR-DMK--RKDRYALIPENDIIAGANAAADN---------
BIOB_MACCJ       NMILNAKSGICPEDCGYCGQSK-LMK--NKDKYLLVDSEQIKSGADFCATH---------
BIOB_RHOBA       YFLMNAKSGLCPEDCHYCSQSKVSDA--PVPKYNILKRDALMDAAKVAAER---------
BIOB_THEEB       HYLLNAQSGLCPEDCHYCSQSKISTA--EIEKYPLLSQEKILAAADRAAHL---------
BIOB_SALRD       HVLQNAKSGVCPEDCAFCSQSLKFDS--DPEQYGMQQVDQIVEGAKAAWDK---------
BIOB_STRAW       NYLVNLKSGLCPEDCSYCSQRLGSKA--EILKYTWLKPDEASQAAAAGLAG---------
BIOB_STRCO       NYLVNLKSGLCPEDCSYCSQRLGSKA--EILKYTWLKPDQASAAAAAGVSG---------
BIOB_STRGG       NYLVNLKSGLCPEDCSYCSQRLGSKA--GILKYTWLKPEEASRAAAAGVAG---------
BIOB2_FRACC      NFLVNLKSGLCPEDCSYCSQRLGSNT--GILKYTWLKPEEAAATAGAGISG---------
BIOB_NOCSJ       NYLVNLKSGLCPEDCHYCSQALGSRA--PILKYNWLSSEEVLEQAGAGLRG---------
BIOB_SACEN       NYLVNLKSGLCPENCNYCSQALGSDA--PILKYSWLSKDETLKQTGAGLRG---------
BIOB_KOCRD       NYLVNLKSGLCAEDCGYCSQRLNAGT--DILKYSWLSPEQAVEQAEYGIKG---------
BIOB_RENSM       NYLVNLKSGLCPEDCTYCSQRLGSAA--QILKYSWLKSEDAIDQAEQGLAG---------
BIOB_CUTAK       NYLVNLKSGLCPEDCSYCSQRLGSRA--EIMKYSWADPQKVHDAVEAGIAG---------
BIOB_ACAM1       HRINDIQNGLCPEDCGYCAQSKISDA--PIKKYPLKSEEDIIQEAYEAKAK---------
BIOB_MAGMM       HILNNVQNGYCSEDCNYCAQAKNSKA--PIEKYSIKSDEEILEGARKAYES---------
BIOB_LEPBA       HILDNIKNGYCPEDCGYCAQRKGGES--GIQEYSLKSPEEIWEDAKKAKEN---------
BIOB_LEPBP       HILDNIKNGYCPEDCGYCAQRKGGES--GIQEYSLKSPEEIWEDAKKAKEN---------
BIOB_LEPBJ       HILDNIKNGYCPEDCGYCAQRKNANS--GIKEYPMKSEAEIYEDAVQAKKN---------
BIOB_LEPBL       HILDNIKNGYCPEDCGYCAQRKNANS--GIKEYPMKSEAEIYEDAVQAKKN---------
BIOB_LEPIC       HILDNIKNGYCPEDCGYCAQRKNANS--GVQEYPMKSEQEIYEDAVQAKKN---------
BIOB_LEPIN       HILDNIKNGYCPEDCGYCAQRKNANS--GVQEYPMKSEQEIYEDAVQAKKN---------
BIOB_THET2       VRLLNVKSGFCPEDCAYCAQSARSQA--AIARYPLLSLEEILERAEEAQRL---------
BIOB_THET8       VRLLNVKSGFCPEDCAYCAQSARSQA--AIARYPLLSLEEILERAEEAQRL---------
BIOB_STRA1       NVLLSAKQGLCAENCGYCSQSKESTA--DIDKFGLLPQNVILKQAIVAHQN---------
BIOB_STRA5       NVLLSAKQGLCAENCGYCSQSKESTA--DIDKFGLLPQNVILKQAIVAHQN---------
BIOB_STRA3       NVLLSAKQGLCAENCGYCSQSKESTA--DIDKFGLLPQNVILKQAIVAHQN---------
BIOB_CORGL       EGIISLKTGGCPEDCHFCSQSGLFES---PVRSVWLDIPNLVEAAKQTAKT---------
BIOB_CORGB       EGIISLKTGGCPEDCHFCSQSGLFES---PVRSVWLDIPNLVEAAKQTAKT---------
BIOB_COREF       EGIISLKTGGCPEDCHFCSQSGLFES---PVRSVWLDIEQLVEAAKQTAKS---------
BIOB1_CORDI      EGIISLKTGGCPEDCHFCSQSGLFES---PVRSAWLDIAGLVEAAKQTQKS---------
BIOB_CORU7       EGIVSLKTGGCPEDCHFCSQSGLFET---PVRSVWLDIPLLVEQAKQTAKT---------
BIOB_CORJK       EGIISLQTGGCPEDCHFCAQSGLFES---PVRSIQLDIAQLIEAAKQTAKT---------
BIOB_MYCBO       EGIISLKTGGCPEDCHFCSQSGLFAS---PVRSAWLDIPSLVEAAKQTAKS---------
BIOB_MYCTU       EGIISLKTGGCPEDCHFCSQSGLFAS---PVRSAWLDIPSLVEAAKQTAKS---------
BIOB_MYCTA       EGIISLKTGGCPEDCHFCSQSGLFAS---PVRSAWLDIPSLVEAAKQTAKS---------
BIOB_MYCTF       EGIISLKTGGCPEDCHFCSQSGLFAS---PVRSAWLDIPSLVEAAKQTAKS---------
BIOB_MYCBP       EGIISLKTGGCPEDCHFCSQSGLFAS---PVRSAWLDIPSLVEAAKQTAKS---------
BIOB_MYCMM       EGIISLKTGGCPEDCHFCSQSGLFSS---PVRSAWLDIPSLVEAAKQTAKS---------
BIOB_MYCUA       EGIISLKTGGCPEDCHFCSQSGLFSS---PVRSAWLDIPSLVEAAKQTAKS---------
BIOB_MYCA1       EGIISLKTGGCPEDCHFCSQSGLFAS---PVRSARLDIPSLVEAAKQTAKS---------
BIOB_MYCPA       EGIISLKTGGCPEDCHFCSQSGLFAS---PVRSARLDIPSLVEAAKQTAKS---------
BIOB_MYCLE       EGIISLKTGGCPEDCHFCSQSGLFMS---PVRSAWLDIRSLVEAAKQTAKS---------
BIOB_MYCLB       EGIISLKTGGCPEDCHFCSQSGLFMS---PVRSAWLDIRSLVEAAKQTAKS---------
BIOB_MYCGI       EGIISLKTGGCPEDCHFCSQSGLFAS---PVRSAWLDVPSLVEAAKQTAKT---------
BIOB_MYCVP       EGIISLKTGGCPEDCHFCSQSGLFAS---PVRSAWLDIPSLVEAAKQTAKT---------
BIOB_MYCSJ       EGIISLKTGGCPEDCHFCSQSGLFAS---PVRSAWLDVPSLVEAAKQTAKT---------
BIOB_MYCSK       EGIISLKTGGCPEDCHFCSQSGLFAS---PVRSAWLDVPSLVEAAKQTAKT---------
BIOB_MYCSS       EGIISLKTGGCPEDCHFCSQSGLFAS---PVRSAWLDVPSLVEAAKQTAKT---------
BIOB_MYCS2       EGIISLKTGGCPEDCHFCSQSGLFAS---PVRSAWLDVPSLVEAAKQTAKT---------
BIOB_MYCA9       EGIISLKTGGCPEDCHFCSQSGLFAS---PVRSAWLDIPSLVEAAKQTAKS---------
BIOB_NOCFA       EGIISLKTGGCPEDCHFCSQSGLFQS---PVRAAWLDIPSLVEAAKQTAKT---------
BIOB_RHOJR       EGIISLKTGGCPEDCHFCSQSGLFQS---PVRAAWLDIPSLVEAAKQTAKS---------
BIOB_FRAAA       EGIISLKTGGCPEDCHFCSQSGKFDS---PVRSAWLDVPSLVEAARQTAAT---------
BIOB1_FRACC      EGIVSLKTGGCPEDCHFCSQSGKFDS---PVRSAWLDVPSLVDAARQTAAT---------
BIOB_FRASN       EGIISLKTGGCPEDCHFCSQSGRFDS---PVRSAWLDVPSLVEAAKATAAT---------
BIOB_SALAI       EGIVSLKTGGCPEDCHFCSQSGLFTS---PVRAVWLDIPSLVEAAKQTAKT---------
BIOB_SALTO       EGIVSLKTGGCPEDCHFCSQSGLFTS---PVRAVWLDIPSLVEAAKQTAKT---------
BIOB_PSECP       EGIVSIKTGGCPEDCHFCSQSGLFDS---PVRGVWLDIPELVKAAKETAAT---------
BIOB_ARTS2       EGIISIKTGGCPEDCHFCSQSGLFDS---PVRGVWLDIPELVKAAKETAAT---------
BIOB_PAEAT       EGIISIKTGGCPEDCHFCSQSGLFDS---PVRGVWLDIPELVKAAKETAAT---------
BIOB_ACIC1       EGIVSVKTGGCPEDCHFCSQSGRFDS---PVRSAWLDIPNLVTAAEQTAAT---------
BIOB_CENSY       EQLNNIKRDGCSEDCTFCGQSAFYDA---DKEPHPLPEPEEVVRAALKAKKE--------
BIOB_NITMS       EQLNNIKKNACSEDCTFCGQSAFFDT---GIETYQLPSPEEVVSKAQKAKEE--------
BIOB_HELPY       CSISNVRSGDCKEDCAYCTQSSHHQG--AIKRYKFKDEKVVLQEARALRQ----------
BIOB_HELPH       CSISNVRSGDCKEDCAYCTQSSHHQG--AIKRYKFKDEKVVLQEARALRE----------
BIOB_HELPS       CSISNVRSGDCKEDCAYCTQSSHHQG--AIKRYKFKDEKVVLQEARALRE----------
BIOB_HELPG       CSISNVRSGDCKEDCAYCTQSSHHQG--AIKRYKFKDEKVVLQEARALRE----------
BIOB_HELPJ       CSISNVRSGDCKEDCAYCTQSSHHQG--AIKRYKFKDEKVVLQEARALRE----------
BIOB_HELP2       CSISNVRSGDCKEDCAYCTQSSHHQG--AIKRYKFKDEKVVLQEARALKQ----------
BIOB_HELAH       CSISNVRSGDCKEDCAYCTQSSHHQG--AIKRYKFKDEKVVLQEARALRE----------
BIOB_HELHP       CSICNVSSGDCPEDCKYCTQSAHYGT--QIQRYKNKSIDKIVQEAKTLRE----------
BIOB_WOLSU       CSICNVSSGGCAEDCAYCTQSAKYRV--DIEKYKQKSLENILEEARRARA----------
BIOB_ARCB4       CAISNIESGTCNEDCKFCTQSVKYKA--DIERYRRKEIEDIVNEAKKARA----------
BIOB_NITSB       CAISNISSGVCAEDCKFCTQSTKYRA--DIPRYKYKSIETIVEEAKKAKA----------
BIOB_NAUPA       CAISNIRSGACNEDCKFCTQSVKWGA--DINRYKQKDLKTIVNEAKLAKK----------
BIOB_CAMC1       CAICSVTQGNCVEDCAYCTQSAKAGA--DITKFKEKSVQQVVDEAKMAYK----------
BIOB_CAMC5       CAISSLSAGNCSEDCHYCTQSAGTKA--DIKRYKLKSPEQVVDEAKKAYA----------
BIOB_CAMFF       CAICNVSSGNCAEDCAYCTQSAHIKA--DIPKFKQKNLEQILNEAKIASK----------
BIOB_CAMJ8       CAISNIASGNCSEDCKYCTQSAHVKT--DIQKYRRKELSQIVLEAKMAKK----------
BIOB_CAMJJ       CAISNIASGNCSEDCKYCTQSAHVKT--DIQKYRRKELSQIVLEAKMAKK----------
BIOB_CAMJE       CAISNIASGNCSEDCKYCTQSAHVKT--DIQKYRRKELSQIVLEAKMAKK----------
BIOB_CAMJR       CAISNIASGNCSEDCKYCTQSAHVKT--DIQKYRRKELSQIVLEAKMAKK----------
BIOB_CAMJD       CAISNIASGNCSEDCKYCTQSAHVRT--DIQKYRRKELSQIVLEAKMAKK----------
BIOB_CAMLR       CAISNIASGGCGEDCKYCTQSAHVKT--NINKYKRKDIDQIVLEAKMAKK----------
BIOB_SULDN       CSICNINSGTCNEDCKFCSQSVRYKA--DIDRYKQKEISLILKEAQDAYS----------
BIOB_SULNB       CAINNILSGTCKEDCKFCTQSVRYHA--DIERYSYKKIGQIVEEARQAKA----------
BIOB_METM6       CSIMNAKSGICPENCIFCSQSKHNTS--KIDTYELKSKEEILKNAKSVEK----------
BIOB_METMP       CSIMNAKSGICPENCIFCSQSKHNTS--KIDTYGLKSKEEILKNAKSVEK----------
BIOB_METM5       CSIMNAKSGICPENCIFCSQSKHNSS--KIDTYELKSKEEILKNAKSVEK----------
BIOB_METM7       CSIMNAKSGVCSENCIFCSQSKHNSS--KIDTYELKSKEEILKNAKSVEK----------
BIOB_METVS       CSIINAKSGFCSENCNFCSQSIHNNS--KINIYGLKSKEEILKSAKSIEN----------
BIOB_META3       CSIINAKSGLCSENCAFCSQSLHNSS--KIKEYPLKPKEDILKQAKYIEK----------
BIOB_METJA       CAIINAKSGKCKEDCIFCSQSIYSKC--NIPIYPLKSKKEILEYAKKIIDECSKISSSIE
BIOB_CALBD       CSIYPAKVGLCPQDCKFCSQSIHHSC--LIEIKDLAALDEVIEYLEYVIS----------
BIOB_CALS8       CSIYPAKVGMCTEDCKFCSQSIYHSC--KIEIKDVASVDEVIEYLENIIA----------
BIOB_AQUAE       CSIINAKSGACSEDCKFCAQSKYYKT--PINVYNLVPVDEMVEGAIRGVE----------
BIOB_HYDS0       CSIINAKSGACSEDCKFCAQSKFYKT--PINIYKLVDKEELVEGAIRGVE----------
BIOB_PERMH       CSLINAKNGACSEDCSFCAQSSKYPT--PINAYGLVPKKELVEGAQKAVS----------
BIOB_SULSY       CSLINAKNGACTEDCSFCAQSSHYKT--PINAYGLVSKDEMLAGAEKAVA----------
BIOB_UNCTG       CSIINAKSGQCSEDCRFCTQSTFNKT--DVKVYSLTDTEKIKEFSTKALE----------
BIOB_THENN       CSIVNAKSGICDQDCKFCAQSSLYNT--GVKRYPLLDEESILEKAKEAEK----------
BIOB_THEP1       CSIVNAKSGICDQDCKFCAQSSLYNT--GVKKYPLLDKESILEKAKEAEK----------
BIOB_THEYD       CAIVNAKSGLCSEDCAFCAQSSRYKT--NSPVYSLLEKDEIVKKALEAKK----------
BIOB_DESDA       CAIINARSGNCGMDCRFCSQSKHNHT--PIETFSLLPDDELRGRILALGT----------
BIOB_ALKMQ       CSIINGKSGKCSENCKFCAQSSHHHT--GIEEYSFLDTNLIVEDCKKHAN----------
BIOB_CLOB8       CTIINGRSGKCSENCKFCAQSNHHKT--EIKKYDFLDPNVILKDCKKNEA----------
BIOB_CLOB1       CTIINGKSGRCQENCKYCAQSAHFDT--DIIEYNILNSDRIINSAISNYN----------
BIOB_CLOBH       CTIINGKSGRCQENCKYCAQSAHFDT--DIIEYNILNSDRIINSAISNYN----------
BIOB_CLOBK       CTIINGKSGRCQENCKYCAQSAHFDT--DIIEYNILNSDRIMNSAISNYN----------
BIOB_CLOBL       CTIINGKSGRCQENCKYCAQSAHFDT--DIIEYNILNSDRIINSAISNYN----------
BIOB_CLOBM       CTIINGKSGRCQENCKYCAQSSYFDT--DIIEYNILHSDRIINSGISNYN----------
BIOB_CLOBA       CTIINGKSGRCGENCKYCAQSVYFKT--DIEEYNLLDSESIITSAISNYN----------
BIOB_CLOBB       CTIINGKSGRCGENCKYCAQSVYFKT--DIEEYNLLDSESIITSAISNYN----------
BIOB_BRAHW       CSIINAKSGKCSENCKFCAQSSHYDT--KCDEYDILDKEKILEQGKSDFN----------
BIOB_AKKM8       CTIINGRSGKCSENCKYCAQSAHYST--AVEEYPLLSDEALLAGARYNDA----------
BIOB2_CORDI      CSIINAKSGRCPENCTFCAQSIRYPTI-SVDSYPLITADELVRQAQENKD----------
BIOB_CAMHC       CSIINVKSGKCSENCKYCAQSAHFDT--KCEIYDILPFEKIMPLAKLNDD----------
BIOB_FUSNN       CTIINAKSGKCSENCKYCAQSVHFKT--GTDVYGLISKELALYEAKRNEN----------
BIOB_CLOD6       CTIMNAKSGKCSEDCKFCAQSSYYKT--GVEEYSLLDYNEILNRAKEMES----------
BIOB_HUNT2       CSIINAKSGGCSENCKFCAQSGHYDT--GVKIYPLLDVDDVLKAAKENEK----------
BIOB_CLOK1       CTIMNAKSGRCTEDCKFCAQSGHYKT--NVENYELVSKEEALKLARENEN----------
BIOB_CLOTE       CSIMNAKSGRCSEDCKFCAQSEHYNT--NIKKYNMINMSDALNLAKENKE----------
BIOB_CLONN       CSIINAKCGKCSEDCKFCAQSIFYNT--NIKTHPLCSYDEILKLAKENEL----------
BIOB_CLOP1       CSIINGKSGRCGEDCAFCAQSKYHKT--NISEYPLLDYEKIKKVAKENED----------
BIOB_CLOPE       CSIINGKSGRCGEDCAFCAQSKYHKT--NISEYPLLDYEKIKKVAKENED----------
BIOB_PORG3       CSIINAKSGNCPEDCKWCAQSRHYAT--SIEKYGLLSATVCAEQAAYNRR----------
BIOB_PORGI       CSIINAKSGNCPEDCKWCAQSRHYAA--SIEKYGLLSAAVCAEQAAYNRR----------
BIOB_PARD8       CSIINAKSGNCSEDCKWCAQSGHYKT--LVNLYPLLPAKECVYHAVYNRK----------
BIOB_CROS5       CSIINVKSGNCSENCQFCSQSVHHQGE-NSPIYGLKSSEEILAQAKAAEV----------
BIOB_RIPO1       CSIINIKSGNCSENCRFCSQSVYHPGE-NSPIYGLKSSEEILAQAKAAEA----------
BIOB_GLOC7       CSIINIKSGHCSENCSFCSQSVHHPGQ-DSPVYGLKTSEEIVQQAKAAAA----------
BIOB_MICAN       CSIINIKSGSCSENCSFCSQSVHHPGQ-DSPIYGLKSREEIVTHAKAAAD----------
BIOB_TRIEI       CSIINVKSGGCSENCSFCSQSVHHPGE-DSPIYGLKSTEEILDQAKAAEA----------
BIOB_SYNY3       CSIINVKSGNCSENCGFCSQSSHHPDP-NSPIYGLKTEAEILEQARAAAA----------
BIOB_CYAP4       CSIVNIKSGNCSENCSFCAQSAHHPGQ-DSPIYGMKTPEDILAQARAAAA----------
BIOB_SYNP2       CSIVNVKSGSCSENCSFCSQSAHHPGE-DSPVYGLKTAEEIIEQAKAAEA----------
BIOB_CARHZ       CSIISVKTGHCPEDCAFCAQSVHHH-T-EITPTEMLEEEKILAKAKAMEA----------
BIOB_CLOAB       CSVINAKSGNCSEDCAFCAQSAHHK-A-NVSCYPLLNEDKILEMAKQREA----------
BIOB_DESAP       CAIVNARAGRCSEDCRFCTQAACYH-T-RAPVYPLLPAEGIIRRARAVRS----------
BIOB_PELTS       CSIVNARSGRCSEDCAFCAQSGHYR-T-EAPVYPLLSKEEILERAREMEL----------
BIOB_HELMI       CSIVNAKSGACSEDCRFCAQSAHHQ-A-CVKTYDLLDPDAIVGRARVMEA----------
BIOB_DESPS       CSIVNARSGRCSEDCKFCAQSSHYS-T-GVDSYALVDPDYVLALAKQNEA----------
BIOB_DESRM       CSIVNAKSGSCSEDCKFCAQSVYYA-T-GCQTYPLLNSVAILEAAKRVEE----------
BIOB_ANAD2       CGITNAKSGRCPEDCGFCSQSARFEGA-DAPVYPMIGAGEIVEQAHKAER----------
BIOB_ANASK       CGITNAKSGRCPEDCGFCSQSARFEGA-DAPVYPMIGAGEIVEQAHKAER----------
BIOB_ANADE       CGITNAKSGRCPEDCGFCSQSARFEGA-DAPVYPMIGAGEIVEQARKAER----------
BIOB_ANADF       CGITNAKSGRCPENCGFCSQSAHFPGA-DAPVYPLVPAEEMVAQAKVAER----------
BIOB_DESVH       CGIVNAKSGRCPEDCAFCAQSSHHA-T-GSPVHALLDAETLLRRAEELRQ----------
BIOB_DESVV       CGIVNAKSGRCPEDCAFCAQSSHHA-T-GSPVHALLDAETLLRRAEELRQ----------
BIOB_DESVM       CGIVNAKSGRCGEDCAFCAQSSHHD-T-GAPVHALLGPDALLRHAEELAR----------
BIOB_DESAG       CAIVNARSGRCPENCSFCAQSAHYA-T-GAPEHPMLNTAALVEHALKLAD----------
BIOB_GEOMG       CSIINAKSGRCPENCAFCAQSAHHT-T-NAPIYPLVDEDKLVACAKEAEA----------
BIOB_GEOSL       CSIINAKSGRCPENCAFCAQSAHHA-T-NAPVYPLVDEEQITACAREAAG----------
BIOB_GEODF       CSIVNAKSGRCPENCSFCAQSAHHK-T-DAPVYSLIDEERMVACAREAEK----------
BIOB_GEOUR       CSIINAKSGRCPENCSFCAQSAHHK-T-DAPVYSLVDEDKMVACAHEAEK----------
BIOB_GEOBB       CSIINAKSGRCAENCAFCAQSAHHK-T-DAPVYPLVQEEEMLASARMAET----------
BIOB_PELPD       CSIINAKSGRCAENCAFCAQSAAHK-T-DAQVYPLVDEEEIVRCARDAER----------
BIOB_GEOLS       CGIINAKSGLCPEDCAFCAQSSHHA-T-GVACYPLLDQDTLLAGARSVAG----------
BIOB_PELCD       CMIVNAKSGHCSEDCRFCAQSSHYH-T-GAPVFPLKTAEQIVAEAQCADS----------
BIOB_SYNAS       CSILNAKSGACAENCAFCSQSGHHR-T-DVVKRPLLSAEAMIEEARRLDS----------
BIOB_DESAL       CCIVNGKSGKCREDCAFCAQSAYAK-T-SAPVYPLIDSEKMFQGASYARE----------
BIOB_DESOH       CVIRNGKSGRCSEDCAFCSQSVRAK-A-DIDAYPLISEIDLAEPGRRLES----------
BIOB_SYNFM       CSILNARSGACSEDCAFCAQSAHHE-T-HAEVFGLLDGNEIAAAYRKAAE----------
BIOB_CHLCH       CSIMNAKSGVCGENCRFCAQSKHNNA--AIEVYDLVSDDSVLIEARQAVA----------
BIOB_PELPB       CSIMNAKSGVCGENCRFCAQSRHNRA--DIEVYDLVDAESVLIEARNCFA----------
BIOB_CHLP8       CSIMNAKSGVCGENCRFCAQSKHNSA--EVDVYGLVDEAKVLDQARALHE----------
BIOB_CHLTE       CSIMNAKSGVCGENCRFCAQSKHNSA--EVDVYELVDENKVLEQARSAWE----------
BIOB_CHLL2       CSIMNAKSGECGENCRFCAQSRHNSA--SIDVYDLAGEDAVLRQAEEAVD----------
BIOB_PELLD       CSIMNAKSGVCGENCRFCAQSRHNHS--DIEVYPLVDEDAVLFEARGCVE----------
BIOB_CHLPM       CSIMNAKSGVCGENCRFCAQSRHNHA--DIEVYPLVDEDAVLFEARSCAE----------
BIOB_CHLPD       CSIMNARSGVCSENCRFCAQSAHHQA--AIDVYGLVDVDAVLFHARQTAS----------
BIOB_CHLPB       CSIINAKSGVCAENCRFCAQSLHNSA--DVEQYSLLDAEAIVRSAGDVYD----------
BIOB_PROA2       CSILNAKSGACSENCRFCAQSLHNQA--DVESYSLLDRSKVFEAAGRVYA----------
BIOB_NATPD       CSIVNAKAGNCAEDCGFCAQSAHFDT--GIDTYGFLDPEDILDAAKRAEA----------
                   :     . *  :* :* *                                        

BIOB_FRAT1       ------------------------GSKRFCMGAAWKHIPK-----KDFDQVAEIITEVK-
BIOB_FRATT       ------------------------GSKRFCMGAAWKHIPK-----KDFDQVAEIITEVK-
BIOB_FRATN       ------------------------GSKRFCMGAAWKHIPK-----KDFDQVAEIITEVK-
BIOB_FRATW       ------------------------GSKRFCMGAAWKHIPK-----KDFDQVAEIITEVK-
BIOB_FRATM       ------------------------GSKRFCMGAAWKHIPK-----KDFDQVAEIITEVK-
BIOB_FRATF       ------------------------GSKRFCMGAAWKHIPK-----KDFDQVAEIITEVK-
BIOB_FRATH       ------------------------GSKRFCMGAAWKHIPK-----KDFDQVAEIITEVK-
BIOB_FRATO       ------------------------GSKRFCMGAAWKHIPK-----KDFDQVAEIITEVK-
BIOB_FRAP2       ------------------------GSKRFCMGAAWKHIPK-----KDFDQVAEIITEVK-
BIOB_COXB1       ------------------------GARRFCMGAAWRSPPK-----RELPKVLEMIKSVK-
BIOB_COXB2       ------------------------GARRFCMGAAWRSPPK-----RELPKVLEMIKSVK-
BIOB_COXBN       ------------------------GARRFCMGAAWRSPPK-----RELPKVLEMIKSVK-
BIOB_COXBR       ------------------------GARRFCMGAAWRSPPK-----RELPKVLEMIKSVK-
BIOB_COXBU       ------------------------GARRFCMGAAWRSPPK-----RELPKVLEMIKSVK-
BIOB_LAWIP       ------------------------GSTRFCMGAAWRSPLD-----KDLKIVCQMIEEVK-
BIOB_RICFE       ------------------------GSTRFCMGAAWRGPRD-----EDLKLVCEMIKEVK-
BIOB_NEOSM       ------------------------GATRFCIGAAWRGPRG-----KDLDIVCEMISRIK-
BIOB_ANAMF       ------------------------GADRFCFAAAWRNLHD-----RDLEKICQFVEAIK-
BIOB_ANAMM       ------------------------GADRFCFAAAWRNLHD-----RDLEKICQFVEAIK-
BIOB_ANAPZ       ------------------------GVHRFCFAAAWRNLHD-----RDVDRICEFVKAIK-
BIOB_EHRCJ       ------------------------GADRFCFAAAWRQVRD-----RDLEYICDIIDLIK-
BIOB_EHRCR       ------------------------GADRFCFAAAWRQLRD-----KDIEYICNIINLIK-
BIOB_EHRRG       ------------------------GIDRFCFAAAWRQIRD-----RDIEYICNIISLIK-
BIOB_EHRRW       ------------------------GIDRFCFAAAWRQIRD-----RDIEYICNIISLIK-
BIOB_AGRRK       ------------------------GAERFCMGAAWRQVRDG----REFDAVIEMVKGVR-
BIOB_AGRVS       ------------------------GAERFCMGAAWRQVRDG----KEFDAVLTMVRGVR-
BIOB_RUEPO       ------------------------GAERFCMGAAWRQVRDG----AEFDNVLAMVRGVR-
BIOB_BEII9       ------------------------GADRFCMGAAWRQVRDG----AAFDAVLEMVEGVR-
BIOB_METSB       ------------------------GADRFCMGAAWRSVRDG----REFDSVIEMVRGVR-
BIOB_ZYMMO       ------------------------GAERFCMGAAWRKVRDG----KEFDAVLEMIRGVR-
BIOB_METC4       ------------------------GAHRFCMGAAWRKPKDG----PDFDAVLEMVRGVR-
BIOB_METEP       ------------------------GAHRFCMGAAWRKPKDG----PDFDAVLEMVRGVR-
BIOB_METPB       ------------------------GAHRFCMGAAWRKPKDG----PEFDAVLEMVRGVR-
BIOB_METRJ       ------------------------GAQRFCMGAAWRQPKDG----PEFDAVLAMVRGVR-
BIOB_METNO       ------------------------GATRFCMGAAWRQPKDG----PEFDAVLAMVRGVR-
BIOB_METS4       ------------------------GATRFCMGAAWRSPKDG----PDFDAVLAMVRGVR-
BIOB_PROM2       ------------------------GADRFCMGWAWREIRDG----KSFNAMLEMVSGVR-
BIOB_PROM9       ------------------------GADRFCMGWAWREIRDG----KSFNAMLEMVSGVR-
BIOB_PROMS       ------------------------GADRFCMGWAWREIRDG----KSFNAMLEMVSGVR-
BIOB_PROM0       ------------------------GADRFCMGWAWREIRDG----KSFNAMLEMVSGVR-
BIOB_PROM5       ------------------------GADRFCMGWAWREIRDG----KPFNSMLEMVKGVK-
BIOB_PROMP       ------------------------GADRFCMGWAWREIRDG----KPFNSMIEMVKGVK-
BIOB_PROM1       ------------------------GADRFCMGWAWREIKDG----NAFDSMLEMVRGVR-
BIOB_PROMT       ------------------------GADRFCMGWAWREIKDG----NAFDSMLEMVKGVR-
BIOB_PROM4       ------------------------GADRFCMGWAWREIRDG----QPFESMLKMVRGVR-
BIOB_PROMA       ------------------------GADRFCMGWAWREIRDG----KPFEAMLDMVRGVK-
BIOB_PROM3       ------------------------GADRFCMGWAWREIRDG----AQFEAMLAMVSGVR-
BIOB_PROMM       ------------------------GADRFCMGWAWREIRDG----AQFEAMLAMVSGVR-
BIOB_SYNPW       ------------------------GADRFCMGWAWREIREG----PAFESMLSMVRGVR-
BIOB_SYNS3       ------------------------GADRFCMGWAWREIRDG----APFEAMLQMVSGVR-
BIOB_SYNPX       ------------------------GADRFCMGWAWREIRDG----APFEAMLSMVRGVR-
BIOB_SYNSC       ------------------------GADRFCMGWAWREIRDG----APFEAMLEMVRGVR-
BIOB_SYNS9       ------------------------GADRFCMGWAWREIRDG----AQFEAMLEMVRGVR-
BIOB_SYNR3       ------------------------GAHRFCMGWAWREIREG----APFDAMLAMVRGVR-
BIOB_SYNE7       ------------------------GASRFCMGWAWREIRDG----AQFDAMLEMVQGVR-
BIOB_SYNP6       ------------------------GASRFCMGWAWREIRDG----AQFDAMLEMVQGVR-
BIOB_SORC5       ------------------------GSTRFCMGAAWREVKDG----PAFERVLDMVRGVK-
BIOB_MYXXD       ------------------------GATRFCMGAAWREVKDG----PQFDSVLEMVRGVR-
BIOB_GLOVI       ------------------------GSTRFCMGAAWREIKDG----PPFERVLEMVRSVA-
BIOB_SYNJA       ------------------------GATRLCMGAAWRSAPAG----EAFERVLEMVRLVR-
BIOB_NOSS1       ------------------------GVSRVCMGAAWREVRDN----SQFDRVLEMVKDVT-
BIOB_TRIV2       ------------------------GVSRVCMGAAWREVRDN----SQFDRVLEMVKDVT-
BIOB_NOSP7       ------------------------GVSRICMGAAWREVRDN----SQFEEVLEMVKDIT-
BIOB_CHLAB       ------------------------GATRVCLGAAWREVKDN----HQFDRTLEMIKGIT-
BIOB_CHLFF       ------------------------GATRVCLGAAWREVKDN----HQFDRILEMIKGIT-
BIOB_CHLPN       ------------------------GATRVCLGAAWRNAKDD----RYFDRVLAMVKSIT-
BIOB_FLAJ1       ------------------------GSSRVCMGAAWRNVKDG----EEFDQVLEMVRTIN-
BIOB_FLAPJ       ------------------------GSSRVCMGAAWRNVKDG----PEFDQVLEMVRTIN-
BIOB_GRAFK       ------------------------GSSRVCMGAAWRNVKDG----EEFDNVLEMVRSIN-
BIOB_CYTH3       ------------------------GSTRFCMGAAWREVRDN----KDFDKVIDMVKGVS-
BIOB_HYDCU       ------------------------GATRLCMGAAWRNPTK-----KDFPRVLEMVRVVK-
BIOB_BRUA1       ------------------------GATRYCMGAAWRSPKD-----RDMPALTHMIESVK-
BIOB_BRUA2       ------------------------GATRYCMGAAWRSPKD-----RDMPALTHMIESVK-
BIOB_BRUAB       ------------------------GATRYCMGAAWRSPKD-----RDMPALTHMIESVK-
BIOB_BRUC2       ------------------------GATRYCMGAAWRSPKD-----RDMPALTHMIESVK-
BIOB_BRUMB       ------------------------GATRYCMGAAWRSPKD-----RDMPALTHMIESVK-
BIOB_BRUME       ------------------------GATRYCMGAAWRSPKD-----RDMPALTHMIESVK-
BIOB_BRUSI       ------------------------GATRYCMGAAWRSPKD-----RDMPALTHMIESVK-
BIOB_BRUSU       ------------------------GATRYCMGAAWRSPKD-----RDMPALTHMIESVK-
BIOB_BRUO2       ------------------------GATRYCMGAAWRSPKD-----RDMPALTHMIESVK-
BIOB_OCHA4       ------------------------GATRYCMGAAWRSPKP-----RDEPAIAEMVKQVK-
BIOB_AGRFC       ------------------------GATRYCMGAAWRNPKE-----RDMEAVVAMVEGVK-
BIOB2_PARDP      ------------------------GATRYCMGAAWRSPKE-----RDMPAVLAMIRGVK-
BIOB_LEGPA       ------------------------GAKRFCMGAAWRCPPD-----KAIPQLKEMIEGVK-
BIOB_LEGPH       ------------------------GAKRFCMGAAWRCPPD-----KAIPQLKEMIEGVK-
BIOB_LEGPL       ------------------------GAKRFCMGAAWRCPPD-----KAIPQLKEMIEGVK-
BIOB_LEGPC       ------------------------GAKRFCMGAAWRCPPD-----KAIPQLKEMIEGVK-
BIOB_RUTMC       ------------------------GATRFCMGAAWRNPTD-----KSLAKVILMIQGVK-
BIOB_VESOH       ------------------------GATRFCMGAAWRNPTD-----KSINKVIPMIQGVK-
BIOB_HAEI8       ------------------------GAGRFCMGAAWRGPKP-----KDIEKVTEIIKAVK-
BIOB_HAEIE       ------------------------GAGRFCMGAAWRGPKP-----KDIEKVTEIIKAVK-
BIOB_HAEIN       ------------------------GAGRFCMGAAWRGPKP-----KDIEKVTEIIKAVK-
BIOB_HAEIG       ------------------------GAGRFCMGAAWRGPKP-----KDIEKVTEIIKAVK-
BIOB_HAES1       ------------------------GAGRFCMGAAWRGPKP-----KDIEKITEIIKAVK-
BIOB_HISS2       ------------------------GAGRFCMGAAWRGPKP-----KDIGKITEIIKAVK-
BIOB_PASMU       ------------------------GAGRFCMGAAWRGPKP-----KDIEKVTAIIKAVK-
BIOB_ACTSZ       ------------------------GASRFCMGAAWRGPKP-----KDIGKITEIVKAVK-
BIOB_MANSM       ------------------------GASRFCMGAAWRGPKP-----KDIAKMTEIIKAVK-
BIOB_ACTP7       ------------------------GASRFCMGAAWRGPKP-----KDIKVVSEIIGVVK-
BIOB_ACTPJ       ------------------------GASRFCMGAAWRGPKP-----KDIKVVSEIIGVVK-
BIOB_ACTP2       ------------------------GASRFCMGAAWRGPKP-----KDIKVVSEIIGAVK-
BIOB_HAEDU       ------------------------GASRFCMGAAWRGPKP-----KDIKVVSEIIGAVK-
BIOB_HAEPS       ------------------------GASRFCMGAAWRGPKP-----KDIETVSAIIKAVK-
BIOB_NEIG1       ------------------------GASRFCMGAAWRGPKP-----KDVETVSAIIKAVK-
BIOB_NEIG2       ------------------------GASRFCMGAAWRGPKP-----KDVETVSAIIKAVK-
BIOB_NEIM0       ------------------------GASRFCMGAAWRGPKP-----KDVETVSAIIKAVK-
BIOB_NEIMF       ------------------------GASRFCMGAAWRGPKP-----KDVETVSAIIKAVK-
BIOB_NEIMA       ------------------------GASRFCMGAAWRGPKP-----KDVETVSAIIKAVK-
BIOB_NEIMB       ------------------------GASRFCMGAAWRGPKP-----KDVETVSAIIKAVK-
BIOB_CHRVO       ------------------------GAGRFCMGAAWRGPKD-----ADLQKTLDMVREVK-
BIOB_METSK       ------------------------MRQPFCM-AAWQ-PKQ-----RDLEPVLAMIREVK-
BIOB_METFK       ------------------------GASRFCMGAAWRSPKQ-----RDLEPVLAMIREVK-
BIOB_THIDA       ------------------------GASRFCMGAAWRGPKQ-----RELEPVLAMVREVK-
BIOB_NITEC       ------------------------GATRFCMGAAWRGPKQ-----RDIEHMTELISAVK-
BIOB_NITEU       ------------------------GATRFCMGAAWRGPKQ-----RDIEYMTEVISAVK-
BIOB_NITMU       ------------------------GATRFCMGAAWRGPKE-----RDMKSVVEMVRAVK-
BIOB_ACISJ       ------------------------GATRFCMGAAWRAPKD-----RDIEKISELITAVK-
BIOB_ACIET       ------------------------GATRFCMGAAWRAPKD-----RDIEKMSELITAVK-
BIOB_DELAS       ------------------------GATRFCMGAAWRAPKD-----RDIEKMNELIGAVK-
BIOB_ACIAC       ------------------------GATRFCMGAAWRAPKD-----RDIEKVGELIAAVK-
BIOB_METPP       ------------------------GATRFCMGAAWREPKD-----RDIEKVVELVREVK-
BIOB1_POLSJ      ------------------------GATRFCMGAAWRSPKD-----RDIEKVAELVRTVK-
BIOB_HERAR       ------------------------GATRFCMGAAWREPKD-----RDLEKVEEMVREVK-
BIOB_JANMA       ------------------------GATRFCMGAAWREPKD-----RDLEKVEEMVREVK-
BIOB_RHOFT       ------------------------GATRFCMGAAWRSPKE-----RDLEKVEAMVRGVK-
BIOB_POLAQ       ------------------------GSNRFCMGAAWREPKD-----RDIEKVTAMIKGVK-
BIOB_BORBR       ------------------------GAQRFCMGAAWRSPKP-----HHLEAVAEMIGAVK-
BIOB_BORPA       ------------------------GAQRFCMGAAWRSPKP-----HHLEAVAEMIGAVK-
BIOB_BORPE       ------------------------GAQRFCMGAAWRSPKP-----HHLEAVAEMIGAVK-
BIOB_BORPD       ------------------------GAQRFCMGAAWRSPKP-----HHLDEVAEMIRAVK-
BIOB_BORA1       ------------------------GAQRFCMGAAWRSPKP-----HHLEAVAEMVREVK-
BIOB_BURCM       ------------------------GASRFCMGAAWRNPKE-----RHMPALTEMVRGVK-
BIOB_BURL3       ------------------------GASRFCMGAAWRNPKE-----RHMPALTEMVRGVK-
BIOB_BURA4       ------------------------GASRFCMGAAWRNPKE-----RHMPALTEMVRGVK-
BIOB_BURVG       ------------------------GASRFCMGAAWRNPKE-----RHMPALTEMVRGVK-
BIOB_BURM1       ------------------------GASRFCMGAAWRNPKE-----RHMPALTEMVRGVK-
BIOB_BURCA       ------------------------GASRFCMGAAWRNPKE-----RHMPALTEMVRGVK-
BIOB_BURCC       ------------------------GASRFCMGAAWRNPKE-----RHMPALTEMVRGVK-
BIOB_BURCH       ------------------------GASRFCMGAAWRNPKE-----RHMPALTEMVRGVK-
BIOB_BURCJ       ------------------------GASRFCMGAAWRNPKE-----RHMPALTEMVRGVK-
BIOB_BURM7       ------------------------GATRFCMGAAWRNPKD-----RHIEPIKEMIRGVK-
BIOB_BURM9       ------------------------GATRFCMGAAWRNPKD-----RHIEPIKEMIRGVK-
BIOB_BURP6       ------------------------GATRFCMGAAWRNPKD-----RHIEPIKEMIRGVK-
BIOB_BURMA       ------------------------GATRFCMGAAWRNPKD-----RHIEPIKEMIRGVK-
BIOB_BURMS       ------------------------GATRFCMGAAWRNPKD-----RHIEPIKEMIRGVK-
BIOB_BURP0       ------------------------GATRFCMGAAWRNPKD-----RHIEPIKEMIRGVK-
BIOB_BURPS       ------------------------GATRFCMGAAWRNPKD-----RHIEPIKEMIRGVK-
BIOB_BURP1       ------------------------GATRFCMGAAWRNPKD-----RHIEPIKEMIRGVK-
BIOB_BURTA       ------------------------GATRFCMGAAWRNPKD-----RHIEPIKEMIRGVK-
BIOB_PARPJ       ------------------------GATRFCMGAAWRNPKD-----RHLEPIKDMIRGVK-
BIOB_PARXL       ------------------------GATRFCMGAAWRNPKD-----RHLEPIKDMIRGVK-
BIOB_PARP8       ------------------------GATRFCMGAAWRNPKD-----RHLEPIKDMIRGVK-
BIOB_CUPTR       ------------------------GATRFCMGAAWRSPKD-----RHLEPVMDMVREVK-
BIOB_CUPNH       ------------------------GATRFCMGAAWRSPKD-----RHLEPVMDMVREVK-
BIOB_CUPPJ       ------------------------GATRFCMGAAWRSPKD-----RHLEPVMDMVREVK-
BIOB_CUPMC       ------------------------GATRFCMGAAWREPKE-----RHLEPVIDMVREVK-
BIOB_POLNA       ------------------------GATRFCMGAAWSRPKE-----RDMERVTEMVREVR-
BIOB2_POLSJ      ------------------------GATRFCMGAAWRSPKE-----RDMERVTEIVREVR-
BIOB_LEPCP       ------------------------GATRFCMGAAWRSPKE-----RDMERVTEMVREVR-
BIOB_RALPJ       ------------------------GASRFCMGAAWRNPKP-----HQLDAVADMVRGVK-
BIOB_RALSO       ------------------------GASRFCMGAAWRNPKP-----HQLDAVADMVRGVK-
BIOB_AZOSB       ------------------------GSSRFCMGAAWRGPKD-----KDMAPVLEMVREVK-
BIOB_AROAE       ------------------------GASRFCMGAAWRGPKD-----KDMETVLAMVREVK-
BIOB_DECAR       ------------------------GASRFCMGAAWKGPKD-----NDLDRVLDMVREVK-
BIOB_GLUDA       ------------------------GAARFCMGAAWRSPKD-----HDLETVCAMVEGVK-
BIOB_GLUOX       ------------------------GAGRFCMGAAWRTPKD-----HDLDTVCEMIEGVK-
BIOB_GRABC       ------------------------GASRFCMGAAWRSPKE-----RDMDTVCEMIEGVK-
BIOB_ACICJ       ------------------------GAQRFCMGAAWRSPKD-----HDLDRVAAMVEGVK-
BIOB_STRM5       ------------------------GASRFCMGAAWRSPKD-----RDIPKVAAMIAGVK-
BIOB_STRMK       ------------------------GASRFCMGAAWRSPKD-----RDIPKVAAMIAGVK-
BIOB_XANAC       ------------------------GASRFCMGAAWRSPKE-----RDIPKVAAMIREVK-
BIOB_XANC5       ------------------------GASRFCMGAAWRSPKE-----RDIPKVAAMIREVK-
BIOB_XANOM       ------------------------GASRFCMGAAWRSPKE-----RDIPKVAAMIREVK-
BIOB_XANOP       ------------------------GASRFCMGAAWRSPKE-----RDIPKVAAMIREVK-
BIOB_XANOR       ------------------------GASRFCMGAAWRSPKE-----RDIPKVAAMIREVK-
BIOB_XANC8       ------------------------GASRFCMGAAWRSPKD-----RDIPKVAAMIREVK-
BIOB_XANCB       ------------------------GASRFCMGAAWRSPKD-----RDIPKVAAMIREVK-
BIOB_XANCP       ------------------------GASRFCMGAAWRSPKD-----RDIPKVAAMIREVK-
BIOB_XYLF2       ------------------------GASRFCMGAAWRSPKD-----RDIPKIASMIREVK-
BIOB_XYLFT       ------------------------GASRFCMGAAWRSPKD-----RDIPKIASMIREVK-
BIOB_XYLFM       ------------------------GASRFCMGAAWRSPKD-----RDIPKIASMIREVK-
BIOB_XYLFA       ------------------------GASRFCMGAAWRSPKD-----RDIPKIAAMIREVK-
BIOB_AZOC5       ------------------------GAARFCMGAAWRAPKD-----RDMDAVCAMISGVR-
BIOB_XANP2       ------------------------GATRFCMGAAWRSPKD-----RDLDAVCAMISGVK-
BIOB_RHOS1       ------------------------GAQRFCMGAAWRSPKD-----RDMDQLCDMVRGVA-
BIOB_RHOS4       ------------------------GAQRFCMGAAWRSPKD-----RDMDRLCDMVRGVA-
BIOB_RHOSK       ------------------------GAQRFCMGAAWRSPKD-----RDMDRLCDMVQGVA-
BIOB1_PARDP      ------------------------GAQRFCMGAAWRSPKD-----RDMDKLCDMVRGVA-
BIOB_BRASB       ------------------------GAERFCMAAAWRSPKD-----RDLDQVCDMVSAVK-
BIOB_BRASO       ------------------------GADRFCMAAAWRNPKD-----RDLDQVCDMVSAVK-
BIOB_NITHX       ------------------------GASRFCMAAAWRNPKD-----RDLDRVCDMVSAVK-
BIOB_NITWN       ------------------------GAGRFCMAAAWRHPKD-----RDLDRVCDMISAVK-
BIOB_OLICO       ------------------------GAGRFCMAAAWRNPKE-----KDLERICHMVSAVK-
BIOB_BRADU       ------------------------GATRFCMAAAWRTPKD-----RDLDSVCDMVNAVK-
BIOB_RHOPA       ------------------------GATRYCMGAAWRSPKE-----RDMAPVIEMVKGVK-
BIOB_RHOPT       ------------------------GATRYCMGAAWRSPKE-----RDMAPVIEMVKGVK-
BIOB_RHOPS       ------------------------GATRYCMGAAWRSPKD-----RDMAPVIEMVKGVK-
BIOB_RHOP2       ------------------------GATRYCMGAAWRSPKD-----RDMAPVIEMVKGVK-
BIOB_RHOP5       ------------------------GATRYCMGAAWREPKD-----RDMAPVIEMVKGVK-
BIOB_RHOPB       ------------------------GATRYCMGAAWRSPKD-----RDMAPVIEMVKGVK-
BIOB_CAUVN       ------------------------GAQRFCMGAAWRELKD-----RDLPKLTEMIGEVK-
BIOB_CAUVC       ------------------------GAQRFCMGAAWRELKD-----RDLPKLTEMIGEVK-
BIOB_CAUSK       ------------------------GAQRFCMGAAWRELKD-----RDLPKLAAMIGGVK-
BIOB_PHEZH       ------------------------GAQRFCMGAAWRDLKD-----RDLPKVAAMISGVK-
BIOB_HYPNA       ------------------------GADRFCMGAAWRSLKD-----RDLPKVAEMISAVK-
BIOB_MARMM       ------------------------GATRFCMGAAWRELKT-----RDEDVICDMISGVK-
BIOB_ERYLH       ------------------------GSQRFCMGAAWRNPKD-----RDMPAIVEIVKGVR-
BIOB_NOVAD       ------------------------GSKRFCMGAAWRNPKD-----RDMPAIISMIKGVR-
BIOB_SPHAL       ------------------------GSKRFCMGAAWRNPKD-----RDMPAIVEMIEGVR-
BIOB_SPHWW       ------------------------GSTRFCMGAAWRNPKD-----RDMPAIVEMVKGVR-
BIOB_PARL1       ------------------------GATRYCMGAAWREPKD-----RDMDMVCAMVEGIK-
BIOB_ACIF2       ------------------------GAQRLCMGAAWRSPHD-----RDIEKVAAMIGVVK-
BIOB_ACIF5       ------------------------GAQRLCMGAAWRSPHD-----RDIEKVAAMIGVVK-
BIOB_NITOC       ------------------------GASRFCMGAAWRRLKE-----RELEPVAKMITEVK-
BIOB_THISH       ------------------------GASRFCMGAAWRNPTD-----RNLERVIEMVEGVK-
BIOB_ALKEH       ------------------------GATRFCMGAAWRSPKD-----RDLETVEAMVREVK-
BIOB_HALHL       ------------------------GATRLCMGAAWRGPKD-----RDLETLVAMVRAVK-
BIOB_ALCBS       ------------------------GASRFCMGAAWRSPRD-----KDMPYVLDMIRQVK-
BIOB_METCA       ------------------------GATRFCMGAAWRSPRD-----GDLEAIAAMVEGVK-
BIOB_MAGSA       ------------------------GASRFCMGAAWRGPKG-----DDFEVAVAMIEGVK-
BIOB_ACIB3       ------------------------GSSRFCMGAAWRNPHE-----RDMPYVLEMVREVK-
BIOB_ACIB5       ------------------------GSSRFCMGAAWRNPHE-----RDMPYVLEMVREVK-
BIOB_ACIBY       ------------------------GSSRFCMGAAWRNPHE-----RDMPYVLEMVREVK-
BIOB_ACIBC       ------------------------GSSRFCMGAAWRNPHE-----RDMPYVLEMVREVK-
BIOB_ACIBT       ------------------------GSSRFCMGAAWRNPHE-----RDMPYVLEMVREVK-
BIOB_ACIBS       ------------------------GSSRFCMGAAWRNPHE-----RDMPYVLEMVREVK-
BIOB_ACICA       ------------------------GSSRFCMGAAWRNPHE-----RDMPYVLEMVREVK-
BIOB_ACIAD       ------------------------GSSRFCMGAAWRNPHE-----RDMPYVLEMVREVK-
BIOB_PSYA2       ------------------------GSSRFCMGAAWKHPSA-----KDMPYVVELVKEVK-
BIOB_PSYCK       ------------------------GSSRFCMGAAWKHPSA-----KDMPYVVELVKEVK-
BIOB_PSYWF       ------------------------GSSRFCMGAAWKHPSA-----KDMPYVAELIKEVK-
BIOB_CELJU       ------------------------GATRFCMGAAWRSPKG-----KDMPYVTAMVKGVK-
BIOB_SACD2       ------------------------GATRFCMGAAWRSPKK-----KDMPYVTAMVKGVK-
BIOB_HAHCH       ------------------------GASRFCMGAAWRNPRA-----KDMPYVLEMVKQVK-
BIOB_MARHV       ------------------------GASRFCMGAAWRSPSK-----KDMPYVLDMVRQVK-
BIOB_CHRSD       ------------------------GASRFCMGAAWRSPRE-----KDLRVVTEMVGRVK-
BIOB_PSE14       ------------------------GSTRFCMGAAWKHPSA-----KDMPYVLEMVKGVK-
BIOB_PSEU2       ------------------------GSTRFCMGAAWKHPSA-----KDMPYVLEMVKGVK-
BIOB_PSESM       ------------------------GSTRFCMGAAWKHPSA-----KDMPYVLEMVKGVK-
BIOB_PSEF5       ------------------------GSTRFCMGAAWKHPSA-----KDMPYVLEMVKGVK-
BIOB_PSEPF       ------------------------GSTRFCMGAAWKHPSA-----KDMPYVLKMVEGVK-
BIOB_PSEP1       ------------------------GSTRFCMGAAWKHPSA-----KDMPYVLEMVKGVK-
BIOB_PSEPK       ------------------------GSTRFCMGAAWKHPSA-----KDMPYVLEMVKGVK-
BIOB_PSEPG       ------------------------GSTRFCMGAAWKHPSA-----KDMPYVLEMVKGVK-
BIOB_PSEPW       ------------------------GSTRFCMGAAWKHPSA-----KDMPYVLEMVKGVK-
BIOB_PSEE4       ------------------------GSTRFCMGAAWKHPSA-----KDMPYVLEMVKGVK-
BIOB_PSEA8       ------------------------GSTRFCMGAAWKHPSA-----KDMPYVLEMVKGVK-
BIOB_PSEAE       ------------------------GSTRFCMGAAWKHPSA-----KDMPYVLEMVKGVK-
BIOB_PSEAB       ------------------------GSTRFCMGAAWKHPSA-----KDMPYVLEMVKGVK-
BIOB_PSEA7       ------------------------GSTRFCMGAAWKHPSA-----KDMPYVLEMVKGVK-
BIOB_PSEMY       ------------------------GSTRFCMGAAWKHPSA-----KDMPYVLKMVEGVK-
BIOB_PSEU5       ------------------------GSTRFCMGAAWKHPSA-----KDMPYVLKMVEGVK-
BIOB_IDILO       ------------------------GASRFCMGAAWRNPKD-----RDMPYVIEMIKGVK-
BIOB_COLP3       ------------------------GSTRFCMGAAWRNPKE-----RDMPYVLDMVKSVK-
BIOB_PSYIN       ------------------------GSTRFCMGAAWKNPKQ-----RDMPYLLDMIKEVR-
BIOB_MARMS       ------------------------GASRFCMGAAWKHPSE-----KDFPYVLEMIKGVK-
BIOB_PSEHT       ------------------------GATRFCMGAAWSDPKD-----RDMPYISQMVKEVK-
BIOB_SHEB2       ------------------------GASRFCMGAAWRNPKE-----KDMPYLKQMVQEVK-
BIOB_SHEB5       ------------------------GASRFCMGAAWRNPKE-----KDMPYLKQMVQEVK-
BIOB_SHEB8       ------------------------GASRFCMGAAWRNPKE-----KDMPYLKQMVQEVK-
BIOB_SHEB9       ------------------------GASRFCMGAAWRNPKE-----KDMPYLKQMVQEVK-
BIOB_SHESA       ------------------------GASRFCMGAAWRNPKD-----KDMPYLKQMVQEVK-
BIOB_SHESM       ------------------------GASRFCMGAAWRNPKD-----KDMPYLKQMVQEVK-
BIOB_SHESR       ------------------------GASRFCMGAAWRNPKD-----KDMPYLKQMVQEVK-
BIOB_SHEON       ------------------------GASRFCMGAAWRNPKD-----KDMPYLKQMVQEVK-
BIOB_SHEPC       ------------------------GASRFCMGAAWRNPKE-----KDMPYLKQMVQEVK-
BIOB_SHESW       ------------------------GASRFCMGAAWRNPKE-----KDMPYLKQMVQEVK-
BIOB_SHEHH       ------------------------GASRFCMGAAWRNPKE-----RDMPYLKTMVEEVK-
BIOB_SHEPA       ------------------------GASRFCMGAAWRNPKE-----RDMPYLKTMVEEVK-
BIOB_SHEPW       ------------------------GASRFCMGAAWRNPKE-----RDMPYLKTMVEEVK-
BIOB_SHEDO       ------------------------GASRFCMGAAWRNPRD-----RDMPYLTQMVKDVK-
BIOB_SHEFN       ------------------------GASRFCMGAAWRNPRD-----KDMPYLTQMVKDVR-
BIOB_SHESH       ------------------------GASRFCMGAAWRNPHA-----RDMPYLKDMVSEVK-
BIOB_SHEWM       ------------------------GASRFCMGAAWRNPHA-----RDMPYLKDMVREVK-
BIOB_SHELP       ------------------------GASRFCMGAAWRNPHE-----RDMPYLKDMVSEVK-
BIOB_SHEAM       ------------------------GATRFCMGAAWRNPHE-----RDMPYLTDMVKEVK-
BIOB_AERHH       ------------------------GSSRFCMGAAWRNPKE-----KDMPYILRMIEEVR-
BIOB_AERS4       ------------------------GSSRFCMGAAWRNPKE-----RDMPYILRMIEEVR-
BIOB_ALTMD       ------------------------GSTRFCMGAAWRNPRD-----RDMPYILKMVEEVK-
BIOB_PSEA6       ------------------------GSTRFCMGAAWRNPKE-----RDMPYVTDMVREVK-
BIOB_ALIF1       ------------------------GSTRFCMGAAWKNPKE-----RDMPYLLDMIKGVK-
BIOB_ALIFM       ------------------------GSTRFCMGAAWKNPKE-----RDMPYLLDMIKGVK-
BIOB_ALISL       ------------------------GSTRFCMGAAWKNPKE-----RDMPYLLDMIKGVK-
BIOB_VIBC3       ------------------------GSTRFCMGAAWKNPKE-----RDMPLLKEMIRGVK-
BIOB_VIBCH       ------------------------GSTRFCMGAAWKNPKE-----RDMPLLKEMIRGVK-
BIOB_VIBTL       ------------------------GSTRFCMGAAWKNPKE-----RDMPHLTDMIKGVK-
BIOB_VIBCB       ------------------------GSTRFCMGAAWKNPKE-----RDMPHLTDMIKGVK-
BIOB_VIBPA       ------------------------GSTRFCMGAAWKNPKE-----RDMPHLTDMIKGVK-
BIOB_VIBVU       ------------------------GSTRFCMGAAWKNPKE-----RDMPLLTDMIKGVK-
BIOB_VIBVY       ------------------------GSTRFCMGAAWKNPKE-----RDMPLLTDMIKGVK-
BIOB_PHOPR       ------------------------GATRFCMGAAWKNPKE-----RDMPYLMDMIRGVK-
BIOB_BUCA5       ------------------------GSSRFCMGAAWKNPKE-----KDMPYLEKIIKKIK-
BIOB_BUCAT       ------------------------GSSRFCMGAAWKNPKE-----KDMPYLEKIIKKIK-
BIOB_BUCAI       ------------------------GSSRFCMGAAWKNPKE-----KDMPYLEEIIKKIK-
BIOB_BUCAP       ------------------------GSTRFCMGAAWKNPKE-----KDMPYLEKIVKEVK-
BIOB_BUCBP       ------------------------GSTRFCMGAAWKNPKE-----RDMHFLKTVIQEVK-
BIOB_WIGBR       ------------------------GVTRFCMGAAWKNPKD-----KDIPLLEEMIKSVK-
BIOB_BAUCH       ------------------------GSTRFCIGAAWKKIHD-----RDMPLLEQIVTGVK-
BIOB_PECAS       ------------------------GSTRFCMGAAWKNPHE-----RDMPYLEQMVQGVK-
BIOB_ERWT9       ------------------------GSGRFCMGAAWKNPHE-----RDMPYLEKMVQGVK-
BIOB_SERMA       ------------------------GSTRFCMGAAWKNPHE-----RDMPYLQQMVQGVK-
BIOB_SERP5       ------------------------GSTRFCMGAAWKNPHE-----RDMPYLQQMVQGVK-
BIOB_YERPA       ------------------------GSTRFCMGAAWKNPHE-----RDMPYLAKMVEGVK-
BIOB_YERPB       ------------------------GSTRFCMGAAWKNPHE-----RDMPYLAKMVEGVK-
BIOB_YERPE       ------------------------GSTRFCMGAAWKNPHE-----RDMPYLAKMVEGVK-
BIOB_YERPG       ------------------------GSTRFCMGAAWKNPHE-----RDMPYLAKMVEGVK-
BIOB_YERPN       ------------------------GSTRFCMGAAWKNPHE-----RDMPYLAKMVEGVK-
BIOB_YERPP       ------------------------GSTRFCMGAAWKNPHE-----RDMPYLAKMVEGVK-
BIOB_YERPS       ------------------------GSTRFCMGAAWKNPHE-----RDMPYLAKMVEGVK-
BIOB_YERPY       ------------------------GSTRFCMGAAWKNPHE-----RDMPYLAKMVEGVK-
BIOB_YERP3       ------------------------GSTRFCMGAAWKNPHE-----RDMPYLVKMVEGVK-
BIOB_YERE8       ------------------------GSTRFCMGAAWKNPHE-----RDMPYLEKMVEGVK-
BIOB_PSEVU       ------------------------GSTRFCMGAAWKNPHE-----RDMPYLEQMVQGVK-
BIOB_ENT38       ------------------------GSTRFCMGAAWKNPHD-----RDMPYLEQMVQGVK-
BIOB_KLEP3       ------------------------GSTRFCMGAAWKNPND-----RDMPYLEQMVKGVK-
BIOB_KLEP7       ------------------------GSTRFCMGAAWKNPND-----RDMPYLEQMVKGVK-
BIOB_SALPB       ------------------------GSTRFCMGAAWRNPHE-----RDMPYLEKIVQGVK-
BIOB_SALPC       ------------------------GSTRFCMGAAWRNPHE-----RDMPYLEKIVQGVK-
BIOB_SALNS       ------------------------GSTRFCMGAAWRNPHE-----RDMPYLEKIVQGVK-
BIOB_SALTY       ------------------------GSTRFCMGAAWRNPHE-----RDMPYLEKIVQGVK-
BIOB_SALCH       ------------------------GSTRFCMGAAWRNPHE-----RDMPYLEKIVQGVK-
BIOB_SALA4       ------------------------GSTRFCMGAAWKNPHE-----RDMPYLEKIVQGVK-
BIOB_SALTI       ------------------------GSTRFCMGAAWKNPHE-----RDMPYLEKIVQGVK-
BIOB_SALHS       ------------------------GSTRFCMGAAWKNPHE-----RDMPYLEQIVQGVK-
BIOB_SALPA       ------------------------GSTRFCMGAAWKNPHE-----RDMPYLEQIVQGVK-
BIOB_SALDC       ------------------------GSTRFCMGAAWKNPHE-----RDMPYLEQIVQGVK-
BIOB_SALEP       ------------------------GSTRFCMGAAWKNPHE-----RDMPYLEQIVQGVK-
BIOB_SALSV       ------------------------GSTRFCMGAAWKNPHE-----RDMPYLEQIVQGVK-
BIOB_SALPK       ------------------------GSTRFCMGAAWKNPHE-----RDMPYLEQIVQGVK-
BIOB_SALG2       ------------------------GSTRFCMGAAWKNPHE-----RDMPYLEQIVQGVK-
BIOB_SALAR       ------------------------GSTRFCMGAAWKNPRE-----RDMPYLEQIVQGVK-
BIOB_CITK8       ------------------------GSTRFCMGAAWKNPHE-----RDMPYLEQMVQGVK-
BIOB_SHIB3       ------------------------GSTRFCMGAAWKNPNE-----RDMPYLEQMVQGVK-
BIOB_SHIBS       ------------------------GSTRFCMGAAWKNPNE-----RDMPYLEQMVQGVK-
BIOB_ECO81       ------------------------GSTRFCMGAAWKNPHE-----RDMPYLEQMVQGVK-
BIOB_ECOL6       ------------------------GSTRFCMGAAWKNPHE-----RDMPYLEQMVQGVK-
BIOB_ECOK1       ------------------------GSTRFCMGAAWKNPHE-----RDMPYLEQMVQGVK-
BIOB_ECOUT       ------------------------GSTRFCMGAAWKNPHE-----RDMPYLEQMVQGVK-
BIOB_ECO45       ------------------------GSTRFCMGAAWKNPHE-----RDMPYLEQMVQGVK-
BIOB_ECOL5       ------------------------GSTRFCMGAAWKNPRE-----RDMPYLEQMVQGVK-
BIOB_SHIF8       ------------------------GSTRFCMGAAWKNPHE-----RDMPYLEQMVQGVK-
BIOB_SHIFL       ------------------------GSTRFCMGAAWKNPHE-----RDMPYLEQMVQGVK-
BIOB_ECO57       ------------------------GSTRFCMGAAWKNPHE-----RDMSYLEQMVQGVK-
BIOB_ECO5E       ------------------------GSTRFCMGAAWKNPHE-----RDMSYLEQMVQGVK-
BIOB_SHISS       ------------------------GSTRFCMGAAWKNPHE-----RDMPYLEQMVQGVK-
BIOB_ECOLI       ------------------------GSTRFCMGAAWKNPHE-----RDMPYLEQMVQGVK-
BIOB_ECOSM       ------------------------GSTRFCMGAAWKNPHE-----RDMPYLEQMVQGVK-
BIOB_ECOLU       ------------------------GSTRFCMGAAWKNPHE-----RDMPYLEQMVQGVK-
BIOB_ECOLC       ------------------------GSTRFCMGAAWKNPHE-----RDMPYLEQMVQGVK-
BIOB_ECOHS       ------------------------GSTRFCMGAAWKNPHE-----RDMPYLEQMVQGVK-
BIOB_ECODH       ------------------------GSTRFCMGAAWKNPHE-----RDMPYLEQMVQGVK-
BIOB_ECO8A       ------------------------GSTRFCMGAAWKNPHE-----RDMPYLEQMVQGVK-
BIOB_ECO7I       ------------------------GSTRFCMGAAWKNPHE-----RDMPYLEQMVQGVK-
BIOB_ECO55       ------------------------GSTRFCMGAAWKNPHE-----RDMPYLEQMVQGVK-
BIOB_ECO27       ------------------------GSTRFCMGAAWKNPHE-----RDMPYLEQMVQGVK-
BIOB_ECO24       ------------------------GSTRFCMGAAWKNPHE-----RDMPYLEQMVQGVK-
BIOB_SHIDS       ------------------------GSTRFCMGAAWKNPHE-----RDMPYLEQMVQGVK-
BIOB_ECOSE       ------------------------GSTRFCMGAAWKNPHE-----RDMPYLEQMVQGVK-
BIOB_ESCF3       ------------------------GSTRFCMGAAWKNPHE-----RDMPYLEQMVQGVK-
BIOB_CROS8       ------------------------GSTRFCMGAAWKNPND-----RDMPYLEQMVQGVK-
BIOB_PHOLL       ------------------------GSTRFCMGAAWKNPHE-----RDMPYLEKMVKEVK-
BIOB_PROMH       ------------------------GSTRFCMGAAWRNPHE-----RDMPYLEQMVKEVK-
BIOB_SODGM       ------------------------GSTRFCMGAAWKNPHD-----RDMPLLEQMVQGVK-
BIOB_METI4       ------------------------GASRFCLGAAWRGLFEGE---TKTKKICKIISKIS-
BIOB_BACSU       ------------------------NIGTYCIVASGRGPSNRE-----VDQVVDAVQEIK-
BIOB_BACNA       ------------------------NIGTYCIVASGRGPSNRE-----VDQVVDAVQEIK-
BIOB_BACVZ       ------------------------NIGTYCIVASGRGPSNRE-----VDQVVDAVKEIK-
BIOB_BACAM       ------------------------NIGTYCIVASGRGPSNRE-----VDQVVDAVKEIK-
BIOB_BACLD       ------------------------NIGTYCIVASGRGPSNRE-----VDQVVDAVKEIK-
BIOB_BACHD       ------------------------NVGTYCIVASGRGPTNRD-----IDHVTEAVREIK-
BIOB_GEOKA       ------------------------RIGTYCIVASGRGPSDKE-----IDTVVSAVKEIK-
BIOB_GEOTN       ------------------------QIGTYCIVASGRGPSDKE-----VDIVVSAVKEIK-
BIOB_ANOFW       ------------------------KIGTYCIVASGRGPSDKE-----IDIVVSAVKEIK-
BIOB_LYSSH       ------------------------KIGTYCIVASGRGPTRKD-----VNVVSEAVEEIK-
BIOB_LYSSC       ------------------------KIGTYCIVASGRGPTRKD-----VNVVSEAVVEIK-
BIOB_BACAN       ------------------------KAGTYCIVASGRRPTDKE-----VNHVIGAVKEIR-
BIOB_BACC0       ------------------------KAGTYCIVASGRRPTDKE-----VNHVIGAVKEIR-
BIOB_BACCZ       ------------------------KAGTYCIVASGRRPTDKE-----VNHVIGAVKEIR-
BIOB_BACHK       ------------------------KAGTYCIVASGRRPTDKE-----VNHVIGAVKEIR-
BIOB_BACAH       ------------------------KAGTYCIVASGRRPTDKE-----VNHVIGAVKEIR-
BIOB_BACC7       ------------------------KAGTYCIVASGRRPTDKE-----VNHVIGAVKEIR-
BIOB_BACCQ       ------------------------KAGTYCIVASGRRPTDKE-----VNHVIGAVKEIR-
BIOB_BACC1       ------------------------KAGTYCIVASGRRPTDKE-----VNHVIGAVKEIR-
BIOB_BACC2       ------------------------KAGTYCIVASGRRPTDKE-----VNHVIGAVKEIR-
BIOB_BACC4       ------------------------KAGTYCIVASGRRPTDKE-----VNHVIGAVKEIR-
BIOB_BACCR       ------------------------KAGTYCIVASGRRPTDKE-----VNHVIGAVKEIR-
BIOB_BACMK       ------------------------KAGTYCIVASGRRPTNKE-----VNHVIGAVKEIR-
BIOB_BACCN       ------------------------KAGTYCIVASGRRPTDKE-----VNHVIGAVKEIK-
BIOB_BACP2       ------------------------KAGTYCIVASGRAPSHRE-----LDEVTAAVKEIT-
BIOB_STAAM       ------------------------HIGTYCIVMSGRGPSDKE-----VDHISNTVRTIKS
BIOB_STAAN       ------------------------HIGTYCIVMSGRGPSDKE-----VDHISNTVRTIKS
BIOB_STAAS       ------------------------HIGTYCIVMSGRGPSDKE-----VDHISNTVRTIKS
BIOB_STAA9       ------------------------HIGTYCIVMSGRGPSDKE-----VDHISNTVRTIKS
BIOB_STAAB       ------------------------HIGTYCIVMSGRGPSDKE-----VDHISNTVRTIKS
BIOB_STAAW       ------------------------HIGTYCIVMSGRGPSDKE-----VDHISNTVRTIKS
BIOB_STAA1       ------------------------HIGTYCIVMSGRGPSDKE-----VDHISNTVRTIKS
BIOB_STAA2       ------------------------HIGTYCIVMSGRGPSDKE-----VDHISNTVRTIKS
BIOB_STAAR       ------------------------HIGTYCIVMSGRGPSDKE-----VDHISNTVRTIKS
BIOB_STAAC       ------------------------HIGTYCIVMSGRGPSDKE-----VDHISNTVRTIKS
BIOB_STAAT       ------------------------HIGTYCIVMSGRGPSDKE-----VDHISNTVRTIKS
BIOB_STAA8       ------------------------HIGTYCIVMSGRGPSDKE-----VDHISNTVRTIKS
BIOB_STAAE       ------------------------HIGTYCIVMSGRGPSDKE-----VDHISNTVRTIKS
BIOB_STAA3       ------------------------HIGTYCIVMSGRGPSDKE-----VDHISNTVRTIKS
BIOB_STAEQ       ------------------------QIGTYCIVMSGRGPSNRE-----VDHICETVEDIKK
BIOB_STAES       ------------------------QIGTYCIVMSGRGPSNRE-----VDHICETVEDIKK
BIOB_STAHJ       ------------------------HIGTYCIVMSGRGPTNRE-----VDHICETVHDIKV
BIOB_STACT       ------------------------QIGTYCIVMSGRGPSDKE-----VDHITESVRQIKE
BIOB_MACCJ       ------------------------DIGTYCIVMSGRGPSDKE-----VEHIADTVEAIKH
BIOB_RHOBA       ------------------------GAKTYCLVISARGPNERE-----MKAVEEIVPEIK-
BIOB_THEEB       ------------------------KAGTFCMVISGRSPSEKV-----FEQVLAAIRAVK-
BIOB_SALRD       ------------------------GAVTYCIVTATRGPHSSE-----VDVVCEATRRIK-
BIOB_STRAW       ------------------------GAKRVCLVASGRGPTDRD-----VDRVSDTIKAIKD
BIOB_STRCO       ------------------------GAKRVCLVASGRGPTDRD-----VDRVSDTIKAIKE
BIOB_STRGG       ------------------------GAKRVCLVASGRGPTDRD-----VDRVSKTIEAIKE
BIOB2_FRACC      ------------------------GARRVCLVASGRGPTDRD-----VDRVADTIGAIKT
BIOB_NOCSJ       ------------------------GATRVCLVSSGRGPSDRD-----VDRVAAMAQELKG
BIOB_SACEN       ------------------------GASRVCLVSSGRGPSTRD-----IDKVTEMVVALKE
BIOB_KOCRD       ------------------------GASRVCLVASGRGPSNRE-----VGNVTRTVEALKE
BIOB_RENSM       ------------------------GASRVCFVASGRGPSDRD-----VDRVAGLVGDFKT
BIOB_CUTAK       ------------------------GARRVCMVASGHGPSRRD-----VERVNGMVRSLKA
BIOB_ACAM1       ------------------------GVYRYCMVSSGRGPTAER-----TEHLAHIIRRIK-
BIOB_MAGMM       ------------------------GAYRYCMVSSGRSPHAER-----IDHMSKLIREIK-
BIOB_LEPBA       ------------------------GAYRFCMVTSGRGPTDKA-----VDKLAETISKIN-
BIOB_LEPBP       ------------------------GAYRFCMVTSGRGPTDKA-----VDKLAETISKIN-
BIOB_LEPBJ       ------------------------GAYRFCMVTSGTGPNRLT-----TERLASTIRRIT-
BIOB_LEPBL       ------------------------GAYRFCMVTSGTGPNRLT-----TERLASTIRRIT-
BIOB_LEPIC       ------------------------GAYRFCMVTSGTGPNRLT-----TEKLASTIQRIT-
BIOB_LEPIN       ------------------------GAYRFCMVTSGTGPNRLT-----TEKLASTIQRIT-
BIOB_THET2       ------------------------SARRFCLVAALRGPTPKV-----LERLGEAAQAIK-
BIOB_THET8       ------------------------SARRFCLVAALRGPTPKV-----LERLGEAAQAIK-
BIOB_STRA1       ------------------------GASVFCIAMSGTKPSKRE-----IEQLCQVIPEIK-
BIOB_STRA5       ------------------------GASVFCIAMSGTKPSKRE-----IEQLCQVIPEIK-
BIOB_STRA3       ------------------------GASVFCIAMSGTKPSKRE-----IEQLCQVIPEIK-
BIOB_CORGL       ------------------------GATEFCIVAAVKGPDERL------MTQLEEAVLAIH
BIOB_CORGB       ------------------------GATEFCIVAAVKGPDERL------MTQLEEAVLAIH
BIOB_COREF       ------------------------GATEFCIVAAVKGPDDKL------MNQLEEAVAAIQ
BIOB1_CORDI      ------------------------GATEFCIVAAVKGPDERL------MSQLEEAVAAIK
BIOB_CORU7       ------------------------GATEFCIVAAVKGPDENL------MRQLEVAVEAIR
BIOB_CORJK       ------------------------GATEFCIVAAVKGPDEDL------MNQMAKAIAAIQ
BIOB_MYCBO       ------------------------GATEFCIVAAVRGPDERL------MAQVAAGIEAIR
BIOB_MYCTU       ------------------------GATEFCIVAAVRGPDERL------MAQVAAGIEAIR
BIOB_MYCTA       ------------------------GATEFCIVAAVRGPDERL------MAQVAAGIEAIR
BIOB_MYCTF       ------------------------GATEFCIVAAVRGPDERL------MAQVAAGIEAIR
BIOB_MYCBP       ------------------------GATEFCIVAAVRGPDERL------MAQVAAGIEAIR
BIOB_MYCMM       ------------------------GATEFCIVAAVRGPDARL------LSQVAAGIEAIR
BIOB_MYCUA       ------------------------GATEFCIVAAVRGPDARL------LSQVAAGIEAIR
BIOB_MYCA1       ------------------------GATEFCIVAAVRGPDERL------LAQVAAGIEAIR
BIOB_MYCPA       ------------------------GATEFCIVAAVRGPDERL------LAQVAAGIEAVR
BIOB_MYCLE       ------------------------GATEFCIVAAVRGPDERL------MSQVAAGIEAIR
BIOB_MYCLB       ------------------------GATEFCIVAAVRGPDERL------MSQVAAGIEAIR
BIOB_MYCGI       ------------------------GATEFCIVAAVRGPDERL------LAQVAAGIEAIR
BIOB_MYCVP       ------------------------GATEFCIVAAVRGPDERL------LAQVAAGIEAIR
BIOB_MYCSJ       ------------------------GATEFCIVAAVRGPDERL------LAQVAAGIEAIR
BIOB_MYCSK       ------------------------GATEFCIVAAVRGPDERL------LAQVAAGIEAIR
BIOB_MYCSS       ------------------------GATEFCIVAAVRGPDERL------LAQVAAGIEAIR
BIOB_MYCS2       ------------------------GATEFCIVAAVRGPDERL------LAQVAAGIEAIR
BIOB_MYCA9       ------------------------GATEFCIVAAVRGPDERL------LAQVAAGIEAIR
BIOB_NOCFA       ------------------------GATEFCIVAAVRGPDARL------MAQVAAGVEAIR
BIOB_RHOJR       ------------------------GASEFCIVAAVRGPDERL------LAQVAAGIEAIR
BIOB_FRAAA       ------------------------GATEFCIVAAVRGPDARL------MSQVREGVAAIR
BIOB1_FRACC      ------------------------GATEFCIVAAVRGPDARL------MAQVREGVAAIR
BIOB_FRASN       ------------------------GATEFCIVAAVRGPDQRL------MAQIREGVAAIR
BIOB_SALAI       ------------------------GATEFCIVAAVRGPDDRL------MRQLREGVAAIR
BIOB_SALTO       ------------------------GATEFCIVAAVRGPDDRL------MRQLREGVAAIQ
BIOB_PSECP       ------------------------GATEFCIVAAVRGPDIKL------MNQVKFAIGRIN
BIOB_ARTS2       ------------------------GATEFCIVAAVRCPDIKL------MNQIKFAIDRIN
BIOB_PAEAT       ------------------------GATEFCIVAAVRGPDIKL------MNQIKFAIDRIN
BIOB_ACIC1       ------------------------GATEFCIVAAVRGPDDRL------MRQVRAAVRAIR
BIOB_CENSY       ------------------------EASSYCLVAAWREPTPEG------FEKVCTIIQEIN
BIOB_NITMS       ------------------------GAESYCLVAAWREPSRTD------FEKVCKIITEIN
BIOB_HELPY       -----------------------LGALGFCLVTSGRELDDEK-----CEYIAKLAKAINQ
BIOB_HELPH       -----------------------LGALGFCLVTSGRELDDEK-----CEYIAKLAKAINQ
BIOB_HELPS       -----------------------LGALGFCLVTSGRELDDEK-----CEYIAKLAKAINQ
BIOB_HELPG       -----------------------LGALGFCLVTSGRELDDEK-----CEYIAKLAKAINK
BIOB_HELPJ       -----------------------LGALGFCLVTSGRELDDEK-----CEYIAKLAKAINK
BIOB_HELP2       -----------------------LGALGFCLVTSGRELDDEK-----CEYIAKLAKAINK
BIOB_HELAH       -----------------------LGALGFCLVTSGRELDDEK-----CEYIAKLAKAINQ
BIOB_HELHP       -----------------------YGALGFCLVTAGRSLESQK-----CEYIAKAASAIKK
BIOB_WOLSU       -----------------------SGALGFCLVTAGRSLDSAK-----TAYISEAARSIKE
BIOB_ARCB4       -----------------------NKAVGFCLVTAGTGLDDKR-----LDYVCRAADAVHK
BIOB_NITSB       -----------------------AKAIGFCLVTAGKGIDDKI-----LDFVTQAARAVKK
BIOB_NAUPA       -----------------------NGATGFCLVTSGKGLDDKT-----LEYVCSAAKSVIK
BIOB_CAMC1       -----------------------NHALGFCLVTSGARLNDKK-----TDYIASLARAVHK
BIOB_CAMC5       -----------------------NHALGFCLVTSGARLDDQK-----TEQVACIARAVGK
BIOB_CAMFF       -----------------------NYALGFCLVTSGLGLDDKK-----LEFICEAATMLRK
BIOB_CAMJ8       -----------------------NEALGFCLVTAGLGLDDEK-----LEYVCEAAKAVQK
BIOB_CAMJJ       -----------------------NEALGFCLVTAGLGLDDEK-----LEYVCEAAKAVQK
BIOB_CAMJE       -----------------------NEALGFCLVTAGLGLDDEK-----LEYVCEAAKAVQK
BIOB_CAMJR       -----------------------NEALGFCLVTAGLGLDDEK-----LEYVCEAAKAVQK
BIOB_CAMJD       -----------------------NEALGFCLVTAGLGLDDEK-----LEYVCEAAKAVQK
BIOB_CAMLR       -----------------------NEALGFCLVTAGAGLDDEK-----LEYVCKVAHAVQK
BIOB_SULDN       -----------------------NGALGFCLVTSDKGLNDKT-----LNFVCSIAEVLSK
BIOB_SULNB       -----------------------NGALGYCLVTAGKGLDDKK-----VDFVARAAQAVKA
BIOB_METM6       ------------------------YSNRFSIVVSGKTVTDLE-----FEKIIESIEEIQ-
BIOB_METMP       ------------------------YSNRFSIVVSGKTVTDLE-----FEKIIESIEEIQ-
BIOB_METM5       ------------------------YSNRFSIVVSGKTVTDLE-----FEKIIESIEEIQ-
BIOB_METM7       ------------------------YSNRFSIVVSGKSVTDLE-----FENIIESIEEIQ-
BIOB_METVS       ------------------------YSNRFSIVSSGKKISEKE-----FEDILEIIDEIK-
BIOB_META3       ------------------------YSNRFSIVVSGKTVNDRE-----YNEIIDAIKDIK-
BIOB_METJA       RGTLIGAESPNLMDVGYPNRGFPLWVERFSIVTSGKKINDDE-----FIEIVEAIELIK-
BIOB_CALBD       -----------------------FPIKRFCLVTSGEKLDDSE-----FEKILDIYSHIS-
BIOB_CALS8       -----------------------FPVKRFSLVTSGGELNDSE-----FERIIDIISYIS-
BIOB_AQUAE       -----------------------FGANRYCIVLSGKSATKEE-----VERITEAVKEIKN
BIOB_HYDS0       -----------------------FGANRYCMVLSSRAASDEE-----VEKLCEAVQEIKA
BIOB_PERMH       -----------------------IKANRYCIVTSGKRATKEE-----VEQIADAVREIT-
BIOB_SULSY       -----------------------INANRYCIVVSGRKASKEE-----VDKIADAIKEIK-
BIOB_UNCTG       ------------------------NVGCFGIVSSGNSLNDVE-----IEKLCEMFKNHK-
BIOB_THENN       -----------------------MGAVRFGIVTSGKRPTRDE-----LLKIASIIEFLKV
BIOB_THEP1       -----------------------MGAIRFGIVTSGKRLTRKE-----ILKVAKIIEFLKA
BIOB_THEYD       -----------------------YGVKRFSIVISGKKPSKKE-----LEKIGNSIEAIK-
BIOB_DESDA       -----------------------QPVARIGVVTSGGALSGEE-----FDRLLGVLRSLP-
BIOB_ALKMQ       -----------------------KGVHRYSIVTAGRELKGKD-----LQVACDAYKRMKE
BIOB_CLOB8       -----------------------NGVHRYSIVTAGRALVGSD-----FDKAVQAYKMMNK
BIOB_CLOB1       -----------------------KGVHRFSVVTSGRALNNNE-----VDTLCKTYSKLKE
BIOB_CLOBH       -----------------------KGVHRFSVVTSGRALNNNE-----VDTLCKTYSKLKE
BIOB_CLOBK       -----------------------KGVHRFSVVTSGRALNNNE-----VDTLCKTYLKLKE
BIOB_CLOBL       -----------------------KGVHRFSVVTSGRALNNNE-----VDTLCKTYSKLKE
BIOB_CLOBM       -----------------------KGVHRFSVVTSGRALNNNE-----VDTLCKTYSKLKE
BIOB_CLOBA       -----------------------SGVHRFSVVTSGKKLTNKE-----IDIVCKTYSEVQE
BIOB_CLOBB       -----------------------NGVHRFSVVTSGKKITNKE-----VHTVCKTYSELKD
BIOB_BRAHW       -----------------------KGVLRYSIVTSGRALYGKE-----IDEVYDAIETLNK
BIOB_AKKM8       -----------------------RGILRYSIVTSGKRLTDED-----VDRLCASYRHIAE
BIOB2_CORDI      -----------------------KGVIRFSIVTSGRKLRRDE-----VRHICEGVRRIKQ
BIOB_CAMHC       -----------------------AGVARFSLVASGKGLHKKD----DLQKVIEIYKKLKS
BIOB_FUSNN       -----------------------EGAHRFSLVTSGRGLNGNEK---ELDKLVEIYKYIGE
BIOB_CLOD6       -----------------------KGVHRFSLVTSGKGMSGKE-----FNNILNIYEGLRE
BIOB_HUNT2       -----------------------EGVHRFSLVTSGKSVSDEE-----FEKILGIYSVLRK
BIOB_CLOK1       -----------------------EGVNRFSLVTSGKGIRGKD-----FEKVLDIYKELNK
BIOB_CLOTE       -----------------------HGINRFSLVTSGKALTSND-----FEKALEIYKEINK
BIOB_CLONN       -----------------------EGVHRYSLVTSGRGISGKE-----FEDILNIYKKLKE
BIOB_CLOP1       -----------------------EGVHRFSIVTSGRGLYGEE-----FERVITYYSNLNK
BIOB_CLOPE       -----------------------EGVHRFSIVTSGRGLYGEE-----FERVITYYSNLNK
BIOB_PORG3       -----------------------QGIGRFSLVASGRTASMNE-----IRQMAESFRTIKQ
BIOB_PORGI       -----------------------QGIGRFSLVASGRTASMNE-----IRQMAESYRAIKQ
BIOB_PARD8       -----------------------QGIRRFALVTSGKRVSDKE-----LEQITDTIRQIKR
BIOB_CROS5       -----------------------AGAKRFCLVSQGRGPKYNSPQSGEFEKILETVRQIT-
BIOB_RIPO1       -----------------------AGAKRFCLVSQGRGPKYQGAKSKEFEQILATVRQIA-
BIOB_GLOC7       -----------------------AGAKRFCLVSQGRGLKYNSPKSKEFAEILATVKRIT-
BIOB_MICAN       -----------------------AGAKRFCLVSQGRGLKYNSPKSQEFEEILATVQEII-
BIOB_TRIEI       -----------------------AGAKRFCLVSQGRGVKYNSPKSTEFEQILGTVRQIL-
BIOB_SYNY3       -----------------------AGAKRFCLVSQGRGPKYHSPKDREFEQILATVRQII-
BIOB_CYAP4       -----------------------AGAKRFCLVSQGRGPKYNSPKSTEFEQILATVRAII-
BIOB_SYNP2       -----------------------AGAKRFCLVSQGRGIKYNSPRDTEFEQILETVRRIQ-
BIOB_CARHZ       -----------------------AGAHRFDLVTAGLGMTEE---DEDFKKILAIYKRLR-
BIOB_CLOAB       -----------------------YGARHCDIATSGLGYTGD---EKDFQTILKAFKKMK-
BIOB_DESAP       -----------------------QGIKRFSLVTSGRDPG------GDFEKILGITRQLKR
BIOB_PELTS       -----------------------RGARRFALVTSGRGISE-----SDFEKVLDIYQMLK-
BIOB_HELMI       -----------------------EGAHRFSLVTSGRGMSD-----AELEPVLAIYERLR-
BIOB_DESPS       -----------------------YGVSRFSLVTAGRAVSP-----AFLREVASIYRRLG-
BIOB_DESRM       -----------------------KGIHRFALVTSGKNLSN-----RDFDEVIKIYQVLR-
BIOB_ANAD2       -----------------------AGAREFSIVASGTRLAREQE-----LATVEEALRRLR
BIOB_ANASK       -----------------------AGAREFSIVASGTRLAREQE-----LATVEEALRRLR
BIOB_ANADE       -----------------------AGAREFSIVASGTRLSREQE-----LATVEDALRRLR
BIOB_ANADF       -----------------------AGAREFSIVTSGTRVAKESE-----LATIEEAVRKLR
BIOB_DESVH       -----------------------SGAERYGIVTSGTRLT-VRE-----LATLCEAAVRIR
BIOB_DESVV       -----------------------SGAERYGIVTSGTRLT-VRE-----LDTLCEAAVRIR
BIOB_DESVM       -----------------------AGVRRFGIVTSGNALS-ERE-----FDAVCHAARLLR
BIOB_DESAG       -----------------------AGADRFGIVTSGTRPA-PRE-----LETVCEAVVRIR
BIOB_GEOMG       -----------------------AGSRCYGIITSGTTIKKGEE-----LDRICRAVRRIR
BIOB_GEOSL       -----------------------AGSHCFGIVTSGSAISRGEE-----LDRICRALRRIR
BIOB_GEODF       -----------------------NGSSCYGIITSGTSIKKGEE-----LERICNAVRRIR
BIOB_GEOUR       -----------------------NGSSCYGIITSGTSINKGEE-----LTRICRAVKRIR
BIOB_GEOBB       -----------------------NGSACFGIITSGTTVN-GPE-----LEQILTALRRIR
BIOB_PELPD       -----------------------NGARCYGIVTSGTGIRPGAE-----LETICNSLRRIR
BIOB_GEOLS       -----------------------HGAACYGIVTSGSGISEGDE-----LEQVCAAIRAIR
BIOB_PELCD       -----------------------RGARCFGIVTSGARVLPGAE-----LESILAALREIR
BIOB_SYNAS       -----------------------AGATRFSMVTSGSRLN-AAE-----IETVGQAASAIT
BIOB_DESAL       -----------------------NGVHRYSLVASGGRLP-KAE-----VRMVAEAFSRMG
BIOB_DESOH       -----------------------TPVNRYSVVTSGRGLS-SAE-----VSTVSRALAAID
BIOB_SYNFM       -----------------------LPVSRFGVVTSGRALS-DED-----IEAIAATVRNTS
BIOB_CHLCH       -----------------------NGVSHFGIVTSGYGYQRIT---PEFERLLGMIDRLHS
BIOB_PELPB       -----------------------EGVSHFGIVTSGYGYKRIN---PEFQRVLDMIDRLHE
BIOB_CHLP8       -----------------------QGVGHFGIVTSGYGYRKVT---PEFERILGMIDLLHR
BIOB_CHLTE       -----------------------QGIGHFGIVTSGYGYLKVT---PEFERILGMIDRLHR
BIOB_CHLL2       -----------------------SGIPHFGIVTSGYGYLKIT---PEFNRILGMIDMLHR
BIOB_PELLD       -----------------------QGVSHFGIVTSGYGYLKMS---DEFQRILSMIDRLHS
BIOB_CHLPM       -----------------------HGVSHFGLVTSGYGYRTMN---AEFKRILAMIDRLHE
BIOB_CHLPD       -----------------------EGISHFGIVTSGFGYKTLS---KEFRQILAMIDRLHQ
BIOB_CHLPB       -----------------------EGIRHFGVVTSGYGYRKVN---PEFLKIVAIIDQLRQ
BIOB_PROA2       -----------------------KGVRHFGIVTSGYGYRTVN---KEFQRIIDLITGLRE
BIOB_NATPD       -----------------------DGAQRFGIVVAEKGVSKEKR--PDEWDDVIRAIRLVR
                                               .                             

BIOB_FRAT1       -NLGLETCVTLGSINADEATK---------LKQAGLDYYNHNLDTS-REFYPEIITTRKF
BIOB_FRATT       -NLGLETCVTLGSINADEATK---------LKQAGLDYYNHNLDTS-REFYPEIITTRKF
BIOB_FRATN       -NLGLETCVTLGSINADEATK---------LKQAGLDYYNHNLDTS-REFYPEIITTRKF
BIOB_FRATW       -NLGLETCVTLGSINADEATK---------LKQAGLDYYNHNLDTS-REFYPEIITTRKF
BIOB_FRATM       -NLGLETCVTLGSINADEATK---------LKQAGLDYYNHNLDTS-REFYPEIITTRKF
BIOB_FRATF       -NLGLETCVTLGSINADEATK---------LKQAGLDYYNHNLDTS-REFYPEIITTRKF
BIOB_FRATH       -NLGLETCVTLGSINADEATK---------LKQAGLDYYNHNLDTS-REFYPEIITTRKF
BIOB_FRATO       -NLGLETCVTLGSINADEATK---------LKQAGLDYYNHNLDTS-REFYPEIITTRKF
BIOB_FRAP2       -NLGLETCVTLGSINAEEATK---------LKEAGLDYYNHNLDTS-REFYPEIITTRKF
BIOB_COXB1       -ALGLETCVTLGMLDQEQALQ---------LKEAGLDFYNHNLDTS-PEFYKKIITTRTY
BIOB_COXB2       -ALGLETCVTLGMLDQEQALQ---------LKEAGLDFYNHNLDTS-PEFYKKIITTRTY
BIOB_COXBN       -ALGLETCVTLGMLDQEQALQ---------LKEAGLDFYNHNLDTS-PEFYKKIITTRTY
BIOB_COXBR       -ALGLETCVTLGMLDQEQALQ---------LKEAGLDFYNHNLDTS-PEFYKKIITTRTY
BIOB_COXBU       -ALGLETCVTLGMLDQEQALQ---------LKEAGLDFYNHNLDTS-PEFYKKIITTRTY
BIOB_LAWIP       -KLGLETCVTLGFLKEHQIAM---------LKKAGLDFYNHNMNTS-PEFYEHIATTHTF
BIOB_RICFE       -KLGLETCVTLGLLKEHQAVT---------LKEAGLDFYNHNIDTS-EEFYNKIITTRTF
BIOB_NEOSM       -KLGLETCASLGLLSYEQAVS---------LKAAGLDFYNHNIDTS-QEYYSKIITTRRF
BIOB_ANAMF       -SEGLESCASLGMLKLDQAQK---------LKESGLDFYNHNVDTS-REFYHNVVTTRTY
BIOB_ANAMM       -SEGLESCASLGMLKLDQAQK---------LKESGLDFYNHNVDTS-REFYHNVVTTRTY
BIOB_ANAPZ       -EEGLESCASLGMLKLEQAQK---------LKEAGLDFYNHNVDTS-RAYYHNIVTTRTY
BIOB_EHRCJ       -SENLESCASLGMVTLEQAKK---------LKNAGLDFYNHNIDTS-RDFYPNVTTTRSY
BIOB_EHRCR       -SEKLESCASLGMITLDQAKK---------LKNAGLDFYNHNIDTS-RDFYSNVTTTRNY
BIOB_EHRRG       -SENLESCASLGMVTLEQAKK---------LKTAGLDFYNHNIDTS-RDFYYNVTTTRSY
BIOB_EHRRW       -SENLESCASLGMVTLEQAKK---------LKTAGLDFYNHNIDTS-RDFYYNVTTTRSY
BIOB_AGRRK       -ALGMEACVTLGMLKPHQAER---------LAAAGLTAYNHNLDTS-PEFYGQIITTRTY
BIOB_AGRVS       -DLGMEACVTLGMLEKHQAEK---------LAEAGLTAYNHNLDTS-PEFYGEIITTRSY
BIOB_RUEPO       -ALGMEACVTLGMLRPHQAQR---------LAEAGLTAYNHNLDTS-PEFYGQIIGTRTY
BIOB_BEII9       -ALGMEACVTLGMLNQSQAQR---------LKQAGLTAYNHNLDTS-PEFYPQIVTTHTY
BIOB_METSB       -ELGLEACVTLGMLNAAQAGR---------LKEAGLTAYNHNLDTG-PDYYDKIVTTRSY
BIOB_ZYMMO       -ALDMEACVTLGMVNEDQARR---------LAEAGLTAYNHNLDTG-PAYYPQIVSTHSY
BIOB_METC4       -GLGMEACVTLGMLTQSQAQR---------LAEAGLTSYNHNLDTG-PEFYGDIISTRTY
BIOB_METEP       -GLGMEACVTLGMLTQSQAQR---------LAEAGLTSYNHNLDTG-PEFYGDIISTRTY
BIOB_METPB       -GLGMEACVTLGMLTQSQAQR---------LAEAGLTSYNHNLDTG-PEFYGDIISTRTY
BIOB_METRJ       -GLGMEACVTLGMLTPSQAGR---------LAEAGLTSYNHNLDTG-PDFYEDIISTRTY
BIOB_METNO       -GLGMEACVTLGMLTPSQAER---------LAEAGLTAYNHNLDTG-PDFYGDIISTRTY
BIOB_METS4       -GLGMEACVTLGMLTPSQAER---------LAEAGLTAYNHNLDTG-PDYYDKIVSTRSY
BIOB_PROM2       -DLGMEACVTAGMLTEEQAAR---------LADAGLTAYNHNLDTS-PEHYKNIITTRTY
BIOB_PROM9       -DLGMEACVTAGMLTEEQASR---------LADAGLTAYNHNLDTS-PEHYKNIITTRTY
BIOB_PROMS       -DLGMEACVTAGMLTEEQASR---------LADAGLTAYNHNLDTS-PEHYKNIITTRTY
BIOB_PROM0       -DLGMEACVTAGMLTEEQASR---------LADAGLTAYNHNLDTS-PEHYKNIITTRTY
BIOB_PROM5       -ELGMEACVTAGMLTDEQALR---------LADAGLTAYNHNLDTS-PEYYKNIITTRTY
BIOB_PROMP       -ELGMEACVTAGMLTDEQALK---------LADAGLTAYNHNLDTS-PEYYKNIITTRTY
BIOB_PROM1       -ELGLEACVTAGMITDSQASR---------LAEAGLTAYNHNLDTS-PEHYSKIISTRTY
BIOB_PROMT       -ELGLEACVTAGMITDSQASR---------LAEAGLTAYNHNLDTS-PEHYSKIISTRTY
BIOB_PROM4       -DLGMEACVTAGMLTDNQALR---------LAEAGLTAYNHNLDTS-PENYDQIITTRTY
BIOB_PROMA       -ELGLEACVTGGMLTNQQAAR---------LAEVGLNAYNHNLDTS-PEHYDKIISTRTY
BIOB_PROM3       -ELGLEACVTAGMLTEKQASR---------LADAGLTAYNHNLDTS-PEYYDQIITTRTY
BIOB_PROMM       -ELGLEACVTAGMLTEKQASR---------LADAGLTAYNHNLDTS-PEYYDQIITTRTY
BIOB_SYNPW       -ELGLEACVTAGMLTDSQAER---------LAEAGLTAYNHNLDTS-PEHYDSIITTRTY
BIOB_SYNS3       -ALGMEACVTAGMLTDGQAQR---------LAKAGLTAYNHNLDTS-PEHYDKIITTRTF
BIOB_SYNPX       -DLGMEACVTAGMLSDQQAER---------LAEAGLTAYNHNLDTS-PEHYDRIISTRTY
BIOB_SYNSC       -GMGMEACVTAGMLTDQQAER---------LAEAGLTAYNHNLDTS-PEHYDRIISTRTY
BIOB_SYNS9       -GMGMEACVTAGMLTDDQAGR---------LAEAGLTAYNHNLDTS-PEHYEKIISTRTY
BIOB_SYNR3       -ELGMEACVTAGMLTDSQAER---------LAQAGLTSYNHNLDTS-PEHYDQIISTRTY
BIOB_SYNE7       -QLGLEACVTAGMLSDRQAER---------LAEAGLTAYNHNLDTS-PEFYGEIISTRTY
BIOB_SYNP6       -QLGLEACVTAGMLSDRQAER---------LAEAGLTAYNHNLDTS-PEFYGEIISTRTY
BIOB_SORC5       -ALGLEACCTLGMLTDDQARR---------LKEAGLDAYNHNLDTS-RKAYKSIISTRTY
BIOB_MYXXD       -ALGMEACATLGMLSESQAKR---------LREAGLSAYNHNLDTS-PEHYGDIISTRTY
BIOB_GLOVI       -ALDMEVCCTLGMVKPHQAER---------LKQAGLTAYNHNLDTG-PGYYPQVVTTRTY
BIOB_SYNJA       -KLGMEACVTLGMVSAAQAQQ---------LAAAGLTAYNHNLDTS-PAFYPRIITTRTY
BIOB_NOSS1       -DMGLEVCCTLGMLTSEQAKK---------LETAGLYAYNHNLDTS-SDYYSTIITTRTY
BIOB_TRIV2       -DMGLEVCCTLGMLTTDQAKK---------LETAGLYAYNHNLDTS-SDYYSTIITTRTY
BIOB_NOSP7       -AMGLEVCCTLGMLTANQARK---------LEEAGLYAYNHNLDTS-QEYYSTIITTRTY
BIOB_CHLAB       -DMGAEVCCTLGMLTPSQAEK---------LFEAGLYAYNHNLDSS-EGFYKTIITTRKY
BIOB_CHLFF       -NMGAEVCCALGMLTPSQSEK---------LYDAGLYAYNHNLDSS-EGFYKTIITTRKY
BIOB_CHLPN       -DLGAEVCCALGMLSEEQAKK---------LYDAGLYAYNHNLDSS-PEFYETIITTRSY
BIOB_FLAJ1       -KLDMEVCCTLGMLTENQAQR---------LAEAGLYAYNHNLDTS-EEYYKDVISTRGF
BIOB_FLAPJ       -KLDMEVCCTLGMITENQAHR---------LAEAGLYAYNHNLDTS-EEYYKEVISTRGF
BIOB_GRAFK       -KLDMEVCCTLGMLTENQAQR---------LAEAGLYAYNHNLDSS-EEYYKEVISTRGY
BIOB_CYTH3       -TMGMEVCCTLGMLTPEQADK---------LKDAGLYAYNHNLDTS-AEHYDKVITTRTY
BIOB_HYDCU       -DLGLETCLTLGMLNDDQVKQ---------LKEAGLDYYNHNLDTS-EAFYPKIITTRSY
BIOB_BRUA1       -AMGLETCMTLGMLDSDKAEK---------LADAGLDYYNHNIDTS-ERFYPAVITTRSF
BIOB_BRUA2       -AMGLETCMTLGMLDSDKAEK---------LADAGLDYYNHNIDTS-ERFYPAVITTRSF
BIOB_BRUAB       -AMGLETCMTLGMLDSDKAEK---------LADAGLDYYNHNIDTS-ERFYPAVITTRSF
BIOB_BRUC2       -AMGLETCMTLGMLDSDKAEK---------LADAGLDYYNHNIDTS-ERFYPAVITTRSF
BIOB_BRUMB       -AMGLETCMTLGMLDSDKAEK---------LADAGLDYYNHNIDTS-ERFYPAVITTRSF
BIOB_BRUME       -AMGLETCMTLGMLDSDKAEK---------LADAGLDYYNHNIDTS-ERFYPAVITTRSF
BIOB_BRUSI       -AMGLETCMTLGMLDSDKAEK---------LADAGLDYYNHNIDTS-ERFYPAVITTRSF
BIOB_BRUSU       -AMGLETCMTLGMLDSDKAEK---------LADAGLDYYNHNIDTS-ERFYPAVITTRSF
BIOB_BRUO2       -AMGLETCMTLGMLDSDKAEK---------LADAGLDYYNHNIDTS-ERFYPAVITTRSF
BIOB_OCHA4       -ALGLETCMTLGMLSPDQAQT---------FAEAGLDYYNHNIDTS-ERFYPQVITTRSF
BIOB_AGRFC       -ALDMETCMTLGMLTPEQSER---------LADAGLDYYNHNVDTS-ERFYSEIITTRTF
BIOB2_PARDP      -AMGMETCMTLGMLDADQALR---------LKDAGLDYYNHNIDTS-ERYYSEIITTRTF
BIOB_LEGPA       -SLGLETCMTLGMLTKEQASH---------LKEAGLDYYNHNIDTS-PSYYDKVVTTRKF
BIOB_LEGPH       -SLGLETCMTLGMLTKEQASH---------LKEAGLDYYNHNIDTS-PSYYDKVVTTRKF
BIOB_LEGPL       -SLGLETCMTLGMLTKEQASH---------LKEAGLDYYNHNIDTS-PSYYDKVVTTRKF
BIOB_LEGPC       -SLGLETCMTLGMLTKEQASH---------LKEAGLDYYNHNIDTS-PSYYDKVVTTRKF
BIOB_RUTMC       -TMGMETCVTLGMLTQEQAFI---------LKEAGLDYYNHNIDTS-KEHYSNVVTTRNF
BIOB_VESOH       -DMGMETCVTLGMLTQKQAFV---------LKEVGLDYYNHNIDTS-KENYSNIVTTRNF
BIOB_HAEI8       -SLGLETCGTFGLLQDGMAED---------LKEAGLDYYNHNLDTA-PEHYAEVIGTRRF
BIOB_HAEIE       -SLGLETCGTFGLLQDGMAED---------LKEAGLDYYNHNLDTA-PEHYAEVIGTRRF
BIOB_HAEIN       -SLGLETCGTFGLLQDGMAED---------LKEAGLDYYNHNLDTA-PEHYAEVIGTRRF
BIOB_HAEIG       -SLGLETCGTFGLLQDGMAED---------LKEAGLDYYNHNLDTA-PEHYAEVIGTRRF
BIOB_HAES1       -DLGLETCGTFGLLQDGMAEE---------LKEAGLDYYNHNIDTA-PEHYKEIIGTRDF
BIOB_HISS2       -DLGLETCGTFGLLQDGMAEE---------LKEAGLDYYNHNIDTA-PEHYKEIIGTRDF
BIOB_PASMU       -ELGLETCGTFGLLQDGMAED---------LKEAGLDYYNHNLDTA-PEHYGNVIGTRQF
BIOB_ACTSZ       -DLGLETCGTFGLLEDGMAEN---------LKEAGLDYYNHNIDTS-PEHYKKVIGTRGF
BIOB_MANSM       -ALGLETCGTFGLLDDGMAED---------LKEAGLDYYNHNLDTS-PEHYNKVIGTRGF
BIOB_ACTP7       -ALGLETCGTFGLLEDGMAED---------LKQAGLDYYNHNLDTD-PERYNKIVHTRNH
BIOB_ACTPJ       -ALGLETCGTFGLLEDGMAED---------LKQAGLDYYNHNLDTD-PERYNKIVHTRNH
BIOB_ACTP2       -ALGLETCGTFGLLEDGMAED---------LKQAGLDYYNHNLDTD-PERYNKIVHTRNH
BIOB_HAEDU       -ALGLETCGTFGLLEDGMAED---------LKQAGLDYYNHNLDTD-PERYSKVVHTRSH
BIOB_HAEPS       -SLGLETCGTFGMLEEGMAED---------LKEAGLDYYNHNLDTD-PERYHQVIHTRSH
BIOB_NEIG1       -GLGMETCGTFGMLEEGMAED---------LKEAGLDYYNHNLDTD-PDRYNDIIHTRRH
BIOB_NEIG2       -GLGMETCGTFGMLEEGMAED---------LKEAGLDYYNHNLDTD-PDRYNDIIHTRRH
BIOB_NEIM0       -GLGMETCGTFGMLEEGMAED---------LKEAGLDYYNHNLDTD-PDRYNDIIHTRRH
BIOB_NEIMF       -GLGMETCGTFGMLEEGMAED---------LKEAGLDYYNHNLDTD-PDRYNDIIHTRRH
BIOB_NEIMA       -GLGMETCGTFGMLEEGMAED---------LKEAGLDYYNHNLDTD-PDRYNDIIHTRRH
BIOB_NEIMB       -GLGMETCGTFGMLEEGMAED---------LKEAGLDYYNHNLDTD-PDRYNDIIHTRQH
BIOB_CHRVO       -ALGLETCATFGLLRDGQAEQ---------LKDAGLDYYNHNLDTA-PDKYGDIIQTREY
BIOB_METSK       -AMGLETCATLGMLKDGQAEQ---------LKEAGLDYYNHNLDTA-PEYYGEVITTRTY
BIOB_METFK       -AMGLETCATLGMLKDGQAEQ---------LKEAGLDYYNHNLDTA-PEYYGEVITTRTY
BIOB_THIDA       -ALGLETCATLGMLKDGQAEQ---------LKEAGLDYYNHNLDTA-PEFYGEIITTRDY
BIOB_NITEC       -DLGLETCATLGILKPGQAVQ---------LKQAGLDYYNHNLDTS-PEFYGEVITTREY
BIOB_NITEU       -ALGMETCATLGILKPGQATQ---------LKQAGLDYYNHNLDTA-PEFYGEIITTREY
BIOB_NITMU       -ALGLEACTTLGMLKPGQAEQ---------LQEAGLDYYNHNLDTS-PEFYGEIITTRDY
BIOB_ACISJ       -DLGLQTCATLGMLQSHQAQA---------LKDAGLDYYNHNLDTA-PEYYSDVVSTRQY
BIOB_ACIET       -DLGLQTCATLGMLQSHQALA---------LKDAGLDYYNHNLDTA-PEYYSDVVSTRQY
BIOB_DELAS       -GLGMQTCATLGMLQPHQAQS---------LREAGLDYYNHNLDTA-PEYYQDVVSTRQY
BIOB_ACIAC       -GLGMQTCATLGMLEPHQAQA---------LKGAGLDYYNHNLDTA-PEYYTDVVSTRAY
BIOB_METPP       -SLGLEACCTLGMLSKPQAQA---------LKEAGVDYYNHNLDTA-PEAYGRIISTRVY
BIOB1_POLSJ      -ALGLETCATLGMLEDGHAQT---------LQSAGLDYYNHNLDSA-PDFYGDIITTRDY
BIOB_HERAR       -AMGMETCATLGMLGEGQAEK---------LKNAGLDYYNHNLDTA-PEFYSNVISTRDY
BIOB_JANMA       -AMGLETCATLGMLGEGQAEK---------LKNAGLDYYNHNLDTA-PEFYSNVISTRDY
BIOB_RHOFT       -QLGLETCATLGMLEEGQADR---------LKQAGLDYYNHNLDSA-PEFYSNVISTREY
BIOB_POLAQ       -ALGLETCATLGMLEANQAKA---------LQEAGLDFYNHNLDTS-EDFYRSVISTRGY
BIOB_BORBR       -ALGMETCVTLGMLRDGQAEQ---------LKAAGLDYYNHNLDTA-PEFYGKIISTRTY
BIOB_BORPA       -ALGMETCVTLGMLRDGQAEQ---------LKAAGLDYYNHNLDTA-PEFYGKIISTRTY
BIOB_BORPE       -ALGMETCVTLGMLRDGQAEQ---------LKAAGLDYYNHNLDTA-PEFYGKIISTRTY
BIOB_BORPD       -ALGLETCVTLGMLRDGQAEQ---------LKEAGLDYYNHNLDTS-PEFYGSIISTRTY
BIOB_BORA1       -ALGLETCVTLGMLQDGQAEQ---------LKEAGLDYYNHNLDTS-PEFYGNVVTTRGY
BIOB_BURCM       -ELGLETCMTLGMLEDEQAQE---------LANAGLDYYNHNLDTS-PEFYGQVISTRTY
BIOB_BURL3       -ELGLETCMTLGMLEDEQAQE---------LASAGLDYYNHNLDTS-PEFYGQVISTRTY
BIOB_BURA4       -ELGLETCMTLGMLEDEQAQE---------LANAGLDYYNHNLDTS-PEFYGQVISTRTY
BIOB_BURVG       -ELGLETCMTLGMLEDEQAQQ---------LAHAGLDYYNHNLDTS-PEFYGQVISTRTY
BIOB_BURM1       -ALGLETCMTLGMLEDEQAKQ---------LADAGLDYYNHNLDTS-PEFYGQVISTRTY
BIOB_BURCA       -ELGLETCMTLGMLEDEQAQQ---------LADAGLDYYNHNLDTS-PEFYGQVISTRTY
BIOB_BURCC       -ELGLETCMTLGMLEDEQAQQ---------LADAGLDYYNHNLDTS-PEFYGQVISTRTY
BIOB_BURCH       -ELGLETCMTLGMLEDEQAQQ---------LADAGLDYYNHNLDTS-PEFYGQVISTRTY
BIOB_BURCJ       -ELGLETCMTLGMLEDEQARQ---------LADAGLDYYNHNLDTS-PEFYGQVISTRTY
BIOB_BURM7       -DMGLETCVTLGMLEEHQAKA---------LAEAGLDYYNHNLDTS-PEFYGQIISTRTY
BIOB_BURM9       -DMGLETCVTLGMLEEHQAKA---------LAEAGLDYYNHNLDTS-PEFYGQIISTRTY
BIOB_BURP6       -DMGLETCVTLGMLEEHQAKA---------LAEAGLDYYNHNLDTS-PEFYGQIISTRTY
BIOB_BURMA       -DMGLETCVTLGMLEEHQAKA---------LAEAGLDYYNHNLDTS-PEFYGQIISTRTY
BIOB_BURMS       -DMGLETCVTLGMLEEHQAKA---------LAEAGLDYYNHNLDTS-PEFYGQIISTRTY
BIOB_BURP0       -DMGLETCVTLGMLEEHQAKA---------LAEAGLDYYNHNLDTS-PEFYGQIISTRTY
BIOB_BURPS       -DMGLETCVTLGMLEEHQAKA---------LAEAGLDYYNHNLDTS-PEFYGQIISTRTY
BIOB_BURP1       -DMGLETCVTLGMLEEHQAKA---------LAEAGLDYYNHNLDTS-PEFYGQIISTRTY
BIOB_BURTA       -DMGLETCVTLGMLEEHQAKA---------LAEAGLDYYNHNLDTS-PEFYGQIISTRTY
BIOB_PARPJ       -AMGLETCVTLGMLETHQAQG---------LREAGLDYYNHNLDTS-PEFYGQIISTRTY
BIOB_PARXL       -AMGLETCVTLGMLETHQAQG---------LREAGLDYYNHNLDTS-PEFYGQIISTRTY
BIOB_PARP8       -SMGLETCVTLGMLEAHQAQA---------LREAGLDYYNHNLDTS-PEFYGQIISTRTY
BIOB_CUPTR       -AMGLETCVTLGMLKAEQAQQ---------LKEAGLDYYNHNLDTS-PEFYGKIITTRTY
BIOB_CUPNH       -AMGLETCVTLGMLKAEQAQQ---------LKEAGLDYYNHNLDTS-PEFYGKIITTRTY
BIOB_CUPPJ       -AMGLETCVTLGMLKAEQAQQ---------LKDAGLDYYNHNLDTS-PEFYGKIITTRTY
BIOB_CUPMC       -AMGLETCVTLGMLKAEQAQR---------LKDAGLDYYNHNLDTS-PEFYGKIITTRTY
BIOB_POLNA       -GLGLETCMTLGMLEAEQAQA---------LKDAGLDYYNHNLDSS-PEFYGSIISTRTY
BIOB2_POLSJ      -SLGLETCMTLGMLQAEQAQA---------LKDAGLDYYNHNLDSA-PEFYGDIISTRTY
BIOB_LEPCP       -ALGLETCMTLGMLDGEQARE---------LKDAGLDYYNHNLDSA-PDFYGQVISTRTY
BIOB_RALPJ       -AMGLETCVTLGMLKQEQAAQ---------LKEAGLDYYNHNLDTA-PEFYGEIITTRTY
BIOB_RALSO       -AMGLETCVTLGMLKQEQAQQ---------LKDAGLDYYNHNLDTA-PEFYGEIITTRTY
BIOB_AZOSB       -KLGLETCVTLGMLKEGQAEQ---------LAEAGLDYYNHNIDTA-PEFYGQIVTTHTL
BIOB_AROAE       -ALGLETCVTLGMLKGDQALQ---------LKEAGLDYYNHNLDTA-PEFYGQVITTHTL
BIOB_DECAR       -ALGMQTCVTLGMLKDGQAEK---------LKDAGLDYYNHNLDTD-KEFYGQVIKSHTH
BIOB_GLUDA       -SLGMETCVTLGMLDDRQAHR---------LREAGLDYYNHNLDTS-PEHYGSIISTRTY
BIOB_GLUOX       -SLGLETCVTLGMLDAQQTER---------LKKAGLDYYNHNLDTS-EEFYGSIISTRTY
BIOB_GRABC       -ALGMESCVTLGMLTDQQALR---------LKQAGLDYYNHNLDTS-PEYYGAVISTRTY
BIOB_ACICJ       -ALGMETCVTLGMLRPDQAAR---------LKSAGLDYYNHNLDTS-PEFYGSIITTRTY
BIOB_STRM5       -ALGLETCATLGMLSGGQARA---------LKDAGLDYYNHNLDTA-PDYYDSIIHTRQY
BIOB_STRMK       -ALGLETCATLGMLSGEQARA---------LKDAGLDYYNHNLDTA-PDYYDSIIHTRQY
BIOB_XANAC       -AMGLETCATLGMLDAGQARA---------LKDAGLDYYNHNLDTA-PDYYDSIIHTRQY
BIOB_XANC5       -AMGLETCATLGMLDAGQARA---------LKDAGLDYYNHNLDTA-PDYYDSIIHTRQY
BIOB_XANOM       -AMGLETCATLGMLDAGQARA---------LKDAGLDYYNHNLDTA-PDYYDTIIHTRQY
BIOB_XANOP       -AMGLETCATLGMLDAGQARA---------LKDAGLDYYNHNLDTA-PDYYDTIIHTRQY
BIOB_XANOR       -AMGLETCATLGMLDAGQARA---------LKDAGLDYYNHNLDTA-PDYYDTIIHTRQY
BIOB_XANC8       -AMGLETCATLGMLDAGQARA---------LKDAGLDYYNHNLDTA-PDYYDSIIHTRQY
BIOB_XANCB       -AMGLETCATLGMLDAGQARA---------LKDAGLDYYNHNLDTA-PDYYDSIIHTRQY
BIOB_XANCP       -AMGLETCATLGMLDAGQARA---------LKDAGLDYYNHNLDTA-PDYYDSIIHTRQY
BIOB_XYLF2       -ALGLETCATLGMLNTCQAQA---------LKDAGLDYYNHNVDTS-PDFYDSVIHTRQY
BIOB_XYLFT       -ALGLETCATLGMLNTCQAQA---------LKDAGLDYYNHNVDTS-PDFYDSVIHTRQY
BIOB_XYLFM       -ALGLETCATLGMLNTCQAQA---------LKDAGLDYYNHNVDTS-PDFYDSVIHTRQY
BIOB_XYLFA       -ALGLETCATLGMLNTCQAQA---------LKDAGLDYYNHNVDTS-PDFYDSVIHTRQY
BIOB_AZOC5       -ALGLETCVTLGMLTPAQVDR---------LSAAGLDYYNHNVDTS-PAYYPRITSTRTL
BIOB_XANP2       -AMGLEACVTLGMLTPDQVTR---------LGAAGLDYYNHNIDTS-PAFYPEIVTTRTM
BIOB_RHOS1       -DLGLETCMTLGMLSPGQVAR---------LKAAGLDFYNHNIDTS-PAYYAQIASTRTM
BIOB_RHOS4       -DLGLETCMTLGMLSPGQVAR---------LKAAGLDFYNHNIDTS-PAYYARIASTRTM
BIOB_RHOSK       -ELGLETCMTLGMLSPGQVAR---------LRAAGLDFYNHNIDTS-PAYYARIASTRTM
BIOB1_PARDP      -ELGLETCMTLGMLSPEQVAR---------LKAAGLDFYNHNIDTS-PEYYAQIASTRTM
BIOB_BRASB       -DLGMETCVTLGMLTPPQAQR---------LKQAGLDFYNHNVDTS-PEFYDRIITTRTL
BIOB_BRASO       -DLGMETCVTLGMLTPPQAAR---------LKQAGLDYYNHNVDTS-PEFYDRIITTRTM
BIOB_NITHX       -ELGLETCATLGMLTPDQARR---------LHDAGLDFYNHNVDTS-PEFYGNIITTRTM
BIOB_NITWN       -ALGMETCATLGMLTPEQARR---------LQEAGLDFYNHNVDTS-PEFYDKIITTRTM
BIOB_OLICO       -ELGMETCATLGMLTREQADK---------LRAAGLDFYNHNVDTS-PEFYGKIITTRTL
BIOB_BRADU       -GLGMETCVTLGTLTPKHAAR---------LAEAGLDFYNHNVDTS-PEFYSKIITTRSL
BIOB_RHOPA       -ALGMEACMTLGMLTDDQAKQ---------LADAGLDYYNHNIDTS-EEFYASVVKSRSF
BIOB_RHOPT       -ALGMEACMTLGMLTDDQAKQ---------LADAGLDYYNHNIDTS-EEFYASVVKSRSF
BIOB_RHOPS       -ALGMEACMTLGMLTDDQAKQ---------LADAGLDYYNHNIDTS-EEFYSSVVKTRSF
BIOB_RHOP2       -ALGMEACMTLGMLTDDQAQQ---------LADAGLDYYNHNIDTS-EEFYSSVVKSRSF
BIOB_RHOP5       -ALGMEACVTLGMLSDAQAKQ---------LADAGLDYYNHNVDTS-EEFYSQVVTTRSY
BIOB_RHOPB       -ALGMEACVTLGMLSDDQAKQ---------LADAGLDYYNHNLDTS-EEFYPSVVKTRTY
BIOB_CAUVN       -ALGLETCATLGMLTADQAKA---------LKAAGLDYYNHNLDTG-PDYYKDVVTTRTY
BIOB_CAUVC       -ALGLETCATLGMLTADQAKA---------LKAAGLDYYNHNLDTG-PDYYKDVVTTRTY
BIOB_CAUSK       -ALGLETCATLGMLTAEQAKQ---------LKDAGLDYYNHNLDTG-PEYYGDVVSTRTY
BIOB_PHEZH       -ALGLETCATLGMLTADQAKA---------LKAAGLDYYNHNLDTG-PDYYDKVVTTRTY
BIOB_HYPNA       -AEGLETCVTLGMLEEGQAEA---------LKEAGLDYYNHNLDTS-REYYSTVVTTRTF
BIOB_MARMM       -SMGMETCVTLGMLTDSQANK---------LREAGLDYYNHNLDTA-PEDYGRVISTRTY
BIOB_ERYLH       -DMGLETCMTLGMLTPKQADM---------LKDAGLDYYNHNVDTG-PEYYERVISTRNY
BIOB_NOVAD       -EMGMETCMTLGMLTPSQAAQ---------LADAGLDYYNHNIDTS-PERYEEVITTRTF
BIOB_SPHAL       -AMGMETCMTLGMLSKEQAQV---------LGMAGLDYYNHNIDTS-PEHYGNVITTRSF
BIOB_SPHWW       -QMGMETCMTLGMLTGDQART---------LADAGLDYYNHNIDTA-PERYDQVITTRTF
BIOB_PARL1       -DMGMETCMTLGMLSGQQVHR---------LAQSGLDYYNHNIDTS-EEYYPKVISTRTY
BIOB_ACIF2       -EYGLESCVTLGMLKPGQAER---------LQHAGLDYYNHNLDTS-PEFYGEVIHTRSY
BIOB_ACIF5       -EYGLESCVTLGMLKPGQAER---------LQHAGLDYYNHNLDTS-PEFYGEVIHTRSY
BIOB_NITOC       -ALGLETCVTLGMLGPGQAER---------LKAAGLDYYNHNLDTS-PEFYGEIITTRTY
BIOB_THISH       -QLGLETCMTLGMLTDAQARR---------LKDAGLDYYNHNLDTS-PEFYGQVITTRTY
BIOB_ALKEH       -ALGLETCLTLGMLRDGQAER---------LREAGLDYYNHNLDTS-EDYYDEIITTRSY
BIOB_HALHL       -AEGLEACLSAGLLAEGQAER---------LAEAGLDYFNHNLDTS-PSYYDQVVTTRSY
BIOB_ALCBS       -DLGMETCMTLGMLNEGQAGA---------LAEAGLDYYNHNLDTS-PEYYGQVITTRTY
BIOB_METCA       -ALGMETCVTAGMLSDEQARR---------LKEAGLDYYNHNLDTS-ESYYGEIITTRTY
BIOB_MAGSA       -ALGMETCATFGLLDKWQAQR---------LKEAGLDYYNHNIDTS-PEHYSEVITTRTF
BIOB_ACIB3       -ALGMETCMTLGMLNQSQAER---------LKDAGLDYYNHNLDTS-REYYSHIISTRTF
BIOB_ACIB5       -ALGMETCMTLGMLNQSQAER---------LKDAGLDYYNHNLDTS-REYYSHIISTRTF
BIOB_ACIBY       -ALGMETCMTLGMLNQSQAER---------LKDAGLDYYNHNLDTS-REYYSHIISTRTF
BIOB_ACIBC       -ALGMETCMTLGMLNQSQAER---------LKDAGLDYYNHNLDTS-REYYSHIISTRTF
BIOB_ACIBT       -ALGMETCMTLGMLNQSQAER---------LKDAGLDYYNHNLDTS-REYYSHIISTRTF
BIOB_ACIBS       -ALGMETCMTLGMLNQSQAER---------LKDAGLDYYNHNLDTS-RKYYSHIISTRTF
BIOB_ACICA       -ALGLETCMTLGMLNQSQAER---------LKDAGLDYYNHNLDTS-REYYSHIISTRTF
BIOB_ACIAD       -ALGLETCMTLGMLNQSQAER---------LSDAGLDYYNHNLDTS-REYYNNIISTRTF
BIOB_PSYA2       -ALGLETCMTLGMLDTDQAAQ---------LANAGLDYYNHNLDTS-RSYYEQVVSTRSY
BIOB_PSYCK       -ALGLETCMTLGMLDTDQAAQ---------LADAGLDYYNHNLDTS-RSYYEQVVSTRSY
BIOB_PSYWF       -ALGLETCMTLGMLTAEQSEQ---------LAEAGLDYYNHNLDTS-RRYYDEVVSTRSY
BIOB_CELJU       -SLGMETCMTLGMLSEAQAQD---------LADAGLDYYNHNLDTS-PEYYGEIITTRTY
BIOB_SACD2       -EMGLEACMTLGMIDKDQATE---------LAEAGLDYYNHNLDTS-PEYYGDIITTRTY
BIOB_HAHCH       -SLGMETCMTLGMLTADQASE---------LAGAGLDYYNHNLDTS-ENYYGEIITTRTY
BIOB_MARHV       -SLGLETCMTLGMLKEEEAKE---------LADAGLDYYNHNLDTS-EKYYNHIITTRTY
BIOB_CHRSD       -ALGLETCMTLGMVDVDQARR---------LAEAGLDYYNHNLDTS-PDYYGEIITTRTY
BIOB_PSE14       -AMGMETCMTLGRLDQEQTEA---------LATAGLDYYNHNLDTS-PEFYGSIITTRTY
BIOB_PSEU2       -AMGMETCMTLGRLDQEQTEA---------LATAGLDYYNHNLDTS-PEFYGSIITTRTY
BIOB_PSESM       -AMGLETCMTLGRLDQEQTEA---------LATAGLDYYNHNLDTS-PEFYGSIITTRTY
BIOB_PSEF5       -AMGLETCMTLGRLDQDQTEA---------LAKAGLDYYNHNLDTS-PEFYGNIITTRTY
BIOB_PSEPF       -AMGLETCMTLGRLDQDQTEA---------LAKAGLDYYNHNLDTS-PEFYGSIITTRTY
BIOB_PSEP1       -AMGLETCMTLGKLDQEQTKA---------LAHAGLDYYNHNLDTS-PEFYGSIITTRTY
BIOB_PSEPK       -AMGLETCMTLGKLDQEQTKA---------LAQAGLDYYNHNLDTS-PEFYGSIITTRTY
BIOB_PSEPG       -AMGLETCMTLGKLDQDQTLA---------LAQAGLDYYNHNLDTS-PEFYGSIITTRTY
BIOB_PSEPW       -AMGLETCMTLGKLDQDQTQA---------LAQAGLDYYNHNLDTS-PEFYGSIITTRTY
BIOB_PSEE4       -AMGLETCMTLGKLDQEQTLA---------LAQAGLDYYNHNLDTS-PEFYGSIITTRTY
BIOB_PSEA8       -KLGLETCMTLGRLTQEQTQA---------LADAGLDYYNHNLDTS-PEFYGNIITTRTY
BIOB_PSEAE       -KLGLETCMTLGRLTQEQTQA---------LADAGLDYYNHNLDTS-PEFYGNIITTRTY
BIOB_PSEAB       -KLGLETCMTLGRLTQEQTQA---------LADAGLDYYNHNLDTS-PEFYGNIITTRTY
BIOB_PSEA7       -RLGLETCMTLGRLTQEQTQA---------LADAGLDYYNHNLDTS-PEFYGNIITTRTY
BIOB_PSEMY       -KLGLETCMTLGKLTQEQTQA---------LAEAGLDYYNHNLDTS-PEFYGNIITTRTY
BIOB_PSEU5       -AMGLETCMTLGKLDQEQTRA---------LAAAGLDYYNHNLDTS-PEFYGNIITTRTY
BIOB_IDILO       -ALGLESCMTLGMLSNEQAKM---------LQQAGLDYYNHNLDTS-PEFYGDIITTRTY
BIOB_COLP3       -ALGMETCMTLGMLSGDQADQ---------LNGAGLDYYNHNLDTS-PEHYNQIITTRTF
BIOB_PSYIN       -ALGLESCMTLGMLDNNQAEQ---------LSNAGLDYYNHNLDTS-PEYYDKIITTRTY
BIOB_MARMS       -SLGLESCVTLGSLNDDQAKR---------LSEVGLDYYNHNLDTS-AEFYDSIITTRTY
BIOB_PSEHT       -ELGLETCMTLGMLNNEKAHE---------LRNAGLDYYNHNLDTS-PEYYEQIISTRTF
BIOB_SHEB2       -ALGMETCMTLGMLSEDQAND---------LASAGLDYYNHNLDTS-PEYYGDVITTRTY
BIOB_SHEB5       -ALGMETCMTLGMLSEDQAND---------LASAGLDYYNHNLDTS-PEYYGDVITTRTY
BIOB_SHEB8       -ALGMETCMTLGMLSEDQAND---------LASAGLDYYNHNLDTS-PEYYGDVITTRTY
BIOB_SHEB9       -ALGMETCMTLGMLSEDQAND---------LASAGLDYYNHNLDTS-PEYYGDVITTRTY
BIOB_SHESA       -ALGMETCMTLGMLSAEQANE---------LADAGLDYYNHNLDTS-PEYYGDVITTRTY
BIOB_SHESM       -ALGMETCMTLGMLSAEQANE---------LADAGLDYYNHNLDTS-PEYYGDVITTRTY
BIOB_SHESR       -ALGMETCMTLGMLSAEQANE---------LADAGLDYYNHNLDTS-PEYYGDVITTRTY
BIOB_SHEON       -ALGMETCMTLGMLSAEQANE---------LAEAGLDYYNHNLDTS-PEYYGDVITTRTY
BIOB_SHEPC       -ALGMETCMTLGMLSAEQANE---------LADAGLDYYNHNLDTS-PEYYGDVITTRTY
BIOB_SHESW       -ALGMETCMTLGMLSAEQANE---------LADAGLDYYNHNLDTS-PEYYGDVITTRTY
BIOB_SHEHH       -ALGMETCMTLGMLSAEQANT---------LADAGLDYYNHNLDTS-PEYYGDVITTRTY
BIOB_SHEPA       -ALGMETCMTLGMLSAEQANT---------LADAGLDYYNHNLDTS-PEYYGDVITTRTY
BIOB_SHEPW       -SLGMETCMTLGMLSADQASE---------LADAGLDYYNHNLDTS-PEYYGDVITTRTY
BIOB_SHEDO       -ALGLETCMTLGMLSTEQSQK---------LAGAGLDYYNHNLDTS-PEYYGDVITTRTY
BIOB_SHEFN       -ALGMETCMTLGMLSSEQAGK---------LADAGLDYYNHNLDTS-PEYYGDVITTRTY
BIOB_SHESH       -AMGMETCMTLGMLSGTQAEE---------LAEAGLDYYNHNLDTS-PEYYGEIITTRTY
BIOB_SHEWM       -SMGMETCMTLGMLSPDQAGE---------LAEAGLDYYNHNLDTS-PEYYGDIITTRTY
BIOB_SHELP       -AMGMETCMTLGMLSESQAKD---------LADAGLDYYNHNLDTS-PEYYGDIITTRTY
BIOB_SHEAM       -SMGLETCMTLGMLSAHQANQ---------LAEAGLDYYNHNLDTS-PEFYGDIITTRTY
BIOB_AERHH       -GLGMETCMTLGMLTADQAAR---------LGAAGLDYYNHNLDTS-PEFYGDIITTRTY
BIOB_AERS4       -GLGMETCMTLGMLTADQAAR---------LGAAGLDYYNHNLDTS-PEFYGEIISTRTY
BIOB_ALTMD       -SLGLETCMTLGMLTRDQAVA---------LKQAGLDYYNHNLDTS-PEYYGDIITTRTY
BIOB_PSEA6       -KLGLETCMTLGMLTREQAIA---------LQQAGLDYYNHNLDTS-PEFYGDIITTRTY
BIOB_ALIF1       -EMGLETCMTLGMITADQAGE---------LSEAGLDYYNHNLDTS-PEFYGNIITTRTY
BIOB_ALIFM       -EMGLETCMTLGMITAEQAGE---------LSEAGLDYYNHNLDTS-PEFYGNIITTRTY
BIOB_ALISL       -DIGLETCMTLGMITSDQAGE---------LSGAGLDYYNHNLDTS-PEFYGNIITTRTY
BIOB_VIBC3       -DMGLETCMTLGMLTPDQAQQ---------LAQAGLDYYNHNLDTS-PEFYGNIITTRTY
BIOB_VIBCH       -DMGLETCMTLGMLTPDQAQQ---------LAQAGLDYYNHNLDTS-PEFYGNIITTRTY
BIOB_VIBTL       -GMGLETCMTLGMLTPDQAGE---------LADAGLDYYNHNLDTS-PEFYGSIITTRTY
BIOB_VIBCB       -GMGLETCMTLGMLTPDQAKQ---------LATAGLDYYNHNLDTS-PEFYGNIITTRTY
BIOB_VIBPA       -DMGLETCMTLGMLTPEQAKQ---------LANAGLDYYNHNLDTS-PEFYGNIITTRTY
BIOB_VIBVU       -DMGLETCMTLGMLTPEQAKQ---------LASAGLDYYNHNLDTS-PEYYGNIITTRTY
BIOB_VIBVY       -DMGLETCMTLGMLTPEQAKQ---------LASAGLDYYNHNLDTS-PEYYGNIITTRTY
BIOB_PHOPR       -DIGLETCMTLGMITGGQADE---------LAGAGLDYYNHNLDTS-PEYYGQVITTRTY
BIOB_BUCA5       -EMGMETCMTLGTLNSTQAKK---------LADAGLDFYNHNLDTS-KNFYSNIITTRTY
BIOB_BUCAT       -EMGMETCMTLGTLNSTQAKK---------LADAGLDFYNHNLDTS-KNFYSNIITTRTY
BIOB_BUCAI       -EMGMETCMTLGTLNSTQAKK---------LADAGLDFYNHNLDTS-KNFYNNIITTRTY
BIOB_BUCAP       -KMGMETCMTLGTLNNSQAKK---------LAKAGLDFYNHNLDTS-SNFYSSIITTRTY
BIOB_BUCBP       -KLGLETCMTLGTLHNDQADR---------LAKAGLDFYNHNLDTS-KSYYQKIVTTRTY
BIOB_WIGBR       -KLGLETCMTLGMLNDYQANR---------LHNAGLDYYNHNLDTS-KEFYKKIITTRKY
BIOB_BAUCH       -AIGLETCMTLGILKPQQAQR---------LAKAGLDFYNHNLDTS-PEFYHSIVTTRSY
BIOB_PECAS       -AMGMETCMTLGMLHHDQAER---------LASAGLDFYNHNLDTS-PEFYGSIITTRTY
BIOB_ERWT9       -EMGMETCMTLGSLSEQQAQR---------LAHAGLDFYNHNLDTS-PEFYGSIITTRSY
BIOB_SERMA       -AMGMETCMTLGTLDGTQAER---------LAEAGLDYYNHNLDTS-PEFYGSIITTRSY
BIOB_SERP5       -AMGMETCMTLGTLDGTQAER---------LADAGLDYYNHNLDTS-PEFYGNIITTRSY
BIOB_YERPA       -ALGMETCMTLGSLSKQQAHR---------LADAGLDYYNHNLDTS-PEFYGSIITTRSY
BIOB_YERPB       -ALGMETCMTLGSLSKQQAHR---------LADAGLDYYNHNLDTS-PEFYGSIITTRSY
BIOB_YERPE       -ALGMETCMTLGSLSKQQAHR---------LADAGLDYYNHNLDTS-PEFYGSIITTRSY
BIOB_YERPG       -ALGMETCMTLGSLSKQQAHR---------LADAGLDYYNHNLDTS-PEFYGSIITTRSY
BIOB_YERPN       -ALGMETCMTLGSLSKQQAHR---------LADAGLDYYNHNLDTS-PEFYGSIITTRSY
BIOB_YERPP       -ALGMETCMTLGSLSKQQAHR---------LADAGLDYYNHNLDTS-PEFYGSIITTRSY
BIOB_YERPS       -ALGMETCMTLGSLSKQQAHR---------LADAGLDYYNHNLDTS-PEFYGSIITTRSY
BIOB_YERPY       -ALGMETCMTLGSLSKQQAHR---------LADAGLDYYNHNLDTS-PEFYGSIITTRSY
BIOB_YERP3       -ALGMETCMTLGSLSKQQAHR---------LADAGLDYYNHNLDTS-PEFYGSIITTRSY
BIOB_YERE8       -AMGMETCMTLGTLDKQQAHR---------LADAGLDYYNHNLDTS-PEFYGSIITTRSY
BIOB_PSEVU       -AMGLEACMTLGTLDETQAQR---------LASAGLDYYNHNLDTS-PEFYGNIITTRTY
BIOB_ENT38       -EMGLEACMTLGTLNDSQAQR---------LSAAGLDYYNHNLDTS-PEFYGNIITTRTY
BIOB_KLEP3       -ALGLESCMTLGTLTDSQAQR---------LAGAGLDYYNHNLDTS-PEFYGNIITTRTY
BIOB_KLEP7       -ALGLESCMTLGTLTDSQAQR---------LAEAGLDYYNHNLDTS-PEFYGNIITTRTY
BIOB_SALPB       -AMGLETCMTLGMLNESQAQR---------LANAGLDYYNHNLDTS-PEFYGNIITTRTY
BIOB_SALPC       -AMGLETCMTLGMLNESQAQR---------LANAGLDYYNHNLDTS-PEFYGNIITTRTY
BIOB_SALNS       -AMGLETCMTLGMLNESQAQR---------LANAGLDYYNHNLDTS-PEFYGNIITTRTY
BIOB_SALTY       -AMGLETCMTLGMLNESQAQR---------LANAGLDYYNHNLDTS-PEFYGNIITTRTY
BIOB_SALCH       -AMGLETCMTLGMLNESQAQR---------LANAGLDYYNHNLDTS-PEFYGNIITTRTY
BIOB_SALA4       -AMGLETCMTLGMLNESQAQR---------LANAGLDYYNHNLDTS-PEFYGNIITTRTY
BIOB_SALTI       -AMGLETCMTLGMLNESQAQR---------LANAGLDYYNHNLDTS-PEFYGNIITTRTY
BIOB_SALHS       -AMGLETCMTLGMLNESQAQR---------LANAGLDYYNHNLDTS-PEFYGNIITTRTY
BIOB_SALPA       -AMGLETCMTLGMLNESQAQR---------LANAGLDYYNHNLDTS-PEFYGNIITTRTY
BIOB_SALDC       -AMGLETCMTLGMLNESQAQR---------LANAGLDYYNHNLDTS-PEFYGNIITTRTY
BIOB_SALEP       -AMGLETCMTLGMLNESQAQR---------LANAGLDYYNHNLDTS-PEFYGNIITTRTY
BIOB_SALSV       -AMGLETCMTLGMLNESQAQR---------LANAGLDYYNHNLDTS-PEFYGNIITTRTY
BIOB_SALPK       -AMGLETCMTLGMLNESQAQR---------LANAGLDYYNHNLDTS-PEFYGNIITTRTY
BIOB_SALG2       -AMGLETCMTLGMLNESQAQR---------LANAGLDYYNHNLDTS-PEFYGNIITTRTY
BIOB_SALAR       -AMGLETCMTLGMLNESQAQR---------LANAGLDYYNHNLDTS-PEFYGNIITTRTY
BIOB_CITK8       -AMGLEACMTLGTLNESQAQR---------LANAGLDYYNHNLDTS-PEFYGNIITTRSY
BIOB_SHIB3       -DLGLEACMTLGTLSESQAQR---------LANAGLDYYNHNLDTS-PEFYGNIITTRTY
BIOB_SHIBS       -DLGLEACMTLGTLSESQAQR---------LANAGLDYYNHNLDTS-PEFYGNIITTRTY
BIOB_ECO81       -AMGLEACMTLGTLSESQAQR---------LANAGLDYYNHNLDTS-PEFYGNIITTRTY
BIOB_ECOL6       -AMGLEACMTLGTLSESQAQR---------LANAGLDYYNHNLDTS-PEFYGNIITTRTY
BIOB_ECOK1       -AMGLEACMTLGTLSESQAQR---------LANAGLDYYNHNLDTS-PEFYGNIITTRTY
BIOB_ECOUT       -AMGLEACMTLGTLSESQAQR---------LANAGLDYYNHNLDTS-PEFYGNIITTRTY
BIOB_ECO45       -AMGLEACMTLGTLSESQAQR---------LANAGLDYYNHNLDTS-PEFYGNIITTRTY
BIOB_ECOL5       -AMGLEACMTLGTLSESQAQR---------LANAGLDYYNHNLDTS-PEFYGNIITTRTY
BIOB_SHIF8       -AMGLEACMTLGTLSESQAQR---------LANAGLDYYNHNLDTS-PEFYGNIITTRTY
BIOB_SHIFL       -AMGLEACMTLGTLSESQAQR---------LANAGLDYYNHNLDTS-PEFYGNIITTRTY
BIOB_ECO57       -AMGLEACMTLGTLSESQAQR---------LANAGLDYYNHNLDTS-PEFYGNIITTRTY
BIOB_ECO5E       -AMGLEACMTLGTLSESQAQR---------LANAGLDYYNHNLDTS-PEFYGNIITTRTY
BIOB_SHISS       -AMGLEACMTLGTLSESQAQR---------LANAGLDYYNHNLDTS-PEFYGNIITTRTY
BIOB_ECOLI       -AMGLEACMTLGTLSESQAQR---------LANAGLDYYNHNLDTS-PEFYGNIITTRTY
BIOB_ECOSM       -AMGLEACMTLGTLSESQAQR---------LANAGLDYYNHNLDTS-PEFYGNIITTRTY
BIOB_ECOLU       -AMGLEACMTLGTLSESQAQR---------LANAGLDYYNHNLDTS-PEFYGNIITTRTY
BIOB_ECOLC       -AMGLEACMTLGTLSESQAQR---------LANAGLDYYNHNLDTS-PEFYGNIITTRTY
BIOB_ECOHS       -AMGLEACMTLGTLSESQAQR---------LANAGLDYYNHNLDTS-PEFYGNIITTRTY
BIOB_ECODH       -AMGLEACMTLGTLSESQAQR---------LANAGLDYYNHNLDTS-PEFYGNIITTRTY
BIOB_ECO8A       -AMGLEACMTLGTLSESQAQR---------LANAGLDYYNHNLDTS-PEFYGNIITTRTY
BIOB_ECO7I       -AMGLEACMTLGTLSESQAQR---------LANAGLDYYNHNLDTS-PEFYGNIITTRTY
BIOB_ECO55       -AMGLEACMTLGTLSESQAQR---------LANAGLDYYNHNLDTS-PEFYGNIITTRTY
BIOB_ECO27       -AMGLEACMTLGTLSESQAQR---------LANAGLDYYNHNLDTS-PEFYGNIITTRTY
BIOB_ECO24       -AMGLEACMTLGTLSESQAQR---------LANAGLDYYNHNLDTS-PEFYGNIITTRTY
BIOB_SHIDS       -AMGLEACMTLGTLSESQAQR---------LANAGLDYYNHNLDTS-PEFYGNIITTRTY
BIOB_ECOSE       -AMGLEACMTLGTLSESQAQR---------LANAGLDYYNHNLDTS-PEFYGNIITTRTY
BIOB_ESCF3       -AMGLEACMTLGTLSESQAQR---------LADAGLDYYNHNLDTS-PEFYGNIITTRTY
BIOB_CROS8       -ALGLETCMTLGTLSDDQAQR---------LGEAGLDYYNHNLDTS-PEFYGNIITTRTY
BIOB_PHOLL       -ALGMETCMTLGMLNGLQAQR---------LADAGLDYYNHNLDTS-PEFYGNIITTRTY
BIOB_PROMH       -ALGMETCMTLGKLDDSQASR---------LAQAGLDFYNHNLDTS-PEFYGSIITTRTY
BIOB_SODGM       -AMGLETCMTLGMLNDRQVQR---------LAEAGLDFYNHNLDTS-PEFYGSIVTTRSY
BIOB_METI4       -SLGMELCLSAGFLTEKTALM---------LKESGLKVYNHNLNTG-PSYYPRIASTHRF
BIOB_BACSU       ETYGLKICACLGLLKPEQAKR---------LKDAGVDRYNHNLNTS-QRNHSNITTSHTY
BIOB_BACNA       ETYGLKVCACLGLLKPEQAKR---------LKDAGVDRYNHNLNTS-QRNHSNITTSHTY
BIOB_BACVZ       ETYGLKICACLGLLKPEQAER---------LKQAGVDRYNHNINTS-QRNHSNITTSHTY
BIOB_BACAM       ETYGLKICACLGLLKPEQAER---------LKQAGVDRYNHNINTS-QRNHSNITTSHTY
BIOB_BACLD       ETYGLKICACLGLLKPGQAER---------LKEAGVDRYNHNINTS-KTNHSNITTSHTY
BIOB_BACHD       DTYGLKICACLGILKPEQAEQ---------LKAAGVDRYNHNVNTS-ARHHDQITTSHTY
BIOB_GEOKA       ERFGLKVCACLGILKPEQAAR---------LKEAGVDRYNHNINTS-KQHHPNITTSHTY
BIOB_GEOTN       ERFGLKVCACLGLLKPEQAAR---------LKEAGVDRYNHNINTS-KQHHPNITTSHTY
BIOB_ANOFW       ETYGLKVCACLGILKPEQALR---------LKEAGVDRYNHNINTS-KEHHPHITTSHTY
BIOB_LYSSH       AKYGLKVCACLGLLKEEQAQQ---------LKEAGVDRYNHNLNTS-ERHHSYITTTHTY
BIOB_LYSSC       EKYGLKVCACLGLLKEEQAQQ---------LKEAGVDRYNHNLNTS-ERHHSFITTSHTY
BIOB_BACAN       ETTDLKICCCLGFLNEDQAGR---------LAEAGVHRYNHNLNTH-ANNYESICSTHTY
BIOB_BACC0       ETTDLKICCCLGFLNEDQAGR---------LAEAGVHRYNHNLNTH-ANNYESICSTHTY
BIOB_BACCZ       ETTDLKICCCLGFLNEDQAGR---------LAEAGVHRYNHNLNTH-ANNYESICSTHTY
BIOB_BACHK       ETTDLKICCCLGFLNEDQAGR---------LAEAGVHRYNHNLNTH-ANNYESICSTHTY
BIOB_BACAH       ETTDLKICCCLGFLNEDQAGR---------LAEAGVHRYNHNLNTH-ANNYENICSTHTY
BIOB_BACC7       ETTDLKICCCLGFLNEDQAGR---------LAEAGVHRYNHNLNTH-ANNYESICSTHTY
BIOB_BACCQ       ETTDLKICCCLGFLNEDQAGR---------LAEAGVHRYNHNLNTH-ANNYESICSTHTY
BIOB_BACC1       ETTDLKICCCLGFLNEDQAGR---------LAEAGVHRYNHNLNTH-VNNYESICSTHTY
BIOB_BACC2       ETTDLKICCCLGFLNEDQAGR---------LAEAGVHRYNHNLNTH-ANNYDSICSTHTY
BIOB_BACC4       ETTDLKICCCLGFLNEDQAGL---------LAEAGVHRYNHNLNTH-ANNYDSICSTHTY
BIOB_BACCR       ETTDLKICCCLGFLNEDQAGR---------LAEAGVHRYNHNLDTH-ANNYDSICSTHTY
BIOB_BACMK       ETTDLKICCCLGFLNEDQAGQ---------LAEAGVHRYNHNLNTH-ANNYDSICSTHTY
BIOB_BACCN       ETTDLKICCCLGFLNEDQAKR---------LAEAGVHRYNHNLNTH-ANHYDNICSTHTY
BIOB_BACP2       ETMPLKVCACLGLLNEDKAKR---------LKEAGVHRYNHNINTH-QDHHPHITTTHTY
BIOB_STAAM       QHPQLKICACLGLTNDEQAKK---------LKSAGVDRYNHNINTS-ENYHDNVVTTHSY
BIOB_STAAN       QHPQLKICACLGLTNDEQAKK---------LKSAGVDRYNHNINTS-ENYHDNVVTTHSY
BIOB_STAAS       QHPQLKICACLGLTNDEQAKK---------LKSAGVDRYNHNINTS-ENYHDNVVTTHSY
BIOB_STAA9       QHPQLKICACLGLTNDEQAKK---------LKSAGVDRYNHNINTS-ENYHDNVVTTHSY
BIOB_STAAB       QHPQLKICACLGLTNDEQAKK---------LKSAGVDRYNHNINTS-ENYHDNVVTTHSY
BIOB_STAAW       QHPQLKICACLGLTNDEQAKK---------LKSAGVDRYNHNINTS-ENYHDNVVTTHSY
BIOB_STAA1       QHPQLKICACLGLTNDEQAKK---------LKSAGVDRYNHNINTS-ENYHDNVVTTHSY
BIOB_STAA2       QHPQLKICACLGLTNDEQAKK---------LKSAGVDRYNHNINTS-ENYHDNVVTTHSY
BIOB_STAAR       QHPQLKICACLGLTNDEQAKK---------LKSAGVDRYNHNINTS-ENYHDNVVTTHSY
BIOB_STAAC       QHPQLKICACLGLTNDEQAKK---------LKSAGVDRYNHNINTS-ENYHDNVVTTHSY
BIOB_STAAT       QHPQLKICACLGLTNDEQAKK---------LKSAGVDRYNHNINTS-ENYHDNVVTTHSY
BIOB_STAA8       QHPQLKICACLGLTNDEQAKK---------LKSAGVDRYNHNINTS-ENYHDNVVTTHSY
BIOB_STAAE       QHPQLKICACLGLTNDEQAKK---------LKSAGVDRYNHNINTS-ENYHDNVVTTHSY
BIOB_STAA3       QHPQLKICACLGLTNDEQAKK---------LKSAGVDRYNHNINTS-ENYHDNVVTTHSY
BIOB_STAEQ       IHPQLKICACLGLTKEEQAKK---------LKAAGVDRYNHNLNTS-ERYHDEVVTTHTY
BIOB_STAES       IHPQLKICACLGLTKEEQAKK---------LKAAGVDRYNHNLNTS-ERYHDEVVTTHTY
BIOB_STAHJ       LHPQLKICACLGLTNEEQAEK---------LKEAGVDRYNHNLNTS-ERYHNEVVTTHTY
BIOB_STACT       NHPQLKVCACLGLANEDQASR---------LKEAGVDRYNHNLNTS-ENYHDTVVTTHTY
BIOB_MACCJ       EHPQLKICACLGLTNDEQAKK---------LKLAGVDRYNHNINTS-ENYHDEVVTTHTY
BIOB_RHOBA       QKYNLDICACLGLLDESQAAR---------LKACGVDRVNHNLNSS-ESHYEKICTTHTY
BIOB_THEEB       ERYPLKICACLGLLTPEQTAR---------LAAAGVDRVNHNLNTS-ENFYSEICTTHTF
BIOB_SALRD       ETYPMDVCASLGLLDAKQARK---------LADAGVDRYNHNLETS-CDHFGNVVTTHEW
BIOB_STRAW       QNEGVEVCACLGLLSDGQADR---------LREAGADAYNHNLNTS-EGTYGDITTTHTY
BIOB_STRCO       QNESVEVCACLGLLSDGQAER---------LREAGADAYNHNLNTS-ESTYGDITTTHTY
BIOB_STRGG       ENEGIEVCACLGLLSDGQADR---------LRSAGADAYNHNLNTS-EETYGAITTTHTY
BIOB2_FRACC      AHPDVEVCACLGLLSDGQAAQ---------LRAAGADAYNHNLNTA-GEKYADICTTHTY
BIOB_NOCSJ       EQPGVEICACLGLLKDGQAER---------LRAAGVDAYNHNINTA-ESHHDTIVSTHSY
BIOB_SACEN       EYPGVEVCACLGLLKDGQAQR---------LKDAGVDAYNHNINTA-ESNHDNIVQTHTY
BIOB_KOCRD       QHPDVEVCACLGLLKDGQAES---------LSSAGVNAYNHNLNTA-ESHYESICSTHTY
BIOB_RENSM       RNPQAEVCACLGILKEGQAER---------LKSCGVDAYNHNLNTS-EEKYSEICTTHEF
BIOB_CUTAK       DHPDVEVCVCLGFVDDEKAAS---------IKEAGADAYNHNANTA-RSHYGKICSTHSY
BIOB_ACAM1       NEVGIQTCLSAGLMDHEQAAV---------LKEAGLDRLNHNLNTS-ESHTPDIVTTHTF
BIOB_MAGMM       SRWPVEVCLSAGFLDANKARE---------LKEAGLDRYNHNLNTA-DGYYGSICTTHSY
BIOB_LEPBA       GELGMKVCLSAGILDGKKAKT---------LKDAGLDRYNHNLNTS-ESKYNEICSTHTF
BIOB_LEPBP       GELGMKVCLSAGILDGKKAKT---------LKDAGLDRYNHNLNTS-ESKYNEICSTHTF
BIOB_LEPBJ       NELGMKVCLSAGLLDEEKAQV---------LKSAGLDRYNHNLNTS-ENHYPEICDTHTY
BIOB_LEPBL       NELGMKVCLSAGLLDEEKAQV---------LKSAGLDRYNHNLNTS-ENHYPEICDTHTY
BIOB_LEPIC       DELNMKVCLSAGLLDIEKAQV---------LKEAGLDRYNHNLNTS-ENHYSEICDTHTY
BIOB_LEPIN       DELNMKVCLSAGLLDIEKAQV---------LKEAGLDRYNHNLNTS-ENHYSEICDTHTY
BIOB_THET2       ARFPLELCASLGLLEEGMAEA---------LKAAGFDYYNHNLNTA-PSLYPRIATTHTY
BIOB_THET8       ARFPLELCASLGLLEEGMAEA---------LKAAGFDYYNHNLNTA-PSLYPRIATTHTY
BIOB_STRA1       KSLPLEICLTAGFLDREQLHQ---------LKQAGIDRINHNLNTP-EENYPNIATTHSF
BIOB_STRA5       KSLPLEICLTAGFLDREQLHQ---------LKQAGIDRINHNLNTP-EENYPNIATTHSF
BIOB_STRA3       KSLPLEICLTAGFLDREQLHQ---------LKQAGIDRINHNLNTP-EENYPNIATTHSF
BIOB_CORGL       SEVEIEVAASIGTLNKEQVDR---------LAAAGVHRYNHNLETA-RSYFPEVVTTHTW
BIOB_CORGB       SEVEIEVAASIGTLNKEQVDR---------LAAAGVHRYNHNLETA-RSYFPEVVTTHTW
BIOB_COREF       REVDIEVAASVGSLTPEQVTR---------LARAGVHRYNHNLETA-RSFFPQVVTTHTW
BIOB1_CORDI      SEVDIEVAASIGILTQEQVDR---------LKAAGVHRYNHNLETA-RSYFPNVVTTHSW
BIOB_CORU7       AEVDINVAASVGILTQEQVDR---------LTAIGVHRYNHNLETS-RSNFPNVVTTHSW
BIOB_CORJK       AEVDINIAASIGILTQEQVDR---------LKELGVHRYNHNLETC-KSYFPEVVTTHTW
BIOB_MYCBO       NEVEINIACSLGMLTAEQVDQ---------LAARGVHRYNHNLETA-RSFFANVVTTHTW
BIOB_MYCTU       NEVEINIACSLGMLTAEQVDQ---------LAARGVHRYNHNLETA-RSFFANVVTTHTW
BIOB_MYCTA       NEVEINIACSLGMLTAEQVDQ---------LAARGVHRYNHNLETA-RSFFANVVTTHTW
BIOB_MYCTF       NEVEINIACSLGMLTAEQVDQ---------LAARGVHRYNHNLETA-RSFFANVVTTHTW
BIOB_MYCBP       NEVEINIACSLGMLTAEQVDQ---------LAARGVHRYNHNLETA-RSFFANVVTTHTW
BIOB_MYCMM       NEVEINVACSLGMLTAEQVEQ---------LAAMGVHRYNHNLETA-RSYFTNVVTTHTW
BIOB_MYCUA       NEVEINVACSLGMLTAEQVEQ---------LAAMGVHRYNHNLETA-RSYFTNVVTTHTW
BIOB_MYCA1       NEVEINIACSLGMLTAEQVEQ---------LAEMGVHRYNHNLETA-RSFFPNVVTTHTW
BIOB_MYCPA       NEVEINIACSLGMLTAEQVEQ---------LAEMGVHRYNHNLETA-RSFFPNVVTTHTW
BIOB_MYCLE       NEVEINIACSLGMLTVEQVEQ---------LSGIGVHRYNHNLETA-RSFFTNVVTTHTW
BIOB_MYCLB       NEVEINIACSLGMLTVEQVEQ---------LSGIGVHRYNHNLETA-RSFFTNVVTTHTW
BIOB_MYCGI       NEVDIQIACSLGMLTQDQVER---------LSAMGVHRYNHNLETA-RSFFTNVVTTHSW
BIOB_MYCVP       NEVDIQIACSLGMLTQDQVER---------LSEMGVHRYNHNLETA-RSFFTNVVTTHSW
BIOB_MYCSJ       NEVDIQIACSLGMLTAEQVER---------LSEMGVHRYNHNLETA-RSFFTNVVTTHTW
BIOB_MYCSK       NEVDIQIACSLGMLTAEQVER---------LSEMGVHRYNHNLETA-RSFFTNVVTTHTW
BIOB_MYCSS       NEVDIQIACSLGMLTAEQVER---------LSEMGVHRYNHNLETA-RSFFTNVVTTHTW
BIOB_MYCS2       NEVDIQIACSLGMLTEEQVQR---------LADMGVHRYNHNLETA-RSFFPNVVTTHTW
BIOB_MYCA9       NEVDIQIACSLGMLTQEQVDR---------LSAMGVHRYNHNLETA-KSHFPNVVTTHSW
BIOB_NOCFA       NEVDIQVACSLGMLTQEQVDQ---------LAAMGVHRYNHNLETA-KSHFPNVVTTHTW
BIOB_RHOJR       NEVDIQIACSLGMLTQEQVDQ---------LAAMGVHRYNHNLETS-KSHFPNVVTTHTW
BIOB_FRAAA       AAVDINVACSLGMLTQDQVDE---------LTAIGVHRYNHNLETS-RSHFPKVVTTHSW
BIOB1_FRACC      AAVDINVACSLGMLTSEQVDE---------LTAMGVHRYNHNLETA-RSHFPNVVTTHSW
BIOB_FRASN       EAVDINVACSLGMLTQEQVDE---------LAGLGVHRYNHNLETA-RSHFPKVVTTHSW
BIOB_SALAI       AEVDIHVAASVGMLTQEQVDE---------LVEMGVHRYNHNLETC-RSYFPNVVTTHSW
BIOB_SALTO       AEVDIQVAASVGMLTQEQVDE---------LVEMGVHRYNHNLETC-RSYFPNVVTTHSW
BIOB_PSECP       EEVDINIACSLGMLTQQQVDQ---------LAGWGVHRYNHNLETA-RSFFPQVVTTHTY
BIOB_ARTS2       EAVDINIACSLGMLTQRQVDQ---------LAEWGVHRYNHNLETA-RSYFPEVVTTHSY
BIOB_PAEAT       EEVDINIACSLGMLTQRQVDQ---------LAEWGVHRYNHNLETA-RSYFPEVVTTHSY
BIOB_ACIC1       EAVDINISCSLGILTPDQAAE---------LAEIGVHRYNHNLETA-RSYFPSVVTTHTW
BIOB_CENSY       THVGISVECSLGFLTRERAAR---------LKGLGVKRYNHNLETA-RSKFPEICSTHTY
BIOB_NITMS       DKVGISVECSLGFLTQEQAKK---------LKDLKVKRYNHNLETA-KSKFPEICTTHTY
BIOB_HELPY       EELGLHLIACCGRADLEQLEF---------LRDAGIHSYNHNLETS-QNFFPKICSTHTW
BIOB_HELPH       EELGLHLIACCGRADLEQLEF---------LRDAGIHSYNHNLETS-QNFFPKICSTHTW
BIOB_HELPS       EELGLHLIACCGRADLEQLEF---------LRDAGIHSYNHNLETS-QNFFPKICSTHTW
BIOB_HELPG       EELGLHLIACCGRADLEQLEF---------LRDAGIHSYNHNLETS-QNFFPKICSTHTW
BIOB_HELPJ       EELGLHLIACCGRADLEQLEF---------LRDAGIHSYNHNLETS-QNFFPKICTTHTW
BIOB_HELP2       EELGLHLIACCGRADLEQLEF---------LRDAGIHSYNHNLETS-QNFFPKICSTHTW
BIOB_HELAH       EELGLHLIACCGRADLDQLEF---------LRDAGIHSYNHNLETS-QNFFPKICSTHTW
BIOB_HELHP       ADLGLHIIACCGSADVDSLKY---------LKTNGVDSYNHNLETS-KEFFPHICTTHTW
BIOB_WOLSU       AGLELHLIACCGSATKEALAE---------LKKNGVDSYNHNLETA-KSFFPKICTTHSW
BIOB_ARCB4       AVPDISLIACNGIASYEQLKE---------LKKHGIENYNHNLETA-REFYNEICTTHSW
BIOB_NITSB       EVPDISLIGCNGTAEVWQLKE---------LKHAGIDNYNHNLETA-KSFYEQICSTHSW
BIOB_NAUPA       EV-DISIIACNGTAGKDSLKE---------LKKAGVKIYNHNLETS-REYYPKICSTHTW
BIOB_CAMC1       EVPNLMLIACNGMATYEQLCE---------LKNAGIFSYNHNLETS-REYFPKICTTHSW
BIOB_CAMC5       EVPQLMLIACNGMASYDQLKE---------LKNAGVFSYNHNLETS-RDFFPKICTTHSW
BIOB_CAMFF       ETPNLMLIACNGSASYESLKE---------LKKVGIFSYNHNLETS-REFFPQICTTHSW
BIOB_CAMJ8       EVPNLLLIACNGMASVEQLKE---------LKKAGIFSYNHNLETS-KEFFPQICTTHTW
BIOB_CAMJJ       EVPNLLLIACNGMASVEQLKE---------LKKAGIFSYNHNLETS-KEFFPQICTTHTW
BIOB_CAMJE       EVPNLLLIACNGMASVEQLKE---------LKKAGIFSYNHNLESS-KEFFPQICTTHTW
BIOB_CAMJR       EAPNLLLIACNGMASVEQLKE---------LKKAGIFSYNHNLESS-KEFFPQICTTHTW
BIOB_CAMJD       EVPNLLLIACNGMASVEQLKE---------LKKAGIFSYNHNLETS-KEFFPQICTTHTW
BIOB_CAMLR       EVEGLLLIACNGIANLEQLKE---------LKKAGIFSYNHNLETS-KEFFPNICSTHTW
BIOB_SULDN       ELPELRLIACNGTATIEQLLT---------LRASGIKAYNHNLETS-REFYPKICTTHSW
BIOB_SULNB       EVEGLNLIACNGTASLEQLIY---------LKEHGIDSYNHNLETS-ERYYPEICLTHGW
BIOB_METM6       NKTKLKVCVSLGLLNKDKLKA---------LKEKN-VRIHNNLETS-ENYFKNICTSHDY
BIOB_METMP       NKTKLRVCVSLGLLNKDKLKA---------LKERN-VRIHNNLETS-ENYFKNICTSHDY
BIOB_METM5       NKTKLKVCVSLGLLNKDQLKA---------LNEKN-VRIHNNLETS-ENYFKNICTTHDY
BIOB_METM7       NKTKLKVCVSLGLLNKDKLKA---------LKEKN-VRIHNNLETS-ENYFKNICTSHDY
BIOB_METVS       NKTKLKVCVSLGLLNKSQLKA---------LMKKN-IRIHNNLETS-KNYFKNICTTHEY
BIOB_META3       KETNLKVCASLGLLDNSQLKE---------LKDLD-VRIHNNLETS-KEYFDKICTTHTY
BIOB_METJA       EETNLKVCCSLGLLDREKLKE---------LKKLD-VRIHNNLEAS-KNYFKNICSTHSY
BIOB_CALBD       KNYNILLCASLGFLTQERAKK---------LLKVGVVKYHNNLETS-STYFKNICSTHTQ
BIOB_CALS8       KNYDIHLCASLGFLTKERAKK---------LMLAGVTRYHNNLETS-STYFKNICSTHTQ
BIOB_AQUAE       EGLPINVCVSAGTLDEESLKK---------LKEAGVKRINHNLETS-RNFFKNIVTTHTW
BIOB_HYDS0       QNIPINVCVSAGTIGLESLLK---------LKEAGVTRINHNLETS-ENYFPNIVSTHTW
BIOB_PERMH       ENLPVRVCVSIGTVDEEDLKL---------LKDSGVDRVNHNLETS-ERHFKNIVTTHSY
BIOB_SULSY       KTYPIKVCCSLGTVDEKDLDK---------LKVAGVDRINHNLETS-EKYFSKIVSTHTW
BIOB_UNCTG       --KVSHLGVSIGKISDETFLK---------LKEAGIKKMHHNLETS-ENFYPNICSTHNY
BIOB_THENN       -TTSLRICASLGTLEKDELSY---------LKDHGLDRYHHNLETS-PGFFQNICTTHTF
BIOB_THEP1       -NTNLKICASLGVLEKDELRY---------LKENGLDRYHHNLETS-PGFFRNICTTHTF
BIOB_THEYD       -KIGIYPCASLGLLEYDEICY---------LRDKGLERLHCNIETS-ERFFSNICTTHKF
BIOB_DESDA       EYVLKRVCASLGKLSAVQLAQ---------LMDIGLDRYHHNLETS-RRYYPSICTTQTW
BIOB_ALKMQ       EC-DIDLCASHGLLSEEAFIA---------LKESGVSMYHENIETS-KRNFPNICTTHTY
BIOB_CLOB8       EC-SINLCASHGFLSEEQFVL---------LKEAGVTMYHANIETS-KRNFHNICTTHSY
BIOB_CLOB1       TC-SIRLCASHGLLKYEDLKR---------LKDSGVTRYHNNLETS-RKFFTKICTTHKY
BIOB_CLOBH       TC-SIRLCASHGLLKYEDLKR---------LKDSGVTRYHNNLETS-RKFFTKICTTHKY
BIOB_CLOBK       TC-SIRLCASHGLLKYEDLKR---------LKDSGVTRYHNNLETS-RKFFTKICTTHKY
BIOB_CLOBL       TC-SIRLCASHGLLKYEDLKR---------LKDSGVTRYHNNLETS-RKFFTKICTTHKY
BIOB_CLOBM       IC-SIRLCASHGLLKYEDLKR---------LKDSGVTRYHNNLETS-KSFFKNICTTHTY
BIOB_CLOBA       KC-AIKLCASHGLLNYEELVK---------LKESGVIRYHNNLETS-RRFFSNICTTHTF
BIOB_CLOBB       KC-DIKLCASHGLLNYEELVK---------LKESGVIRYHNNLETS-RNFFSNICTTHTF
BIOB_BRAHW       ET-DGYICASLGLLDEEGFNK---------MKNAGLKRVHNNLEAS-RNFFSKVCTTHTY
BIOB_AKKM8       HC-GISLCASHGLISKKHCEQ---------LKAAGVSRYHNNLETS-RRNFPNVCTTHTY
BIOB2_CORDI      EV-GIEVCISAGLLSAEDFQA---------LHDAGISRVHCNLETS-RAYFPSICISHTF
BIOB_CAMHC       HT-KFHLCASFGIVSKEILAE---------LKKSGVKTYHHNLETS-RKFFPKICTTHTY
BIOB_FUSNN       HTSKLELCASHGICTKEALQK---------LVDAGVLTYHHNLESS-RRFYPNVCTSHSY
BIOB_CLOD6       NT-NLKLCASLGIIDYEQAKM---------LKSAGVTTYHHNVETC-RDNFHNICTTHTY
BIOB_HUNT2       ET-NLKLCASLGSLSYERAVR---------LKEAGVSMYHHNIETC-REYYPKICDTHTY
BIOB_CLOK1       EN-RIDLCASLGILEYEDLIR---------LKQCGVTMYHHNLETS-REYYKEICTTHSY
BIOB_CLOTE       RV-NINLCASLGILSYNQLLQ---------LKNVGVTMYHHNLETS-REYYNKICTTHSY
BIOB_CLONN       DT-KIKLCASLGIISKYQLKK---------LKEAGVSRYHHNLETS-REFYSKICTTHSY
BIOB_CLOP1       EL-KINLCASHGIINKESLIK---------LKKAGVKRYHHNLETS-RNCYDKICKTHSY
BIOB_CLOPE       EL-KINLCASHGIINKESLIK---------LKKAGVKRYHHNLETS-RNYYDKICKTHSY
BIOB_PORG3       RT-DIKCCASLGLLSEEKLQI---------LFDNGVTTYHCNMETA-PSFFPSLCSTHTQ
BIOB_PORGI       RT-DIKCCASLGLLSEEKLQI---------LFDNGVTTYHCNMETA-PSFFPSLCSTHTQ
BIOB_PARD8       QS-DIKCCASMGLLTRSQLQS---------LYDSGVENYHCNIETA-PSYFRQLCSTHTI
BIOB_CROS5       TETNIKPCCALGEVTLEQAEA---------LKEAGVTRYNHNLEAS-ENYYQSIVSTHSW
BIOB_RIPO1       AETSIKPCCALGEVTPEQAQA---------LREAGVTRYNHNLEAS-EGFYPEIVTSHSW
BIOB_GLOC7       TEAKIKPCCALGELTLEQAQA---------LKEAGVTRYNHNLEAS-ATFYPQIVTTHTW
BIOB_MICAN       ETAKIKPCCALGELTLPQAQA---------LKEAGVTRYNHNLEAS-ENFYPNVVSTHSW
BIOB_TRIEI       AETNIKPCCALGELTPEQAQA---------LAEAGVTRYNHNLEAS-EHFYPEIVSTHSW
BIOB_SYNY3       QETNIKPCCALGEVTPEQAQQ---------LKEAGVTRYNHNLEAS-ATYYDKIVSTHTW
BIOB_CYAP4       AETNIKPCCALGEVTPEQAQA---------LKEAGVSRYNHNLESS-ENFFPEVATTHSW
BIOB_SYNP2       AETAIKPCCALGEVTPEQAQQ---------LREAGVTRYNHNLEAS-ENFFPDIVTTHSW
BIOB_CARHZ       QEVKLELCACLGTLTEKAAMQ---------LREVGVTRYNHNLETA-RSFFSNIVTTHTY
BIOB_CLOAB       ENTNLKLCACLGTLTEKAMNS---------LAAVGVERYNHNLETA-KSFYKNIVSTHGY
BIOB_DESAP       EVPELKLCASLGIISPTEARA---------LKEAGLDRYHHNLETA-ASFFPEVCTTHRY
BIOB_PELTS       EKTGLGLCASLGIIGYDKAVR---------LKEAGVGMYHHNLETC-RSYFPHICTTHSF
BIOB_HELMI       RETKLSLCASLGILNEAQLRR---------LAEAGVTMYHHNLEAS-RRFFPQICTTHSY
BIOB_DESPS       EETSLAPCASMGLLEPETAEM---------LVEMGVRRYHCNLETS-ASFFSEVCTSHTW
BIOB_DESRM       EKTSLQLCASLGLLDTSRALQ---------LKKAGVSTYHHNLECA-ESFFKRICTTHTY
BIOB_ANAD2       AETAVEPCASLGLMREPELRR---------LKDAGLMHYHHNLETA-RSHFENVCTTHTF
BIOB_ANASK       AETAVEPCASLGLMREPELRR---------LKDAGLMHYHHNLETA-RSHFENVCTTHTF
BIOB_ANADE       AETAVEPCASLGLMREPELRR---------LKDAGLMHYHHNLETA-RSHFENVCTTHTF
BIOB_ANADF       AETAVEPCASLGLVREPELVR---------LKAAGLMHYHHNLETA-RSFFENVCTTHTY
BIOB_DESVH       RETGIALCGSLGQLTPDAAAC---------LKEAGFSSYHHNLETS-RSFFPAICSTHAY
BIOB_DESVV       RETGIALCGSLGQLTPDAAAC---------LKEAGFSSYHHNLETS-RSFFPAICSTHAY
BIOB_DESVM       DRVDIGLCASLGQLATGSAESGNRGERARRLKDAGISSYHHNLETA-RSFFPQVCTTHPY
BIOB_DESAG       ARTHLSPCASLGQLSPQAAAM---------LRQAGLERYHHNLETA-RSFFASVCTTHDY
BIOB_GEOMG       ETTSIAPSCSLGIIDHETAVT---------LREAGVETYHHNLETS-RSFFPHICTTHDY
BIOB_GEOSL       RETAIEPSCSLGVIDYETALA---------LREAGAVTYHHNLETA-RSFFPNVCTTHDY
BIOB_GEODF       RETGITPSCSLGIINHETASA---------LVEAGVETYHHNLETS-RSFFPNVCTTHDY
BIOB_GEOUR       QETGITPSCSLGIIDYETALA---------LKDAGVETYHHNLETA-RSFFPNVCTTHDY
BIOB_GEOBB       KETTILPSCSLGIIDEETARK---------LKEAGMDTYHHNLETA-ASFFPQICTTHDY
BIOB_PELPD       SETAIAPSCSLGILDEETARL---------LKDAGMVTYHHNLETS-RSFFPSICSSHDY
BIOB_GEOLS       AEGRIAPGASLGTLTKTAAEQ---------LKAAGLVTYHHNLETS-RSFFPQICSTHDY
BIOB_PELCD       ETTRIAPSASLGLLDEETARA---------LADAGCVTYHHNLETA-RSYFPHICTTHDY
BIOB_SYNAS       KSTRLTVCASLGQLTASSAER---------LKAGGVSVYHHNLETA-RSFFPQICTTHDY
BIOB_DESAL       G-DGVGYCASLGILDAQDFAL---------LKEAGVDRYHHNLETA-ESHFKEICTTHAY
BIOB_DESOH       T-TAVSTCASLGILDPGQLAM---------LRDAGVTRYHHNLESA-ESLFANVCTTHTY
BIOB_SYNFM       D-PRVAWCASMGCLDRSRLQL---------LKEAGVSRFHHNLETA-ESYFPEICSTHGY
BIOB_CHLCH       ELPSLNVCASFGVLGEEPVAA---------LAAHGIAHYNINLQVEPNRYNDLIATTHSA
BIOB_PELPB       ELPELSVCASLGMLGEEPAEA---------LAAHGIAHYNINIQVVPDRYHDLIADTHSV
BIOB_CHLP8       ELPDLKVCASLGMLGDEPAAE---------LARHGIAHYNINIQVDPGRYGELIADTHSV
BIOB_CHLTE       ELPGLHVCASLGVLGDAPAAE---------LARHGIAHYNINIQVDPARYGELIADTHAV
BIOB_CHLL2       ELPGLNVCASLGVLGEETSAA---------LAAHGIAHYNINIQVAPSRYSDLIADTHTV
BIOB_PELLD       ELPSLQVCASLGVLGPDTAKA---------LAGRGIAHYNINIQVTPGRYGELIADTHAV
BIOB_CHLPM       ELPELNVCASIGILGPETAAA---------LARHGIAHYNINLQVAPEKYAGLIADTHGI
BIOB_CHLPD       ELPDLEICASLGVLGEEPALE---------LARHGIAQYNINIQVAPRRYGELIADTHSV
BIOB_CHLPB       EYPDLNVCASLGILGEEPVRM---------LAEHNVRHYNINIQVAPDRYSDLIADSHPL
BIOB_PROA2       EYPGLKVCASLGVLGSDSAAL---------LADAGIAHYNINLQVSPDRYSDLIADSHSQ
BIOB_NATPD       DETDVEVDASLGVLTEEEAEI---------LAAEGLNHYNHNIETS-RRYFSEIVNTHSF
                            *                  :        : * :         :  ::  

BIOB_FRAT1       EERIETIRNVANADINVCCGGILGMGESLDDRFNLLLELLQLPAAPKSIPINTLIPIKGT
BIOB_FRATT       EERIETIRNVANADINVCCGGILGMGESLDDRFNLLLELLQLPAAPKSIPINTLIPIKGT
BIOB_FRATN       EERIETIRNVANADINVCCGGILGMGESLDDRFNLLLELLQLPAAPKSIPINTLIPVKGT
BIOB_FRATW       EERIETIRNVANADINVCCGGILGMGESLDDRFNLLLELLQLPAAPKSIPINTLIPVKGT
BIOB_FRATM       EERIETIRNVANADINVCCGGILGMGESLDDRFNLLLELLQLPAAPKSIPINTLIPVKGT
BIOB_FRATF       EERIETIRNVANANINVCCGGILGMGESLDDRFNLLLELLQLPAAPKSIPINTLIPVKGT
BIOB_FRATH       EERIETIRNVANANINVCCGGILGMGESLDDRFNLLLELLQLPAAPKSIPINTLIPVKGT
BIOB_FRATO       EERIETIRNVANANINVCCGGILGMGESLDDRFNLLLELLQLPAAPKSIPINTLIPVKGT
BIOB_FRAP2       EERIETIRNVANADINVCCGGILGMGESLDDRFNLLLELLQLPAAPKSIPINTLIPVKGT
BIOB_COXB1       QDRMETLKNVRNAGINVCCGGILGMGESRADRIQLLLELYQLPEPPTSIPINQLIPIKGT
BIOB_COXB2       QDRMETLKNVRNAGINVCCGGILGMGESRADRIQLLLELYQLPEPPTSIPINQLIPIKGT
BIOB_COXBN       QDRMETLKNVRNAGINVCCGGILGMGESRADRIQLLLELYQLPEPPTSIPINQLIPIKGT
BIOB_COXBR       QDRMETLKNVRNAGINVCCGGILGMGESRADRIQLLLELYQLPEPPTSIPINQLIPIKGT
BIOB_COXBU       QDRMETLKNVRNAGINVCCGGILGMGESRADRIQLLLELYQLPEPPTSIPINQLIPIKGT
BIOB_LAWIP       DDRLATLKAVRKFGIKLCSGGIIGLGETIDDRISMLLLLATLEEQPESVPINRFVKVAGT
BIOB_RICFE       QDRLDTLRYVRASGMKVCCGGILGMGETNDDRINMILTLANLEEPAESVTINKLIKIPGT
BIOB_NEOSM       SDRIETLENVAKAGLKICSGGILGMGESNEDRIKMLVELSHLSFPPESIPINKLIPIPGT
BIOB_ANAMF       EERLETVRNVQQAGIKVCCGGILGMGESTEDRASMLVTLANLEQHPLSVPINRLVPIEGT
BIOB_ANAMM       EERLETVRNVQQAGIKVCCGGILGMGESTEDRASMLVTLANLEQHPLSVPINRLVPIEGT
BIOB_ANAPZ       DERLDTINNVQEAGINVCCGGILGMGESTEDRAQMLLTLANLKQHPRSVPINRLVAFKGT
BIOB_EHRCJ       DDRLTSLNNIHEAGINICSGGILGLGESVEDRAKMLLTLANLKEHPLSVPINRLVPIKGT
BIOB_EHRCR       DDRLASLNNIYEAGINICSGGILGLGESIEDRAKMLLTLANLKEHPRSVPINRLVPIKGT
BIOB_EHRRG       DDRLSSLNNISEAEINICSGGILGLGESIEDRAKMLLTLANLKKHPKSVPINRLVPIKGT
BIOB_EHRRW       DDRLSSLNNISEAEINICSGGILGLGESIEDRAKMLLTLANLKKHPKSVPINRLVPIKGT
BIOB_AGRRK       QDRLDTLATVRSFGIDLCCGGIIGMGETIRDRASMLHILAAMEPHPESVPINALVPVEGT
BIOB_AGRVS       ADRLETLSIVRSFGIDLCCGGIIGMGETIRDRASMLQVLASMRPHPESVPINALVPVEGT
BIOB_RUEPO       QDRLDTLAYCRDAGIELCCGGIIGMGESLRDRAAMLQVLANFAPHPESVPINALIPIEGT
BIOB_BEII9       DERLATLEAVRGEGIALCCGGIIGMGETVEDRVALLAILAGFDPHPESVPINALVPVAGT
BIOB_METSB       DDRLDTLKAVRGAGIEMCCGGIVGMGESVADRAAMLQTLARFDPHPESVPINALVPVEGT
BIOB_ZYMMO       QDRLETLAKIRDAGIALCTGGIIGLGESPRDRVEMLVVLAGMNPHPESVPVNMLVPIEGT
BIOB_METC4       DDRLQTLEHVRQAGIGVCCGGIVGMGERVRDRAEMLLVLANHAPHPESVPINALVAVEGT
BIOB_METEP       DDRLQTLEHVRQAGIGVCCGGIVGMGERVRDRAEMLLVLANHAPHPESVPINALVAVEGT
BIOB_METPB       DDRLQTLEHVRQAGIGVCCGGIVGMGERVRDRAEMLLVLANHAPHPESVPINALVAVEGT
BIOB_METRJ       DERLQTLANVREAGIGVCCGGIVGMGEGVTDRAAMLQVLANHAPHPESVPINALVAVPGT
BIOB_METNO       ADRLNTLQAVRDAGIGVCCGGIIGMGEGVADRAAMLQVLANHAPHPESVPINALVAVAGT
BIOB_METS4       EDRLATLQAVRDAGIGVCCGGIIGMGEGVTDRVAMLQVLANHAPHPESVPINALAAVPGT
BIOB_PROM2       QDRLDTIKRVRNAGINVCCGGIIGLGETNGDRASLLKVLSNMNPHPESVPINSLVAIEGT
BIOB_PROM9       QDRLDTIKRVRNAGINVCCGGIIGLGETNGDRASLLEVLSNMNPHPESVPINSLVAIEGT
BIOB_PROMS       QDRLDTIKRVRNAGINVCCGGIIGLGETNGDRASLLEVLSNMNPHPESVPINSLVAIEGT
BIOB_PROM0       QDRLDTIKRVRNAGINVCCGGIIGLGETNGDRASLLEVLSNMNPHPESVPINSLVAIEGT
BIOB_PROM5       QDRLETIKRVRNAGINVCCGGIIGLGENNGDRASLLEVLSNMNPHPESVPINSLVAIEGT
BIOB_PROMP       QDRLETIKRVRNAGINVCCGGIIGLGEDNGDRASLLEVLSNMNPHPESVPINSLVAIEGT
BIOB_PROM1       QDRLETLRRVRMAGITVCCGGIIGMGESVSDRASLLKVLATLDPHPESVPINALVAVEGT
BIOB_PROMT       QDRLETLRRVRMAGITVCCGGIIGMGESVSDRASLLKVLATLDPHPESVPINALVAVEGT
BIOB_PROM4       QERIETLERVRSAGITLCTGGIIGLGESLKDRASLLKVLANMSPHPESVPINALVAVEGT
BIOB_PROMA       QDRLETLHRVRNAGITICCGGIIGMGETLKDRASLLRVLANMDPHPESVPINALVPVEGT
BIOB_PROM3       QERIETLQKVRSAGITLCCGGIIGMGESTLDRASLLCVLANINPHPESVPINGLVAVEGT
BIOB_PROMM       QERIETLQKVRSAGITLCCGGIIGMGESTVDRASLLCVLANINPHPESVPINGLVAVEGT
BIOB_SYNPW       QERLETLQRVRQAGVTLCCGGIIGMGESVRDRASMLQVLACLDPHPESVPINALVAVEGT
BIOB_SYNS3       QERLETLERVRQAGVTLCCGGIIGMGETIGDRASMLQVLASINPHPESVPINALVAVEGT
BIOB_SYNPX       QERLETLQRVRKAGVTLCCGGIIGMGETLRDRASMLQVLASMAPHPESVPVNGLVAVEGT
BIOB_SYNSC       QERLETLERVRKAGVTLCCGGIIGMGETLRDRASMLQVLASMNPHPESVPVNGLVAVEGT
BIOB_SYNS9       EDRLETLQRVRKAGVTLCSGGIIGMGETLRDRASMLQVLASMNPHPESVPVNGLVAVEGT
BIOB_SYNR3       QERLDTLQRARDAGLSLCCGGIIGMGESRRDRASLLQVLAGLNPHPESVPINGLVAVEGT
BIOB_SYNE7       ADRLATLERVRQAGISVCCGGIIGMGEGQRDRAGLLQVLATLNPHPESVPINALVPVEGT
BIOB_SYNP6       ADRLATLERVRQAGISVCCGGIIGMGEGQRDRAGLLQVLATLNPHPESVPINALVPVEGT
BIOB_SORC5       DERLVTLRNVRRAGITVCSGGIIGMGESIADRCEMLVELARLDPHPESVPINALVRSPGT
BIOB_MYXXD       EDRLRTLNRVRDAGISVCCGGIIGMGESVDDRCNLLRTLANQEHHPESVPINALVAVEGT
BIOB_GLOVI       KDRLETIRAVGAAGISVCCGGILGMGESLTDRFELLESLGSLDPTPESIPINCLVPVAGT
BIOB_SYNJA       RDRLETLAHVAAAGLQICCGGIVGLGESDEDRIGLLHVLANLTPPPTSVPINALVPVAGT
BIOB_NOSS1       GDRLNTIENVRQTNVTVCSGGILGLGESIDDRVAMLQTLATLNPHPESVPINILSQVEGT
BIOB_TRIV2       SDRLNTIENVRQTNVTVCSGGILGLGESIDDRVAMLQTLATLNPHPESVPINILSQVEGT
BIOB_NOSP7       SDRLNTIENVRQTNVTVCSGGILGLGETVDDRVGMLQTLANLHPHPESVPINILSQVPGT
BIOB_CHLAB       EDRLRTLDIVEKSGLHVCCGGIIGMGETVEDRVELLHNLARRERMPESVPVNVLWPIKGT
BIOB_CHLFF       EDRLKTLDVVEQSGISVCCGGIIGMGETTEDRIGLLHTLACRERAPESVPVNVLWPIEGT
BIOB_CHLPN       EDRLNTLDVVNKSGISTCCGGIVGMGESEEDRIKLLHVLATRDHIPESVPVNLLWPIDGT
BIOB_FLAJ1       EDRLQTIENVRKTNVTVCSGGIIGMGESIEDRAGMLVALSTLNPQPESVPINALVAVEGT
BIOB_FLAPJ       EDRIETIANVRKTNVTVCSGGIIGMGESIGDRAGMLVALSTLSPQPESVPINALVAVEGT
BIOB_GRAFK       QDRLDTIGNVRKTNVTVCSGGIIGMGESEADRAGMLVALSTLNPQPESVPINALVPVEGT
BIOB_CYTH3       DDRLETLDNVRNAKISVCSGGIIGMGESHGDRVGMLHTLANMVEHPESVPVNALVPVEGT
BIOB_HYDCU       QDRLDTIDKVQEAGINVCSGGIIGMGEQHKDRAELIRTFGTMRHHPNSVPINLLVPVEGT
BIOB_BRUA1       EDRLDTLANVRNAGIKVCSGGILGLGEEAEDRIDMLVTLANLPEPPESVPINMLIPMPGT
BIOB_BRUA2       EDRLDTLANVRNAGIKVCSGGILGLGEEAEDRIDMLVTLANLPEPPESVPINMLIPMPGT
BIOB_BRUAB       EDRLDTLANVRNAGIKVCSGGILGLGEEAEDRIDMLVTLANLPEPPESVPINMLIPMPGT
BIOB_BRUC2       EDRLDTLANVRNAGIKVCSGGILGLGEEAEDRIDMLVTLANLPEPPESVPINMLIPMPGT
BIOB_BRUMB       EDRLDTLANVRNAGIKVCSGGILGLGEEAEDRIDMLVTLANLPEPPESVPINMLIPMPGT
BIOB_BRUME       EDRLDTLANVRNAGIKVCSGGILGLGEEAEDRIDMLVTLANLPEPPESVPINMLIPMPGT
BIOB_BRUSI       EDRLDTLANVRNAGIKVCSGGILGLGEEAEDRIDMLVTLANLPEPPESVPINMLIPMPGT
BIOB_BRUSU       EDRLDTLANVRNAGIKVCSGGILGLGEEAEDRIDMLVTLANLPEPPESVPINMLIPMPGT
BIOB_BRUO2       EDRLDTLANVRNAGIKVCSGGILGLGEETEDRIDMLVTLANLPEPPESVPINMLIPMPGT
BIOB_OCHA4       DDRLETLAHVREAGIKVCSGGILGLGETEDDRIDMLVTLANLPTPPESVPINMLIPMPGS
BIOB_AGRFC       EDRLETLANVRDAGIKVCAGGILGMGETVEDRISMLVTLANLPVPPESVPINMLIPIPGS
BIOB2_PARDP      QDRIETLERVQAAGINVCAGGIVGMGETAEDRISMLETLAGLEVPPQSVPINMLMPMAGT
BIOB_LEGPA       SDRLDTLNNVRSAGINVCCGGILGLGETREDRIEFLLTLANMETPPESVPINRLIPVEGT
BIOB_LEGPH       SDRLDTLNNVRSAGINVCCGGILGLGETREDRIEFLLTLANMETPPESVPINRLIPVEGT
BIOB_LEGPL       SDRLDTLNNVRSAGINVCCGGILGLGETREDRIEFLLTLANMETPPESVPINRLIPVEGT
BIOB_LEGPC       SDRLDTLNNVRSAGINVCCGGILGLGETREDRIEFLLTLANMETPPESVPINRLIPVEGT
BIOB_RUTMC       QDRLNTLESVQNANIHVCSGGILGLDESQTDRASMLRSLSNLRTHPDSVPFNLLVPIPGT
BIOB_VESOH       QDRLNTLESVQNANIRVCSGGILGLGEDQTDRASMLRSLSNLAIHPDSVPLNLLVPIPGT
BIOB_HAEI8       DDRLSTLGKVRKAGLKVCCGGIVGMNETRKERAGLIASLANLDPQPESVPINQLVKVEGT
BIOB_HAEIE       DDRLSTLGKVRKAGLKVCCGGIVGMNETRKERAGLIASLANLDPQPESVPINQLVKVEGT
BIOB_HAEIN       DDRLSTLGKVRKAGLKVCCGGIVGMNETRKERAGLIASLANLDPQPESVPINQLVKVEGT
BIOB_HAEIG       DDRLSTLGKVRKAGLKVCCGGIVGMNETRKERAGLIASLANLDPQPESVPINQLVKVEGT
BIOB_HAES1       DDRLNTLGKVRKAGLKVCCGGIVGMNETRKERAGLIASLANLDPQPESVPINQLVKVEGT
BIOB_HISS2       DDRLNTLGKIRKAGLKVCCGGIVGMNETRKERAGLIASLANLDPQPESVPINQLVKVEGT
BIOB_PASMU       DDRINTLGKVRKAGLKVCCGGIIGMNETRKERAGLIASLANLDPQPESVPINQLVKVEGT
BIOB_ACTSZ       EDRLSTLGKVRKAGLKVCCGGIIGMNENRKERAGFIASLANLDPQPESVPINQLVKVDGT
BIOB_MANSM       DDRLNTLGKVRKAGLKVCCGGIIGMNESRKERAGFIASLANLDPQPESVPINQLVKVEGT
BIOB_ACTP7       DDRMDTLGKVRHAGLKVCCGGIVGMNETRPERAGLIASLANLDPQPESVPINQLIKVEGT
BIOB_ACTPJ       DDRMDTLGKVRHAGLKVCCGGIVGMNETRPERAGLIASLANLDPQPESVPINQLIKVEGT
BIOB_ACTP2       DDRMDTLGKVRHAGLKVCCGGIVGMNETRPERAGLIASLANLDPQPESVPINQLIKVEGT
BIOB_HAEDU       DDRMDTLGKVRHAGLKVCCGGIVGMNETRPERAGLIASLANLDPQPESVPINQLIKVEGT
BIOB_HAEPS       DDRMDTLGKVRSAGLKICCGGIVGMNETRAERAGLIASLANLDPQPESVPINQLVKVAGT
BIOB_NEIG1       EDRMDTLGKVRNAGLKVCCGGIVGMNETRAERAGLIASLANLDPQPESVPINRLVKVEGT
BIOB_NEIG2       EDRMDTLGKVRNAGLKVCCGGIVGMNETRAERAGLIASLANLDPQPESVPINRLVKVEGT
BIOB_NEIM0       EDRMDTLGKVRNAGLKVCCGGIVGMNETRAERAGLIASLANLDPQPESVPINRLVKVEGT
BIOB_NEIMF       EDRMDTLGKVRNAGLKVCCGGIVGMNETRAERAGLIASLANLDPQPESVPINRLVKVEGT
BIOB_NEIMA       EDRMDTLGKVRNAGLKVCCGGIVGMNETRAERAGLIASLANLDPQPESVPINRLVKVEGT
BIOB_NEIMB       EDRMDTLGKVRNAGLKVCCGGIVGMNETRAERAGLIASLANLDPQPESVPINRLVKVEGT
BIOB_CHRVO       EDRLDTLGKVRKAGLSVCCGGIVGMNETRRDRAGLIVQLANLDPQPESVPVNNLVQVVGT
BIOB_METSK       QDRLDTLDRVREQDINVCCGGIIGMGESRVQRAGLLAQLANMERPPESVPDQLLTQVEGT
BIOB_METFK       QDRLDTLDRVREQDINVCCGGIIGMGESRVQRAGLLAQLANMERPPESVPINLLTQVEGT
BIOB_THIDA       QDRLDTLERVRRADLHVCCGGIVGMGESRTQRAGLIAQLAALDPQPESVPINLLVRVEGT
BIOB_NITEC       QNRLDTLDEVRGANINVCCGGIVGMGESRTARAGLIAQLASLDPYPESVPINYLVQVEGT
BIOB_NITEU       QDRLDTLEEVRGANINVCCGGIVGLGESRMARAGLIAQLANLDPYPESVPINYLVQVEGT
BIOB_NITMU       EDRLDTLQKVRHAGINVCCGGIVGMGESRRARAGLIAQLANLDPYPESVPINHLVQVEGT
BIOB_ACISJ       QDRLDTLRHVRDAGINVCCGGIVGMGEAPVHRAGLIAQLANLNPYPESVPINSLVRVAGT
BIOB_ACIET       QDRLDTLRHVRDAGINVCCGGIVGMGEAPVHRAGLIAQLANLNPYPESVPINSLVRVAGT
BIOB_DELAS       QDRLDTLKAVRGAGISVCCGGIIGMGEAPVHRAGLIAQLANLNPHPESVPINSLVRVPGT
BIOB_ACIAC       QERLDTLRHVREAGISVCCGGIIGMGEAPVHRAGLIAQLANLDPYPESVPINSLVRVPGT
BIOB_METPP       EERLQTLAHVRDAGMNVCCGGIVGMGESRRERAGLVAQLANLDPHPESVPINELVQVEGT
BIOB1_POLSJ      QDRLDTLARVRSAGVKVCCGGIVGMGETRRQRAGLVAELANLTPYPESVPINNLVKVEGT
BIOB_HERAR       QNRIDTLARVRNVGIKVCCGGIVGMGESRLQRAGLIAQLCNMDPYPESVPVNNLVQVEGT
BIOB_JANMA       QNRIDTLGRVRGAGIKVCCGGIVGMGESRLQRAGLIAQLCNMDPYPESVPVNNLVQVEGT
BIOB_RHOFT       QDRLDTLGRVRQAGLKICCGGIVGMGESRQQRAGLIAQLANLNPYPESVPVNHLVQVEGT
BIOB_POLAQ       QDRLDTISNVRAAGMSVCCGGIVGMGESREQRAAFLARLANLSPYPESVPINHLVPVAGT
BIOB_BORBR       QDRLDTLQQVREAGINVCCGGIVGMGESRRDRAGLVAQLANMEPYPESVPINNLVQVEGT
BIOB_BORPA       QDRLDTLQQVREAGINVCCGGIVGMGESRRDRAGLVAQLANMEPYPESVPINNLVQVEGT
BIOB_BORPE       QDRLDTLQQVREAGINVCCGGIVGMGESRRDRAGLVAQLTNMEPYPESVPINNLVQVEGT
BIOB_BORPD       QDRLDTLARVRDAGLNVCCGGIVGMGESRRERAGLIAQLASLDPYPESVPINNLVQVEGT
BIOB_BORA1       QDRLDTLARVRNAGIHVCCGGIIGMGESRRDRASLIAQLANMEPYPESVPINHLVPIPGT
BIOB_BURCM       QDRLDTLDRVRDAGINVCCGGIIGMGESRRERAGLISQLANLNPYPDSVPINNLVAIEGT
BIOB_BURL3       QDRLDTLDRVRDAGINVCCGGIIGMGESRRERAGLISQLANLNPYPDSVPINNLVAIEGT
BIOB_BURA4       QDRLDTLDRVRDAGINVCCGGIIGMGESRRERAGLISQLANLNPYPESVPINNLVAIEGT
BIOB_BURVG       QDRLDTLDRVRDAGINVCCGGIIGMGESRRERAGLISQLANLNPYPDSVPINNLVAIEGT
BIOB_BURM1       QDRLDTLDRVRDAGINVCCGGIIGMGESRRERAGLISQLANLNPYPESVPINNLVAIEGT
BIOB_BURCA       QDRLDTLDRVRDAGINVCCGGIIGMGESRRERAGLISQLANLNPYPESVPINNLVAIEGT
BIOB_BURCC       QDRLDTLDRVRDAGINVCCGGIIGMGESRRERAGLISQLANLNPYPESVPINNLVAIEGT
BIOB_BURCH       QDRLDTLDRVRDAGINVCCGGIIGMGESRRERAGLISQLANLNPYPESVPINNLVAIEGT
BIOB_BURCJ       QDRLDTLDRVRDAGINVCCGGIIGMGESRRERAGLISQLANLNPYPESVPINNLVAIEGT
BIOB_BURM7       QDRLDTLERVRDAGINVCCGGIIGMGESRRERAGLIAQLANMNPYPESVPINNLVAIEGT
BIOB_BURM9       QDRLDTLERVRDAGINVCCGGIIGMGESRRERAGLIAQLANMNPYPESVPINNLVAIEGT
BIOB_BURP6       QDRLDTLERVRDAGINVCCGGIIGMGESRRERAGLIAQLANMNPYPESVPINNLVAIEGT
BIOB_BURMA       QDRLDTLERVRDAGINVCCGGIIGMGESRRERAGLIAQLANMNPYPESVPINNLVAIEGT
BIOB_BURMS       QDRLDTLERVRDAGINVCCGGIIGMGESRRERAGLIAQLANMNPYPESVPINNLVAIEGT
BIOB_BURP0       QDRLDTLERVRDAGINVCCGGIIGMGESRRERAGLIAQLANMNPYPESVPINNLVAIEGT
BIOB_BURPS       QDRLDTLERVRDAGINVCCGGIIGMGESRRERAGLIAQLANMNPYPESVPINNLVAIEGT
BIOB_BURP1       QDRLDTLERVRDAGINVCCGGIIGMGESRRERAGLIAQLANMNPYPESVPINNLVAIEGT
BIOB_BURTA       QDRLDTLERVRDAGINVCCGGIIGMGESRRERAGLIAQLANMNPYPESVPINNLVAIEGT
BIOB_PARPJ       QDRLDTLERVRDAGINVCCGGIVGLGESRRERAGLIAQLANMEPYPESVPINNLVQVEGT
BIOB_PARXL       QDRLDTLERVRDAGINVCCGGIVGLGESRRERAGLIAQLANMDPYPESVPINNLVQVEGT
BIOB_PARP8       QDRLDTLEHVRDAGINVCCGGIVGLGESRRERAGLIAQLANMEPYPESVPINNLVQVEGT
BIOB_CUPTR       QDRLDTIGYVRDAGINVCCGGIVGMGESREARAGLIAQLANMDPYPESVPINNLVQVEGT
BIOB_CUPNH       QDRLDTIGHVRDAGINVCCGGIVGMGEAREARAGLIAQLANMDPYPESVPINNLVQVEGT
BIOB_CUPPJ       QDRLDTIGHVRDAGINVCCGGIVGMGESREARAGLIAQLANMDPYPESVPINNLVQVEGT
BIOB_CUPMC       QDRLDTIGHVREAGINVCCGGIVGMGEAREARAGLIAQLANMDPYPESVPINNLVQVEGT
BIOB_POLNA       QDRLDTLENVRGAGINVCCGGIVGMGESRAQRAGLVAQLANLEPYPESVPINNLVAVEGT
BIOB2_POLSJ      QDRLDTLGHVRQAGINVCCGGIVGMGESRLQRAGLIAQLANLSPYPESVPINNLVPVAGT
BIOB_LEPCP       QDRLDTLGNVRDAGINVCCGGIVGMGESRTQRAGLIAQLANLSPYPESVPINNLVPVPGT
BIOB_RALPJ       QDRLDTLEHVRDAGINVCCGGIVGLGESVHERAGLIAELANMEPYPDSVPINNLVKVEGT
BIOB_RALSO       QDRLDTLEHVRDAGINVCCGGIVGLGESRHERAGLVAELANMEPYPDSVPINNLVKVEGT
BIOB_AZOSB       QDRLDTLDKVRDAGINVCCGGIVGMGETQTSRAGLIAQLANMTPPPDSVPINNLVAIPGT
BIOB_AROAE       ADRLDTLEQVRGAGINVCSGGIVGMGEGRRSRAGLLVQLANMASPPESVPINNLVPVPGT
BIOB_DECAR       DDRLDTLDQVRDAGINVCSGGIIGMGESRKNRAALIVQLANLPKPPESVPINNLVPIPGT
BIOB_GLUDA       QERLDTLAHVRDAGINVCCGGIVGMGENDDDRAGLIASLASLPRHPESVPINLLVRVAGT
BIOB_GLUOX       QQRLDTLSNVRDAGINVCCGGIVGMGEDLSDRAGLLMTLANLPKHPESVPINLLVRVEGT
BIOB_GRABC       EDRLETLAHVRDAGINVCCGGILGLGEGLDDRAGLIVALANLPRHPESVPINALVQVEGT
BIOB_ACICJ       QDRLDTLAAVRDAGINICCGGIIGMGEDLDDRAGLLATLADLDPPPESVPINALVAVKGT
BIOB_STRM5       QDRLDTLEHVRDAGLKTCCGGIVGMGETRAQRVGLLLALATLPAHPDSVPINKLVQVAGT
BIOB_STRMK       QDRLDTLEHVRDAGLKTCCGGIVGMGETRAQRVGLLLALASLPAHPDSVPINKLVQVAGT
BIOB_XANAC       QDRLNTLEHVRDVGLKTCCGGIVGMGETREHRIGLLLALATLPAHPDSVPINQLVQVPGT
BIOB_XANC5       QDRLNTLEHVRDVGLKTCCGGIVGMGETREHRVGLLLALATLPAHPDSVPINQLVQVPGT
BIOB_XANOM       QDRLNTLEHVRDVGLKTCCGGIVGMGETRDHRIGLLLALATLPAHPDSVPINQLVQVPGT
BIOB_XANOP       QDRLNTLEHVRDVGLKTCCGGIVGMGETRDHRIGLLLALATLPAHPDSVPINQLVQVPGT
BIOB_XANOR       QDRLNTLEHVRDVGLKTCCGGIVGMGETRDHRIGLLLALATLPAHPDSVPINQLVQVPGT
BIOB_XANC8       QDRLNTLEHVRDVGLKTCCGGIVGMGETREHRVGLLHALATLPAHPDSVPINQLVQVPGT
BIOB_XANCB       QDRLNTLEHVRDVGLKTCCGGIVGMGETREHRVGLLHALATLPAHPDSVPINQLVQVPGT
BIOB_XANCP       QDRLNTLEHVRDVGLKTCCGGIVGMGETREHRVGLLHALATLPAHPDSVPINQLVQVPGT
BIOB_XYLF2       QDRLDTLAHVRDVGLKTCCGGIVGMGETRQHRVGLLLTLATLPAHPDSVPVNLLVQVAGT
BIOB_XYLFT       QDRLDTLAHVRDVGLKTCCGGIVGMGETRQHRVGLLLTLATLPAHPDSVPVNLLVQVAGT
BIOB_XYLFM       QDRLDTLAHVRDVGLKTCCGGIVGMGETRQHRVGLLLTLATLPAHPDSVPVNLLVQVAGT
BIOB_XYLFA       QDRLDTLAHVRDVGLKTCCGGIVGMGETRQHRVGLLLTLATLPAHPDSVPVNLLVQVAGT
BIOB_AZOC5       DDRLETLGHVRAGGIKVCCGGIVGMGETIEDRLAMLELLAGLDPHPESVPLNMWTPIDGT
BIOB_XANP2       DDRLDTLASVRAGGIRLCTGGIVGMGESVDDRIAMLLVLATLDPHPESVPINMWNEIEGT
BIOB_RHOS1       EDRLETVEQVRRGGIKVCCGGILGMGEAEEDRIALLVTLATLPAHPDSVPVNLWNEIEGV
BIOB_RHOS4       EDRLETVEQVRRGGIKVCCGGILGMGEAEEDRIALLVTLATLPAHPDSVPVNLWNEIEGV
BIOB_RHOSK       EDRLETVEQVRRGGIKVCCGGILGMGEAEEDRIALLVTLATLPAHPDSVPVNLWTEIEGV
BIOB1_PARDP      ENRLDTVEQVRKGGIKVCCGGILGMGEAEEDRIAMLVTLATLPAHPDSVPVNLWNEIEGV
BIOB_BRASB       QDRIDTLAHVRDAGIKVCCGGIIGMGEAVDDRLGMMVLLANLGAHPDSVPINMWNEVKGV
BIOB_BRASO       QDRIDTLANVREAGIKVCCGGIIGMGEEVDDRLGMLVLLANLDAHPDSVPINMWNEVKGV
BIOB_NITHX       QDRIDTLAHAREAGLKVCCGGIIGLGEQVGDRLGMLMLLANLPAHPESVPINMWNEVKSV
BIOB_NITWN       QDRIETLACAREAGLKLCCGGIIGMGEQVGDRLGMLILLANLDEHPESVPINLWNEVRGV
BIOB_OLICO       QDRIETLAHARESGLKVCCGGIVGLGEQVEDRLGMLVLLANLAEHPESVPINQWNEVKGV
BIOB_BRADU       QDRIDTLAHVRDAGIKICCGGIIGMGERVEDRLGMLVLLANLPNYPESVPINLWNKIEGV
BIOB_RHOPA       GDRLDTLEKVQDAGIKVCCGGILGLGEKPTDRVEMLRTLANLPQHPESVPINMLIPIEGT
BIOB_RHOPT       GDRLDTLEKVQDAGIKVCCGGILGLGEKPTDRVEMLRTLANLPQHPESVPINMLIPIEGT
BIOB_RHOPS       GDRLETLEKVQDAGIKVCCGGILGLGEKPTDRVEMLRTLANLPQHPESVPINMLIPIEGT
BIOB_RHOP2       GDRLDTLATVQDAGIKVCCGGILGLGEKPTDRVEMLRTLANLPQHPESVPINMLIPIEGT
BIOB_RHOP5       GDRLDTLAKVHDAGIKVCCGGILGLGEKPTDRVEMLRTLANLAQHPESVPINMLIPIEGT
BIOB_RHOPB       GDRLNTLHKVQDAGIKVCCGGILGLGEKPTDRVEMLRTLANLAKHPESVPINLLIPIEGT
BIOB_CAUVN       QERLDTLAHVRDAGMSTCCGGIVGMGEQRRDRAGLLHQLATLPAHPDSLPINGLVPISGT
BIOB_CAUVC       QERLDTLAHVRDAGMSTCCGGIVGMGEQRRDRAGLLHQLATLPAHPDSLPINGLVPISGT
BIOB_CAUSK       QERLDTLAYVRDAGMSTCCGGIVGMGETRRDRASLLHQLATLPSHPDSLPVNALVPVAGT
BIOB_PHEZH       QDRLDTLAAVRDAGMATCCGGIVGMGETRRDRAGLLHQLATLPAHPDSLPINDLMPIPGT
BIOB_HYPNA       DDRIETLGRARQAGIKLCCGGILGMGESRSDRVGLIHELSLLSPHPESVPVNKLVPIEGT
BIOB_MARMM       QDRIDTLSRVRGAGIHVCTGGIVGMGEDEAARIGLLTELASMDPHPESVPINHLVAVPNT
BIOB_ERYLH       QDRLDTLQNVRDAGINVCSGGIVGMGETREDRVGFVHTLATLERHPESVPVNALVPVKGT
BIOB_NOVAD       ADRLQTLDNVRNAGINVCSGGIVGMGETRADRVGFVHALATLEQHPESVPVNALVPIKGT
BIOB_SPHAL       QDRLDTLEEVRAAGINVCSGGIVGMGETRADRVGFIHTLATLPEHPGSVPINALVPVKGT
BIOB_SPHWW       EDRIETLEHVREAGINVCCGGIVGMGETRADRVGFIHALATLPVHPESVPVNALVPVKGT
BIOB_PARL1       QDRLETLERVRNAGINVCSGGIVGMGESPSDRIGMLMTLANLEEHPQSVPINMLMPVEGT
BIOB_ACIF2       QDRLDTLEAVRDAGIRICSGGILGMGESRRDRARMLQVLAQLPQAPESIPINALVPIPGT
BIOB_ACIF5       QDRLDTLEAVRDAGIRICSGGILGMGESRRDRARMLQVLAQLPQAPESIPINALVPIPGT
BIOB_NITOC       QDRLETLSQVREAGIHVCCGGIVGMGEERSDRAGLLANLANLPRHPESVPINRLVQVEGT
BIOB_THISH       QDRLETLAHVREAGINVCSGGILGMGESRRDRARLLQQLANLPRHPESVPINNLVQVEGT
BIOB_ALKEH       QDRLDTLARVRDAGLKTCCGGIIGMGETRQDRAELLRTLASLPVQPQSVPINQLVQVPGT
BIOB_HALHL       EQRLQTLERIRDAGMRVCCGGIVGLGEARADRVEMLATLANLPVPPQSVPINRLIPIPGT
BIOB_ALCBS       NDRLSTLANVRDAGMKVCCGGIVGMGEERNDRVGLLQQLANLPHHPESVPINMLVKIEGT
BIOB_METCA       QDRLDTLQRVRDAGMHVCCGGIVGMGESAADRAGLLIGLANLPRHPESVPINLLVRVEGT
BIOB_MAGSA       QDRLDTLDVVRDAGLHVCSGGIVGLGETRTDRARMIQTLANMPKHPDSVPINLLIPIQGT
BIOB_ACIB3       DDRLNTLDYVRQAGMKVCSGGIVGLGESREDRIGLLHELATLPIHPESVPINMLVPIEGT
BIOB_ACIB5       DDRLNTLDYVRQAGMKVCSGGIVGLGESREDRIGLLHELATLPIHPESVPINMLVPIEGT
BIOB_ACIBY       DDRLNTLDYVRQAGMKVCSGGIVGLGESREDRIGLLHELATLPIHPESVPINMLVPIEGT
BIOB_ACIBC       DDRLNTLDYVRQAGMKVCSGGIVGLGESREDRIGLLHELATLPIHPESVPINMLVPIEGT
BIOB_ACIBT       DDRLNTLDYVRQAGMKVCSGGIVGLGESREDRIGLLHELATLPIHPESVPINMLVPIEGT
BIOB_ACIBS       DDRLNTLDYVRQAGMKVCSGGIVGLGESREDRIGLLHELATLPIHPESVPINMLVPIEGT
BIOB_ACICA       DDRLNTLDHVRHAGMKVCSGGIVGLGESRNDRIGLLQELATMPVHPESVPINMLVPIEGT
BIOB_ACIAD       DDRLNTLDHVRSAGMKVCSGGIVGLGEQKQDRIGLLHELATLPIHPESVPINMLVPIEGT
BIOB_PSYA2       DERLDTIANVRNSGINVCSGNIVGMGESRDDRIDWVHELLKMPKAPESIPVNLLVPIQGT
BIOB_PSYCK       DERLDTITNVRNSGINVCSGNIVGMGESRDDRIDWVHELLKMPKAPESIPVNLLVPIQGT
BIOB_PSYWF       DERLQTINHVRKSGINVCSGSIVGMGESREDRIDWVLELASMPLPPESIPVNLLVPIQGT
BIOB_CELJU       QDRLETLDNVRKAGMKVCCGGIVGMGEEVLDRAGLLQQLANMAEHPESVPINMLVKVGGT
BIOB_SACD2       QDRLDTLDNVRHAGMKVCCGGIMGMGEDESDRVGLLLQLANMPQHPESVPINMLVAVEGT
BIOB_HAHCH       SDRLETLQNVRDAGMKVCCGGIMGMGESARDRAALLAQLANLPSHPESVPINMLVKVKGT
BIOB_MARHV       QDRLDTLDNVRKAGMKVCCGGIMGMGEDEDDRVGLLVQLANLPQHPESVPVNMLVKVKGT
BIOB_CHRSD       ADRLETLANVREAGMKVCSGGILGMGEAPRDRAALLQQLVRLDPHPESVPINMLVKVPGT
BIOB_PSE14       SERLQTLAYVRDAGMKICSGGILGMGESLDDRAGLLIQLANLPEHPESVPINMLVKVAGT
BIOB_PSEU2       SERLQTLAYVRDAGMKICSGGILGMGESLDDRAGLLIQLANLPEHPESVPINMLVKVAGT
BIOB_PSESM       GERLQTLAYVRDAGMKICSGGILGMGESLDDRAGLLIQLANLPEHPESVPINMLVKVAGT
BIOB_PSEF5       SERLQTLAYVRDAGMKICSGGILGMGESLDDRAGLLIQLANLPEHPESVPINMLVKVAGT
BIOB_PSEPF       AERLQTLAYVRDAGMKICSGGILGMGESLDDRANLLIQLANLPEHPESVPINMLVKVAGT
BIOB_PSEP1       SERLQTLAYVRDAGMKICSGGILGMGESLDDRAGLLIQLANLPEHPESVPINMLVKVAGT
BIOB_PSEPK       SERLQTLAYVRDAGMKICSGGILGMGESLDDRAGLLIQLANLPEHPESVPINMLVKVAGT
BIOB_PSEPG       GERLQTLAYVRDAGMKICSGGILGMGESLDDRAGLLIQLANLPEHPESVPINMLVKVAGT
BIOB_PSEPW       SERLQTLAYVRDAGMKICSGGILGMGESLDDRAGLLIQLANLPEHPESVPINMLVKVAGT
BIOB_PSEE4       SERLQTLAYVRDAGMKICSGGILGMGESLDDRAGLLIQLANLPEHPESVPINMLVKVAGT
BIOB_PSEA8       SERLQTLAYVREAGMKICSGGILGMGESVDDRAGLLIQLANLPEHPESVPINMLVKVKGT
BIOB_PSEAE       SERLQTLAYVREAGMKICSGGILGMGESVDDRAGLLIQLANLPEHPESVPINMLVKVKGT
BIOB_PSEAB       SERLQTLAYVREAGMKICSGGILGMGESVDDRAGLLIQLANLPEHPESVPINMLVKVKGT
BIOB_PSEA7       GERLQTLAYVREAGMKICSGGILGMGESVDDRAGLLIQLANLPEHPESVPINMLVKVKGT
BIOB_PSEMY       SERLQTLAYVREAGMKICSGGILGMGESVDDRAGLLIQLANLPEHPESVPINMLVKVKGT
BIOB_PSEU5       AERLETLSYVREAGMKICSGGILGMGESLDDRAGLLIQLANLPEHPESVPINMLVKVKGT
BIOB_IDILO       QDRLNTLNNVRDAGMKVCAGGIVGMGESVTDRASLLVQLANLPKHPESVPINMLVKVEGT
BIOB_COLP3       QDRLDTLSNVRSAGMKVCSGGIVGLGEKAVDRSSLLIQLANLNPQPESVPINMLVKVEGT
BIOB_PSYIN       QDRLDTLENVRNSGMKVCSGGIVGLGEAGSDRSGLLVQLANLPQQPESVPINKLVKVKGT
BIOB_MARMS       QDRLDTLSRVRDSGIKLCCGGIMGMGEEQKDRVGLLRQLSQMTPHPESVPINMLVKVEGT
BIOB_PSEHT       QDRLDTIGNVRDAGMKVCSGGIVGMGEQAADRYGLLMQLANLDQQPESVPINMLVKVKGT
BIOB_SHEB2       QNRLDTLTNVRASGMKVCSGGIVGMGEKATDRAGLLQQLANLPQHPDSVPINMLVKVAGT
BIOB_SHEB5       QNRLDTLTNVRASGMKVCSGGIVGMGEKATDRAGLLQQLANLPQHPDSVPINMLVKVAGT
BIOB_SHEB8       QNRLDTLTNVRASGMKVCSGGIVGMGEKATDRAGLLQQLANLPQHPDSVPINMLVKVAGT
BIOB_SHEB9       QNRLDTLTNVRASGMKVCSGGIVGMGEKATDRAGLLQQLANLPQHPDSVPINMLVKVAGT
BIOB_SHESA       QNRLDTLSHVRASGMKVCSGGIVGMGEKATDRAGLLQQLANLPQHPDSVPINMLVKVAGT
BIOB_SHESM       QNRLDTLSHVRASGMKVCSGGIVGMGEKATDRAGLLQQLANLPQHPDSVPINMLVKVAGT
BIOB_SHESR       QNRLDTLSHVRASGMKVCSGGIVGMGEKATDRAGLLQQLANLPQHPDSVPINMLVKVAGT
BIOB_SHEON       QNRLDTLSHVRASGMKVCSGGIVGMGEKATDRAGLLQQLANLPQHPDSVPINMLVKVAGT
BIOB_SHEPC       QNRLDTLTHVRASGMKVCSGGIVGMGEKATDRAGLLQQLANLPQHPDSVPINMLVKVAGT
BIOB_SHESW       QNRLDTLTHVRASGMKVCSGGIVGMGEKATDRAGLLQQLANLPQHPDSVPINMLVKVAGT
BIOB_SHEHH       QSRLDTLSNVRASGMKVCSGGIVGMGEKATDRAGLIQQLANLDQHPDSVPINMLVKVEGT
BIOB_SHEPA       QSRLDTLTNVRASGMKVCSGGIVGMGEKATDRAGLIQQLANLEQHPDSVPINMLVKVEGT
BIOB_SHEPW       QNRLDTLSNVRASGMKVCSGGIVGMGEKATDRAGLLQQLANLDKHPDSVPINMLVKVEGT
BIOB_SHEDO       QSRLDTLSNVRASGMKVCSGGIVGMGEKASDRAGLLQQLANLEQHPDSVPINMLVKVAGT
BIOB_SHEFN       QSRLDTLTNVRASGMKVCSGGIVGMGEKATDRAGLLQQLANLEQHPDSVPINMLVKVAGT
BIOB_SHESH       QDRLDTLSNVRSAGMKVCSGGIVGMGEQASDRAGLLQQLANMEQHPDSVPINMLVKVAGT
BIOB_SHEWM       QDRLDTLSNVRAAGMKVCSGGIVGMGEQATDRSGLLQQLANMEQHPDSVPINMLVKVAGT
BIOB_SHELP       QDRLNTLDNVRAAGMKVCSGGIVGMGEQASDRAGLLQQLANMAKHPESVPINMLVKVAGT
BIOB_SHEAM       QDRLDTLSNVRAAGMKVCSGGIVGMGEQATDRAGLLQQLANLEQHPDSVPINMLVKVTGT
BIOB_AERHH       QDRLDTLAYVRGAGMKVCSGGIVGMGEQAKDRAGLLMALANLPRHPESVPINMLVKVKGT
BIOB_AERS4       QDRLDTLEHVRGAGMKVCSGGIVGMGEQAKDRAGLLMALANLPRHPESVPINMLVKVKGT
BIOB_ALTMD       EDRLNTLENVRAAGMNVCSGGIVGMGETVSDRASMLVQLANLPEQPQSVPINMLVKVKGT
BIOB_PSEA6       QDRLNTLDAVREAGMNVCSGGIVGMGETGSDRSGLLMQLANLEHQPESVPINMLVKVKGT
BIOB_ALIF1       QDRLDTLSHVRDAGMKICSGGIIGMGESASDRAGLFVELANLPQHPESVPVNMLVKVKGT
BIOB_ALIFM       QDRLDTLSHVRDAGMKICSGGIIGMGESASDRAGLFVELANLPQHPESVPVNMLVKVKGT
BIOB_ALISL       QDRLDTLSHVRDAGMKICSGGIIGMGESVNDRAGLFVELANLPQHPESVPVNMLVKVKGT
BIOB_VIBC3       QDRLDTLSHVRDAGMKICSGGIIGMGESTNDRAGLLVELANLPTHPESVPINMLVKVKGT
BIOB_VIBCH       QDRLDTLSHVRDAGMKICSGGIIGMGESTNDRAGLLVELANLPTHPESVPINMLVKVKGT
BIOB_VIBTL       QDRLDTLSHVRDAGMKICSGGIIGMGESTNDRAGLLVELANLPVHPESVPINMLVKVKGT
BIOB_VIBCB       QDRLDTLSHVRDAGMKICSGGIIGMGESANDRAGLLVELANLPVHPESVPINMLVKVKGT
BIOB_VIBPA       QDRLDTLSHVRDAGMKICSGGIIGMGESANDRAGLLVELANLPTHPESVPINMLVKVKGT
BIOB_VIBVU       QDRLDTLSHVRDAGMKICSGGIIGMGESANDRAGLLVELANLPTHPESVPINMLVKVKGT
BIOB_VIBVY       QDRLDTLSHVRDAGMKICSGGIIGMGESANDRAGLLVELANLPTHPESVPINMLVKVKGT
BIOB_PHOPR       QDRLDTLSHVRDAGMKICSGGIIGMGESSRDRAGLLVELATLPTHPESVPINMLVKVKGT
BIOB_BUCA5       QERLHTLHAVRSSGMKVCSGGIIGLGEKKQDRIELLIELSNLSIQPESVPINMLVKIPGT
BIOB_BUCAT       QERLHTLHAVRSSGMKVCSGGIIGLGEKKQDRIELLMELSNLSIQPESVPINMLVKIPGT
BIOB_BUCAI       QERLHTLHAVRSSGMKVCSGGIIGLGEKKQDRIELLMELSNLSIQPESVPINMLVKIPGT
BIOB_BUCAP       EERLSTLKKVRNSGMKICSGGIIGLGEKKQDRMELLMELSNLSIQPESVPINMLVKIPGT
BIOB_BUCBP       QDRLNTLKKVRKSGMKICSGGILGLGEKLKDRIELLIELSNLEIAPESIPINMLVKVKGT
BIOB_WIGBR       EDRISTIQNVRNAGIKVCSGGILGLGESDKDRIKLLIQLANLPKPPESVPINMLVRIKGT
BIOB_BAUCH       QDRLNTIENVRKAGIKICSGGIIGLGETISDRAGLLVELANLPEPPSSVPINMLVKVRGT
BIOB_PECAS       QERLDTLDKVRGAGIKVCSGGIVGLGETVRDRAGLLVQLANLPTPPESVPINMLVKVKGT
BIOB_ERWT9       QERLDTLGKVREAGIKVCSGGIVGLGETVQDRAGLLVQLANLPEPPESVPINMLVKVKGT
BIOB_SERMA       QERLDTLDKVRDAGIKVCSGGIVGLGETVRDRAGLLVQLANLPKPPESVPINMLVKVKGT
BIOB_SERP5       QERLDTLGKVRGAGIKVCSGGIVGLGETVRDRAGLLVQLANLPTPPESVPINMLVKVKGT
BIOB_YERPA       QERLDTLNEVRDAGIKVCSGGIVGLGETVRDRAGLLVQLANLPKPPESVPINMLVKVKGT
BIOB_YERPB       QERLDTLNEVRDAGIKVCSGGIVGLGETVRDRAGLLVQLANLPKPPESVPINMLVKVKGT
BIOB_YERPE       QERLDTLNEVRDAGIKVCSGGIVGLGETVRDRAGLLVQLANLPKPPESVPINMLVKVKGT
BIOB_YERPG       QERLDTLNEVRDAGIKVCSGGIVGLGETVRDRAGLLVQLANLPKPPESVPINMLVKVKGT
BIOB_YERPN       QERLDTLNEVRDAGIKVCSGGIVGLGETVRDRAGLLVQLANLPKPPESVPINMLVKVKGT
BIOB_YERPP       QERLDTLNEVRDAGIKVCSGGIVGLGETVRDRAGLLVQLANLPKPPESVPINMLVKVKGT
BIOB_YERPS       QERLDTLNEVRDAGIKVCSGGIVGLGETVRDRAGLLVQLANLPKPPESVPINMLVKVKGT
BIOB_YERPY       QERLDTLNEVRDAGIKVCSGGIVGLGETVRDRAGLLVQLANLPKPPESVPINMLVKVKGT
BIOB_YERP3       QERLDTLNEVRDAGIKVCSGGIVGLGETVRDRAGLLVQLANLPKPPESVPINMLVKVKGT
BIOB_YERE8       QERLDTLSEVRDAGIKVCSGGIVGLGETVRDRAGLLVQLANLPKPPESVPINMLVKVKGT
BIOB_PSEVU       QERLDTLDKVRDAGIKVCSGGIVGLGETVKDRAGLLLQLANLPTPPESVPINMLVKVKGT
BIOB_ENT38       QERLDTLEKVREAGIKVCSGGIVGLGETVNDRAGLLLQLANLPTPPESVPINMLVKVKGT
BIOB_KLEP3       QERLDTLDKVRDAGIKVCSGGIVGLGETVKDRAGLLLQLANLPTPPESVPINMLVKVKGT
BIOB_KLEP7       QERLDTLDKVRDAGIKVCSGGIVGLGESVKDRAGLLLQLANLPTPPESVPINMLVKVKGT
BIOB_SALPB       QERLDTLEKVREAGIKVCSGGIVGLGETVTDRAGLLLQLANLPTPPESVPINMLVKVKGT
BIOB_SALPC       QERLDTLEKVREAGIKVCSGGIVGLGETVTDRAGLLLQLANLPTPPESVPINMLVKVKGT
BIOB_SALNS       QERLDTLEKVREAGIKVCSGGIVGLGETVTDRAGLLLQLANLPTPPESVPINMLVKVKGT
BIOB_SALTY       QERLDTLEKVREAGIKVCSGGIVGLGETVTDRAGLLLQLANLPTPPESVPINMLVKVKGT
BIOB_SALCH       QERLDTLEKVREAGIKVCSGGIVGLGETVTDRAGLLLQLANLPTPPESVPINMLVKVKGT
BIOB_SALA4       QERLDTLEKVREAGIKVCSGGIVGLGETVTDRAGLLLQLANLPTPPESVPINMLVKVKGT
BIOB_SALTI       QERLDTLEKVREAGIKVCSGGIVGLGETVTDRAGLLLQLANLPTPPESVPINMLVKVKGT
BIOB_SALHS       QERLDTLEKVREAGIKVCSGGIVGLGETVTDRAGLLLQLANLPTPPESVPINMLVKVKGT
BIOB_SALPA       QERLDTLEKVREAGIKVCSGGIVGLGETVTDRAGLLLQLANLPTPPESVPINMLVKVKGT
BIOB_SALDC       QERLDTLEKVREAGIKVCSGGIVGLGETVTDRAGLLLQLANLPTPPESVPINMLVKVKGT
BIOB_SALEP       QERLDTLEKVREAGIKVCSGGIVGLGETVTDRAGLLLQLANLPTPPESVPINMLVKVKGT
BIOB_SALSV       QERLDTLEKVREAGIKVCSGGIVGLGETVTDRAGLLLQLANLPTPPESVPINMLVKVKGT
BIOB_SALPK       QERLDTLEKVREAGIKVCSGGIVGLGETVTDRAGLLLQLANLPTPPESVPINMLVKVKGT
BIOB_SALG2       QERLDTLEKVREAGIKVCSGGIVGLGETVTDRAGLLLQLANLPTPPESVPINMLVKVKGT
BIOB_SALAR       QERLDTLEKVREAGIKVCSGGIVGLGETVNDRAGLLLQLANLPTPPESVPINMLVKVKGT
BIOB_CITK8       QERLDTLDKVREAGIKVCSGGIVGLGETVKDRAGLLLQLANLPTPPESVPINMLVKVKGT
BIOB_SHIB3       QERLDTLEKVRDAGIKVCSGGIVGLGETVKDRAGLLLQLANLPTPPESVPINMLVKVKGT
BIOB_SHIBS       QERLDTLEKVRDAGIKVCSGGIVGLGETVKDRAGLLLQLANLPTPPESVPINMLVKVKGT
BIOB_ECO81       QERLDTLEKVREAGIKVCSGGIVGLGETVKDRAGLLLQLANLPTPPESVPINMLVKVKGT
BIOB_ECOL6       QERLDTLEKVREAGIKVCSGGIVGLGETVKDRAGLLLQLANLPTPPESVPINMLVKVKGT
BIOB_ECOK1       QERLDTLEKVREAGIKVCSGGIVGLGETVKDRAGLLLQLANLPTPPESVPINMLVKVKGT
BIOB_ECOUT       QERLDTLEKVREAGIKVCSGGIVGLGETVKDRAGLLLQLANLPTPPESVPINMLVKVKGT
BIOB_ECO45       QERLDTLEKVREAGIKVCSGGIVGLGETVKDRAGLLLQLANLPTPPESVPINMLVKVKGT
BIOB_ECOL5       QERLDTLEKVREAGIKVCSGGIVGLGETVKDRAGLLLQLANLPTPPESVPINMLVKVKGT
BIOB_SHIF8       QERLDTLEKVRDAGIKVCSGGIVGLGETVKDRAGLLLQLANLPTPPESVPINMLVKVKGT
BIOB_SHIFL       QERLDTLEKVRDAGIKVCSGGIVGLGETVKDRAGLLLQLANLPTPPESVPINMLVKVKGT
BIOB_ECO57       QERLDTLEKVRDAGIKVCSGGIVGLGETVKDRAGLLLQLANLPTPPESVPINMLVKVKGT
BIOB_ECO5E       QERLDTLEKVRDAGIKVCSGGIVGLGETVKDRAGLLLQLANLPTPPESVPINMLVKVKGT
BIOB_SHISS       QERLDTLEKVRDAGIKVCSGGIVGLGETVKDRAGLLLQLANLPTPPESVPINMLVKVKGT
BIOB_ECOLI       QERLDTLEKVRDAGIKVCSGGIVGLGETVKDRAGLLLQLANLPTPPESVPINMLVKVKGT
BIOB_ECOSM       QERLDTLEKVRDAGIKVCSGGIVGLGETVKDRAGLLLQLANLPTPPESVPINMLVKVKGT
BIOB_ECOLU       QERLDTLEKVRDAGIKVCSGGIVGLGETVKDRAGLLLQLANLPTPPESVPINMLVKVKGT
BIOB_ECOLC       QERLDTLEKVRDAGIKVCSGGIVGLGETVKDRAGLLLQLANLPTPPESVPINMLVKVKGT
BIOB_ECOHS       QERLDTLEKVRDAGIKVCSGGIVGLGETVKDRAGLLLQLANLPTPPESVPINMLVKVKGT
BIOB_ECODH       QERLDTLEKVRDAGIKVCSGGIVGLGETVKDRAGLLLQLANLPTPPESVPINMLVKVKGT
BIOB_ECO8A       QERLDTLEKVRDAGIKVCSGGIVGLGETVKDRAGLLLQLANLPTPPESVPINMLVKVKGT
BIOB_ECO7I       QERLDTLEKVRDAGIKVCSGGIVGLGETVKDRAGLLLQLANLPTPPESVPINMLVKVKGT
BIOB_ECO55       QERLDTLEKVRDAGIKVCSGGIVGLGETVKDRAGLLLQLANLPTPPESVPINMLVKVKGT
BIOB_ECO27       QERLDTLEKVRDAGIKVCSGGIVGLGETVKDRAGLLLQLANLPTPPESVPINMLVKVKGT
BIOB_ECO24       QERLDTLEKVRDAGIKVCSGGIVGLGETVKDRAGLLLQLANLPTPPESVPINMLVKVKGT
BIOB_SHIDS       QERLDTLEKVRDAGIKVCSGGIVGLGETVKDRAGLLLQLANLPTPPESVPINMLVKVKGT
BIOB_ECOSE       QERLDTLEKVRDAGIKVCSGGIVGLGETVKDRAGLLLQLANLPTPPESVPINMLVKVEGT
BIOB_ESCF3       QERLDTLEKVRDAGIKVCSGGIVGLGETVKDRAGLLLQLANLPTPPESVPINMLVKVKGT
BIOB_CROS8       QERLDTLEKVREAGIKVCSGGIVGLGETVTDRAGLLLQLANLPTPPESVPINMLVKVKGT
BIOB_PHOLL       QDRLDTLDKVREAGIKVCSGGIVGLGEAIRDRAALLVQLANLPKPPESVPINMLVKVKGT
BIOB_PROMH       QDRLDTLDKVRNAGIKVCSGGILGLGEEVKDRAAMLVQLANLPQPPESVPINMLAKIKGT
BIOB_SODGM       QDRLDTLSKVRQAGIKVCSGGIVGLGEDIRDRAGLLVQLANLPTPPESVPINMLVKVKGT
BIOB_METI4       EDRLQTIRIVQKVGLKLCSGGIIGMGERLKDRLEMLFCLYSLPEAPESIPINVYMPIEGT
BIOB_BACSU       DDRVNTVEIAKESGLSPCSGAIIGMKETKQDVIDIAKSLKALD--ADSIPVNFLHAIDGT
BIOB_BACNA       DDRVNTVEIAKESGLSPCSGAIIGIKETKQDVIDIAKSLKALD--ADSIPVNFLHAIDGT
BIOB_BACVZ       DDRVNTVETAKQSGMSPCSGVIVGMKETKQDVIDMANSLKALD--ADSIPVNFLHAIDGT
BIOB_BACAM       DDRVNTVETAKQSGMSPCSGVIVGMKETKQDVIDMANSLKALD--ADSIPVNFLHAIDGT
BIOB_BACLD       DDRVNTVETAKKSGMSPCSGVIVGMKETKQDVVDMAKSLKALD--ADSIPVNFLHAIDGT
BIOB_BACHD       EDRVNTVEVVKHSGISPCSGVIVGMKETKEDVVDMAFQLRELD--ADSIPVNFLHAIDGT
BIOB_GEOKA       DDRVRTVETVKEAGLSPCSGVIIGMKETKRDVVDMARSLRALD--ADSIPVNFLHAIDGT
BIOB_GEOTN       DDRVRTVETVKEAGLSPCSGVIIGMKETKQDIVDMARSLRELD--ADSIPVNFLHAIDGT
BIOB_ANOFW       DDRVRTVETVKEAGMSPCSGVIIGMKETKQDVIAMARSLKALD--ADSIPVNFLHAIDGT
BIOB_LYSSH       EDRVNTVEVVKKHGISPCSGAIIGMKETKMDVVEIARALHQLD--ADSIPVNFLHAIDGT
BIOB_LYSSC       EDRVNTVEIVKKHGISPCSGAIIGMKETKEDVVNIARALHQLD--ADSIPVNFLNAIDGT
BIOB_BACAN       DDRVDTVQKAKQAGISPCSGAIFGMGETIEERAEIAFELQRID--ADSIPCNFLVAVKGT
BIOB_BACC0       DDRVDTVQKAKQAGISPCSGAIFGMGETIEERAEIAFELQRID--ADSIPCNFLVAVKGT
BIOB_BACCZ       DDRVDTVQKAKQAGISPCSGAIFGMGETIEERAEIAFELQRID--ADSIPCNFLVAVKGT
BIOB_BACHK       DDRVDTVQKAKQAGISPCSGAIFGMGETIEERAEIAFELQRID--ADSIPCNFLVAVKGT
BIOB_BACAH       DDRVDTVQKAKQAGISPCSGAIFGMGETIEERAEIAFELQRID--ADSIPCNFLVAVKGT
BIOB_BACC7       DDRVDTVQKAKQAGISPCSGAIFGMGETIEERAEIAFELQRID--ADSIPCNFLVAVKGT
BIOB_BACCQ       DDRVDTVQKAKQAGISPCSGAIFGMGETIEERAEIAFELQRID--ADSIPCNFLVAVKGT
BIOB_BACC1       DDRVDTVQKAKQAGISPCSGAIFGMGETIEERAEIAFELQRID--ADSIPCNFLVAVKGT
BIOB_BACC2       DDRVDTVQKAKQAGISPCSGAIFGMGETIEERAEIAFELQRID--ADSIPCNFLVAVKGT
BIOB_BACC4       DDRVDTVQKAKQAGISPCSGAIFGMGETIEERAEIAFELQRID--ADSIPCNFLVAVKGT
BIOB_BACCR       DDRVDTVQKAKQAGISPCSGAIFGMGETIEERAEIAFELQRID--ADSIPCNFLVAVKGT
BIOB_BACMK       DDRVDTVQKAKQAGISPCSGAIFGMGETIEQRAEIAFELQRLD--ADSIPCNFLVAVKGT
BIOB_BACCN       DDRVDTVEKVKQAGISPCSGAIFGMGETKEERVEIAFELQRLD--ADSIPCNFLVSVKGT
BIOB_BACP2       HDRLSTLKKVKQSGMSPCSGVIIGMGETNQQIVEMAFALRAID--ADSIPVNFLHAIEGT
BIOB_STAAM       KDRTDTIELMKANNISPCSGVICGMGESNQDIVDMAFALKEMD--ADSIPINFLHPIKGT
BIOB_STAAN       KDRTDTIELMKANNISPCSGVICGMGESNQDIVDMAFALKEMD--ADSIPINFLHPIKGT
BIOB_STAAS       KDRTDTIELMKANNISPCSGVICGMGESNQDIVDMAFALKEMD--ADSIPINFLHPIKGT
BIOB_STAA9       KDRTDTIELMKANNISPCSGVICGMGESNQDIVDMAFALKEMD--ADSIPINFLHPIKGT
BIOB_STAAB       KDRTDTIELMKANNISPCSGVICGMGESNQDIVDMAFALKEMD--ADSIPINFLHPIKGT
BIOB_STAAW       KDRTDTIELMKANNISPCSGVICGMGESNQDIVDMAFALKEMD--ADSIPINFLHPIKGT
BIOB_STAA1       KDRTDTIELMKANNISPCSGVICGMGESNQDIVDMAFALKEMD--ADSIPINFLHPIKGT
BIOB_STAA2       KDRTDTIELMKANNISPCSGVICGMGESNQDIVDMAFALKEMD--ADSIPINFLHPIKGT
BIOB_STAAR       KDRTDTIELMKANNISPCSGVICGMGESNQDIVDMAFALKEMD--ADSIPINFLHPIKGT
BIOB_STAAC       KDRTDTIELMKANNISPCSGVICGMGESNQDIVDMAFALKEMD--ADSIPINFLHPIKGT
BIOB_STAAT       KDRTDTIELMKANNISPCSGVICGMGESNQDIVDMAFALKEMD--ADSIPINFLHPIKGT
BIOB_STAA8       KDRTDTIELMKANNISPCSGVICGMGESNQDIVDMAFALKEMD--ADSIPINFLHPIKGT
BIOB_STAAE       KDRTDTIELMKANNISPCSGVICGMGESNQDIVDMAFALKEMD--ADSIPINFLHPIKGT
BIOB_STAA3       KDRTDTIELMKANNISPCSGVICGMGESNQDIVDMAFALKEMD--ADSIPINFLHPIKGT
BIOB_STAEQ       EDRVNTVEMMKDNNISPCSGVICGMGESNEDIIDMAFALRAID--ADSIPINFLHPIKGT
BIOB_STAES       EDRVNTVEMMKDNNISPCSGVICGMGESNEDIIDMAFALRAID--ADSIPINFLHPIKGT
BIOB_STAHJ       EDRVRTVEIMKANHISPCSGVICGMGETNEDIIDMAFALREID--ADSIPINFLHPIKGT
BIOB_STACT       EDRVKTVEIMKENNISPCSGVICGMGETAQDRIDMAFALKELD--ADSIPINFLHPIQGT
BIOB_MACCJ       QDRVDTIEIMKANNISPCSGVICGMGETDEDIIDMALALRAID--ADSIPVNFLHPVKGT
BIOB_RHOBA       EDRVQTLRHVRDAGMEMCSGGIIGMGESKSDIVSMAFDLNELG--VQSIPVNILNAIDGT
BIOB_THEEB       RDRDQTLANIQAAGITTCSGGILGMGESDDDVIDLALFLRQRQ--VTSVPVNFLIPIPGT
BIOB_SALRD       SDRVETVKQAKAAGMEACCGGIIGLGEARADWVDLALALREIG--VESVPVNFLNPRSGT
BIOB_STRAW       ADRVETVQKAHAAGLSACSGLIAGMGETDEDLVDVVYSLRELD--PDSVPVNFLIPFEGT
BIOB_STRCO       ADRVDTVNKAHAAGLSACSGLIAGMGESDEDLVDVVFSLRELD--PDSVPVNFLIPMEGT
BIOB_STRGG       ADRVETVQQAQAAGLSACSGLIAGMGESDKDLVDVVFALRDLD--PDSVPVNFLIPFEGT
BIOB2_FRACC      NDRVDTVQEARHAGLSPCSGIIAGMGESDEDLVDVAFALRELA--PDSIPVNFLMPFEGT
BIOB_NOCSJ       SDRVDTIEKAAAAGLSPCSGLIAGLGETDEQLVEALFALKALG--ADSIPVNFLMPFDGT
BIOB_SACEN       ADRVDTVEKAKGGGLSPCSGLIAGLGETDEQLVEALFALRELG--SDSIPVNFLMPFDGT
BIOB_KOCRD       QDRVDTVERAKDAGLSPCSGLIVGMRETDEQLVEAVFALRDLG--SDSVPVNFLMPFEGT
BIOB_RENSM       SDRTNTVKAAKAAGLSPCSGLIVGMGESDEELIDALFALRELG--SESVPVNFLMPFEGT
BIOB_CUTAK       EDRMDTVEVLKRNGLSPCSGVIAGMGETDEEFVDVIFDLRKHG--VDSVPVNFLLPFEGT
BIOB_ACAM1       QDRINTLKAARSAGLDLCSGMIAGMGETDQDIVDIAYQLHEYQ--VPSIPINFLIPISGN
BIOB_MAGMM       GDRLNTLQEARRAGLEVCSGIIIGMGEKPEEIVEVATTLRSLQ--ARSIPVNFYVHVEGA
BIOB_LEPBA       KDRLTTLEAAKEAEIGLCSGIIVGMGEELKDIVQVAFELKRLG--VISIPVNFFIPIKGH
BIOB_LEPBP       KDRLTTLEAAKEAEIGLCSGIIVGMGEELKDIVQVAFELKRLG--VISIPVNFFIPIKGH
BIOB_LEPBJ       AQRTQTLDSVSKAGIGMCSGVIVGMGESFQDIVDMAFELKSFR--VISIPVNFFIPVKGH
BIOB_LEPBL       AQRTQTLDSVSKAGIGMCSGVIVGMGESFQDIVDMAFELKSFR--VISIPVNFFIPVKGH
BIOB_LEPIC       LQRAQTLDSVSKAGIGMCSGVIVGMGESFQDIVDVAFQLKSFR--VISIPVNFFIPVKGH
BIOB_LEPIN       LQRTQTLDSVSKAGIGMCSGVIVGMGESFQDIVDVAFQLKSFR--VISIPVNFFIPVKGH
BIOB_THET2       QDRLWTLKRAREAGLKLCSGVILGMGEGPKEVYEMALALRELG--VESLPVNFLLPIPGT
BIOB_THET8       QDRLWTLKRAREAGLKLCSGVILGMGEGPKEVYEMALALRELG--VESLPVNFLLPIPGT
BIOB_STRA1       KDRCDTLERIHNEDIDVCSGFICGMGESDEGLITLAFRLKELD--PYSIPVNFLLAVEGT
BIOB_STRA5       KDRCDTLERIHNEDIDVCSGFICGMGESDEGLITLAFRLKELD--PYSIPVNFLLAVEGT
BIOB_STRA3       KDRCDTLERIHNEDIDVCSGFICGMGESDEGLITLAFRLKELN--PYSIPVNFLLAVEGT
BIOB_CORGL       EERRETLRLVAEAGMEVCSGGILGMGETLEQRAEFAVQLAELD--PHEVPMNFLDPRPGT
BIOB_CORGB       EERRETLRLVAEAGMEVCSGGILGMGETLEQRAEFAVQLAELD--PHEVPMNFLDPRPGT
BIOB_COREF       EERRETLRLVAEAGMEVCSGGILGMGETLEQRAEFAVQLAELN--PTEVPINFLDPRPGT
BIOB1_CORDI      ESRRETLRMVGEAGMEVCSGGIIGMGETLEQRAEFACDLAELN--PTEVPMNFLDPRPGT
BIOB_CORU7       EERYETLKMVKESGMEVCCGGILGMGETREQRAEFAAELASLE--PHEVPMNFLDPRPGT
BIOB_CORJK       EERTSTLEMVRDAGMEVCCGGIVGMGETVEQRAEFAIDLQNLD--PTEVPLNFFDPRPGT
BIOB_MYCBO       EERWQTLSMVRDAGMEVCCGGILGMGETLQQRAEFAAELAELG--PDEVPLNFLNPRPGT
BIOB_MYCTU       EERWQTLSMVRDAGMEVCCGGILGMGETLQQRAEFAAELAELG--PDEVPLNFLNPRPGT
BIOB_MYCTA       EERWQTLSMVRDAGMEVCCGGILGMGETLQQRAEFAAELAELG--PDEVPLNFLNPRPGT
BIOB_MYCTF       EERWQTLSMVRDAGMEVCCGGILGMGETLQQRAEFAAELAELG--PDEVPLNFLNPRPGT
BIOB_MYCBP       EERWQTLSMVRDAGMEVCCGGILGMGETLQQRAEFAAELAELG--PDEVPLNFLNPRPGT
BIOB_MYCMM       EERWQTLTMVRDAGMEVCCGGILGMGETLEQRAEFAANLAELD--PDEVPLNFLNPRPGT
BIOB_MYCUA       EERWQTLTMVRDAGMEVCCGGILGMGETLEQRAEFAANLAELD--PDEVPLNFLNPRPGT
BIOB_MYCA1       EERWDTLSMVRDAGMEVCCGGILGMGETLEQRAEFAAELAELG--PDEVPLNFLNPRPGT
BIOB_MYCPA       EERWDTLSMVRDAGMEVCCGGILGMGETLEQRAEFAAELAELG--PDEVPLNFLNPRPGT
BIOB_MYCLE       EERWQTLSMVRDAGMEVCCGGILGMGETVEQRAEFALELAELG--PDEVPLNFLNPRPGT
BIOB_MYCLB       EERWQTLSMVRDAGMEVCCGGILGMGETVEQRAEFALELAELG--PDEVPLNFLNPRPGT
BIOB_MYCGI       EERWETLQMVREAGMEVCCGGILGMGESLGQRAEFAANLAELD--PHEVPLNFLNPRPGT
BIOB_MYCVP       EERWDTLQMVREAGMEVCCGGILGMGETLEQRAEFAANLAELD--PHEVPLNFLNPRPGT
BIOB_MYCSJ       EERWDTLRMVREAGMEVCCGGILGMGETLEQRAEFAANLAELD--PHEVPLNFLNPRPGT
BIOB_MYCSK       EERWDTLRMVREAGMEVCCGGILGMGETLEQRAEFAANLAELD--PHEVPLNFLNPRPGT
BIOB_MYCSS       EERWDTLRMVREAGMEVCCGGILGMGETLEQRAEFAANLAELD--PHEVPLNFLNPRPGT
BIOB_MYCS2       EERWDTLNMVREAGMEVCCGGILGMGETLEQRAEFAANLAELN--PHEVPLNFLNPRPGT
BIOB_MYCA9       EERWDTLKMVREAGMEVCCGGILGMGETLEQRAEFAANLAELE--PDEVPLNFLNPRPGT
BIOB_NOCFA       EERWDTLRMVREAGMEVCCGGILGMGETLEQRAEFAAQLAELE--PDEVPLNFLNPRPGT
BIOB_RHOJR       DERWNTLRMVREAGMEVCCGGILGMGESLEQRAEFAANLAELE--PDEVPLNFLNPRPGT
BIOB_FRAAA       EERWETCEMVRAAGMELCCGAILGVGESLEQRAELAAQLAVLE--PDEVPLNFLNPRPGT
BIOB1_FRACC      EERWETCEMVRAAGMELCCGAILGVGESLEQRAELATQLAALE--PDEVPLNFLNPRPGT
BIOB_FRASN       EERWETCELVRAAGMELCCGAIIGVGESLEQRAELAAQLAALE--PDEVPLNFLNPRPGT
BIOB_SALAI       EERWETLRMVRASGMEVCCGGILGLGETVEQRAEFAAQLAELD--PHEVPLNFLNPRPGT
BIOB_SALTO       EERWETLRMVRESGMEVCCGGILGLGESVEQRAEFAAQLAELD--PHEVPLNFLNPRPGT
BIOB_PSECP       EERLETCAMVKAAGMELCCGALLGMGESLHQRAELAAQLAALE--PHEVPLNFLNPRPGT
BIOB_ARTS2       EERLETCNMVKAAGMELCCGALIGMGETLEQRAELAAQLAALE--PHEVPLNFLNPRPGT
BIOB_PAEAT       EERLETCAMVKAAGMELCCGALIGMGESLAQRAELAAQLAALE--PHEVPLNFLNPRPGT
BIOB_ACIC1       EERWQTLQLVRAAGMEVCCGGILGMGESLDQRAEFAAQLADLD--PDEVPLNFLDPRPGT
BIOB_CENSY       EDRLDTLEIAREAGLELCTGGIIGMGESRGQRIELAMELARIR--PEEATVNILVPVQGT
BIOB_NITMS       EDRLETLGIARDAGLELCTGGIIGLGETREQRLELTLELARLY--PEEVTINILVPVPGT
BIOB_HELPY       EERFITCENALRAGLGLCSGGIFGLNESWEDRIEMLRALASLS--PHTTPINFFIKNPVL
BIOB_HELPH       EERFITCENALRAGLGLCSGGIFGLNESWEDRIEMLRALASLS--PHTTPINFFIKNPVL
BIOB_HELPS       EERFITCENALRAGLGLCSGGIFGLNESWEDRIEMLRALASLS--PHTTPINFFIKNPVL
BIOB_HELPG       EERFITCENALRAGLGLCSGGIFGLNESWEDRIEMLRALASLS--PHTTPINFFIKNPVL
BIOB_HELPJ       EERFITCENALRAGLGLCSGGIFGLNESWEDRIEMLRALASLS--PHTTPINFFIKNPVL
BIOB_HELP2       EERFITCENALRAGLGLCSGGIFGLNESWEDRIEMLRALASLS--PHTTPINFFIKNPVL
BIOB_HELAH       EERFITCENALRAGLGLCSGGIFGLNESWEDRIEMLRALASLS--PHTTPINFFIKNPVL
BIOB_HELHP       KERFETCENTLKAELGLLSGGIFGLGESWGDRIELLKHLQILS--PHTSPLNFYIANESL
BIOB_WOLSU       EERYETCESALEVGLGLCTGGIFGLGEGWSERLEFLHALQTLS--PHSVPVNFYIPNPSL
BIOB_ARCB4       DDRYETCLNAKKAGLYLCTGGIFGLGETQENRISMLKSIASLE--PMSVPINFFHPNDAL
BIOB_NITSB       EERYQTCLNAKEAGLNLCTGGIFGLGESKEQREEMMDQIASLE--PMSVPINFYHPNEAL
BIOB_NAUPA       DERFETCENIKSVGLQLCCGGIFGMGESNEDIESFIRSLKELK--PNGIPLNFFIENEKL
BIOB_CAMC1       DERYQTNLDAKRAGLMLCTGGIYGVGESEADRVSFRASLKELE--PFSSPINFFIRSDAL
BIOB_CAMC5       DERWQTNLDAKATGLQLCCGGIYGIGESKTDRASFRTSLKELA--PFSSPINFFIANPAL
BIOB_CAMFF       DDRFNTNLNAKKAGLELCCGGIYGLGESQDDRLSFRASLKELN--PFSSPINFFIPNPAL
BIOB_CAMJ8       ESRFQTNLNAKEAGLMLCCGGIYGMGESEEDRLSFRKSLQELQ--PFSTPINFFIANENL
BIOB_CAMJJ       ESRFQTNLNAKEAGLMLCCGGIYGMGESEEDRLSFRKSLQELQ--PFSTPINFFIANENL
BIOB_CAMJE       ESRFQTNLNAKEAGLMLCCGGIYGMGESEEDRLSFRKSLQELQ--PFSTPINFFIANENL
BIOB_CAMJR       ESRFQTNLNAKEAGLMLCCGGIYGMGESEEDRLSFRKSLQELQ--PFSTPINFFIANENL
BIOB_CAMJD       ESRFQTNLNAKEAGLMLCCGGIYGMGESEENRLSFRKSLQELQ--PFSTPINFFIANENL
BIOB_CAMLR       EQRFQTNLYAKEVGLMLCCGGIYGLGESEADRKSFRASLKELD--PFSSPINFFIPNENL
BIOB_SULDN       DERYETCQNINNAGLVLISGGIFGLGEREEDRVSMLKSLDSLK--PTSVPINFYHHNEAL
BIOB_SULNB       QERYETCENVKSSGLALCSGGIFGMGESMKDREDLLSAIASLQ--PESTPLNFYHPNPAL
BIOB_METM6       NDKVKVILEAKKIGLEMCSGGIFGMGESIEDRVDLFLDLKKLG--VDSVALNLLNPIYGT
BIOB_METMP       SEKIKVILEAKKIGLEMCSGGIFGMGETIEDRVDLFLDLKKLG--VDSVALNLLNPIYGT
BIOB_METM5       NDKIKVILEAKKIGLEMCSGGIFGMGESIDDRINLFLDLKKLG--VDSIALNLLNPIYGT
BIOB_METM7       IDKIKVILEAKKMGLEMCSGGIFGMGESVADRVDLLLDLKKLD--VDSVALNLLNPICGT
BIOB_METVS       EDKVDVIKNGKKLGLQICSGGIFGLGEDIIDRIDLLYELKELN--VDSISLNLLNPIEGT
BIOB_META3       DDKVKSITMAKKIGLEVCSGGIIGLGESLENRINLFYELKELD--VEGIPINIYNPIKGT
BIOB_METJA       EDKVKVIKEAKKLDLEVCSGGIFGLGESVEERIKMAFELKELG--VDSVPINILHPIEGT
BIOB_CALBD       QQKIETLKIAKEAGLQICSGGIISMGEDMIERIKLAFELRELD--VDSVPINILNPIKGT
BIOB_CALS8       AQKIETLKIAKETGLEICSGGIISMGEDMIERIKLAFELRELK--VDSVPINILNPIKGT
BIOB_AQUAE       EDRYETIKRIKKVGLSTCSGGIFGMGESNEDRVDMALTYRELE--VDSIPLNFLMPIEGT
BIOB_HYDS0       KERLETIKNVQKAGLSTCSGVIFGLGETDEDRVDLAFVYKELG--VDSIPLNFLMPIPNT
BIOB_PERMH       KERLETIKTVQKVGLSTCTGGIFGIGETDEDIVDLASVYRELN--VNSIPMNFLIPIPGT
BIOB_SULSY       KERYKTIKKIQKVGLSTCTGGIFGMGESDEDIIDLAMTYRDLE--VDSIPLNFLIPIPGT
BIOB_UNCTG       QERVDTIKRAKKFGFEICSGGLFGMGESLKDRIDLAFTLKALD--ANSIPMNFLMHIKGT
BIOB_THENN       YDRVKTVENAKSIGLEVCSGGIFGVGESFEDRLELARILKDLE--VDSVPINFLIPIKGT
BIOB_THEP1       YDRVKTVENAKNVELEVCSGGIFGVGENFDDRLELAKILKDLE--VDSVPINFLIPIRGT
BIOB_THEYD       SDKVKTLENANKTGLSICSGGVFGIGESWDDRKEMAEFLKNLN--VDSIPINFLTPIKGT
BIOB_DESDA       DQRKATVERVFGAGMTACTGGLFGLGESWRDRIDFAFALKSLG--VTHVPMNFLHPHPET
BIOB_ALKMQ       KDKINAIKLAQRLGFKVCSGGIIGMGETFEDRLDMAVSLAELK--IQSIPINTLMPIKGT
BIOB_CLOB8       DDKIKEIKLAQNAGLKVCSGGIIGMGETWYDRIDMAISLSELG--VISIPINVLMPIKGT
BIOB_CLOB1       DDKIETIKNAKKAGIEICSGGIIGLGETMEDRIDMAFTLRELS--VESVPVNILNPIKGT
BIOB_CLOBH       DDKIETIKNAKKAGIEICSGGIIGLGETMEDRIDMAFTLRELS--VESVPVNILNPIKGT
BIOB_CLOBK       DDKIETIKNAKKAGFEICSGGIIGLGETMEDRIDMAFTLRELS--VESVPVNILNPIKGT
BIOB_CLOBL       DDKIETIKNAKKAGLEICSGGIIGLGETMEDRIDMAFTLRELS--VESVPVNILNPIKGT
BIOB_CLOBM       NDKIETIKNAKKAGLEICSGGIIGLGETMEDRIDMAFTLRELS--VESVPVNILNPIKGT
BIOB_CLOBA       DEKINTIKNALKAGLQVCSGGIIGLGETMEDRIDMAFTLRELN--VDSIPINILNPIKGT
BIOB_CLOBB       DEKTHTIKNALKAGLQVCSGGIIGLGETMEDRIDMAFTLRELN--VDSIPINILNPIKGT
BIOB_BRAHW       DDKINAIKAAQKAGMVVCSGGIMGMGETWEDRIDMAIELRELG--IMSIPVNMLNPIAST
BIOB_AKKM8       DDKLQTIKWALEAGLEVCSGGIMGLGETMEDRIDMYMDIAALG--IKSMPVNFLTPIPGT
BIOB2_CORDI      DDKIATLQAARDEGMSLCSGGILGLGESMEDRIDMALSARELG--VNSFPVNVLVAIEGT
BIOB_CAMHC       DDRINTIKSALCVGLDVCSGGIFGLGESLKDRIDMAYELKNLK--VSSVPINILTPIKGT
BIOB_FUSNN       DDRINTIKNAKAVGLDVCSGGIFGLGETIEDRIDMALDLRALE--IHSVPINVLTPIPGT
BIOB_CLOD6       KDRIKTIKDAKKAGLDVCVGGIIGMNESEEQRLKMAFEIRELN--VKSFPINILNPIKNT
BIOB_HUNT2       DDRINTVKNAAKAGLEICCGGIIGMGESMEQRIKMAFEIRELG--VKSVPINVLNPIKGT
BIOB_CLOK1       DERIDTINAVKKAGLQVCSGGIIGLGESFEDRVRLAFQLKELE--AKSIPINVLNPVKGT
BIOB_CLOTE       DERIETINNAKKAGLMVCSGGIIGMGETITDRIKLAFELKSLQ--IQSIPINILNPVKGT
BIOB_CLONN       DERIQTIKNAKGVGLDVCSGGIIGLGESFIDRINLAFELKNLK--IRSIPINILMPIGGT
BIOB_CLOP1       EERVKTIKNAKEAGLEVCSGGIIGLGETIIDRIDLAITLRELE--IKSIPINVLSAIKGT
BIOB_CLOPE       EERVKTIKNAKEAGLEVCSGGIIGLGETILDRIDLAITLRELE--IKSIPINVLSAIKGT
BIOB_PORG3       EEKLATIRAARRVGMRVCSGGIIGMGETMEQRIEFAFFLHSIN--VYSIPINILQPIPGT
BIOB_PORGI       DEKLATIRAARRVGMRVCSGGIIGMGETMEQRIEFAFYLHSIN--VYSIPINILQPIPGT
BIOB_PARD8       EQKMETIHTAREIGFRICCGGIIGMGETMKERIEMACFLQKEG--VLSIPLNLLQPIPGT
BIOB_CROS5       GDRVETVKNLKKAGIQACTGGIMGMGETWEDRVDLAISLRELE--VDSVPINLLNPREGT
BIOB_RIPO1       RDRVETIKNLKAAGIQACSGGIMGMGETWEDRVDLALALRELG--VESVPINLLNPREGT
BIOB_GLOC7       ADRVETVKNLKAAGIQACTGGIIGMGESWEDRIDLALSLRDLE--VDSVPINLLNPRQGT
BIOB_MICAN       QDRVETVKNLKAAGIQACTGGIIGMGESWTDRIDLAFSLAELE--VESVPINLLNPRSGT
BIOB_TRIEI       NDRVETVKNLKAAGIQACTGGIIGMGETWADRIDLALALRELE--VESVPLNLLNSREGT
BIOB_SYNY3       QDRVDTVKNLKAAGIQACTGGILGMGETWEDRIDLALALRELE--VESVPLNLLNPRPGT
BIOB_CYAP4       RDRVETIKTLKAAGIQACTGGILGLGESWQDRVDLALALRELE--VESVPLNLLNPRAGT
BIOB_SYNP2       QDRVETIKNLKAAGIQACSGGIMGLGESWEDRVDLAIALRDLE--VESVPLNLLNPRQGT
BIOB_CARHZ       DERIETIKNVKKAGMEVCCGGIIGMGETMEQRIEFAFTLKELD--VDAIPINVLNPIKGT
BIOB_CLOAB       DERIKTINYAKNAKMEVCSGMIVGLGETMEQRIEHALLLRDLN--VDAVPVNILNPVKGT
BIOB_DESAP       EDRVATIRAAQKVGLEVCAGGIIGLGEKPEQRVELALALRELG--VTSVPVNILHPVPGT
BIOB_PELTS       DERVETVKAAKEAGLEVCSGGIIGLGESWRHRVEMAFHLKELG--VASVPINILTPVKGT
BIOB_HELMI       DERIATIRAAQAAGMVVCSGGIFSMGETIDDRIDMAFELRELG--IRSVPINILNPIAGT
BIOB_DESPS       QDKVATIEHARRAGLEVCSGGIIGLGESMEQRIELAFELRDLE--VLSIPLNILNPIANT
BIOB_DESRM       QQRVATIKSAQSAGLKICSGGIISLGETMLQRLELAYELKALG--VDSVPINVLNPILGT
BIOB_ANAD2       DEQLETIRAAKGLGLKLCSGGILGMGETPEQRVEFAEEVRDLG--VDCVPVNFLNPRAGT
BIOB_ANASK       DEQLETIRAAKGLGLKLCSGGILGMGETPEQRVEFAEEVRDLG--VDCVPVNFLNPRAGT
BIOB_ANADE       DEQLETIRAAKGLGLKLCSGGILGMGETPEQRVEFAEEVRDLG--VDCVPVNFLNPRAGT
BIOB_ANADF       DEQLETIRAAKRQGLKLCSGGILGMGETPEQRVELAATIRELG--IDCVPMNFLNPRPGT
BIOB_DESVH       DDDIATVRAARAAGLRTCSGGIFGMGETDAQRIELSATLRELD--VDSIPVNLLSPIPGT
BIOB_DESVV       DDDIATVRAARAAGLRTCSGGIFGMGETDAQRIELSATLRELD--VDSIPVNLLSPIPGT
BIOB_DESVM       DDDIATVREAARAGLRTCCGGILGLGETWEHRVELALTLRELD--VDSIPLNFLHPVPGT
BIOB_DESAG       DEDIYTVKLAREAGLAVCCGGILGLGESRAQRAELSGQIKRCR--ADSVPVNLLTPVAGT
BIOB_GEOMG       EEDVETVRVAKQAGLTICCGGIFGLGETAAQRVELAMTLRELD--VDSVPLNFLNPIEGT
BIOB_GEOSL       EEDVETVRVAKRAGLKVCCGGIFGLGETPEQRVEMALTLRELD--VDSIPLNFLNPIEGT
BIOB_GEODF       EEDVNTVRVAKKAGLKVCCGGIFGLGESVAQRIEMAYTLRELD--VDSVPLNFLNPIAGT
BIOB_GEOUR       EEDVETVRVARKAGMKVCCGGIFGLGESIPQRVEMALTLRELD--VDSVPLNFLNPIPGT
BIOB_GEOBB       QDDVNTVRAVKKAGVKVCCGGIFGLGESAAQRVEMALTLKDLD--VDSVPMNFLNPIEGT
BIOB_PELPD       EQDVETIRAVKRAGVRVCCGGIFGLGESFGQRIEMTETLRELD--VDSVPLNFLNPVEGT
BIOB_GEOLS       DDDVATVQLAKQVGLRVCCGGLFGLGETMAQRVELALTLRELQ--VDSVPINFLDPVPGT
BIOB_PELCD       DQDLETVRVAKAAGMKVCCGGLFGLGETPEQRLELGLTLRELD--IDSVPINFLNPVAGT
BIOB_SYNAS       EEDIETLLIARKAGLRLCSGGIFGLGESWEQRVEMAFTLRELD--VDSIPINFLNPLPGT
BIOB_DESAL       GDRVKTIREAKKAGMSVCAGGLFGIGESDLQVLELGLALRDLE--VDSVPVNFLIPIKGT
BIOB_DESOH       EERVQTVKAAKAAGLSVCCGGIFGLGETDDQVAELAFALRDLD--VDSVPVNFLVPIKGT
BIOB_SYNFM       AQRLDTVRAVREVGLEVCCGGILGLGESLEQRVEFAALLAREE--VDCIPLNFLVPIPGT
BIOB_CHLCH       EERIATIHRLRQHNIAVCCGGIIGVGESVEERIGLLIALQALD--LAVIPLNVLVPIAGT
BIOB_PELPB       EERIETIKLLRKNNISVCCGGIMGVGETMQERIAMIFALQELD--VSVIPLNVLVPIEGT
BIOB_CHLP8       DERIDTIRRLRAHGIAVCCGGIIGTGETMQERIGMIFALQKLD--VTVIPLNVLVPIDGT
BIOB_CHLTE       NERIGTIRRLRSNGIGVCCGGILGVGETMQERIGMIFALRDLD--VTVIPLNVLVPIDGT
BIOB_CHLL2       VERIATVRLLRKHRIPVCCGGILGVGESMTERLEMIFALSELD--VSVIPLNVLVPIDGT
BIOB_PELLD       EERMETVRLLRRNGVSVCCGGIIGVGEHMEDRVEMMFALRELD--VSVIPINVLVPIKGT
BIOB_CHLPM       EERMETVRLLRREGVNVCCGGIIGVGESMEDRVAMLFALRDLD--VSVIPINVLVPIEGT
BIOB_CHLPD       DDRIDTIKRLRRNNIDVCCGGIIGVGEQMKERVEMIFAFADLD--VSVIPLNILVPIDGT
BIOB_CHLPB       KDRIDTIRLLRKYGIPVCCGGILGVGETMRERLDFIYALQELD--IAVIPLNVLVPIEGT
BIOB_PROA2       NDRIETIRLLRKHRIAVCCGAILGVGETMQERIDLIFVLQALD--VAVIPLNVLVPVDGT
BIOB_NATPD       DDRLKTLHRAKAAGMDLCAGVILGMGETPADRVDAAIELQEVG--VSSLPVNILNPVEGT
                  .            .    * : .  *                      . :        

BIOB_FRAT1       PLGDKYTNAQ---IDSFELVRFIATTRILFPQA-RLRLSAGRENMSLETQTLC---FLAG
BIOB_FRATT       PLGDKYTNAQ---IDSFELVRFIATTRILFPQA-RLRLSAGRENMSLETQTLC---FLAG
BIOB_FRATN       PLGDKYTNAQ---IDSFELVRFIATTRILFPQA-RLRLSAGRENMSLETQTLC---FLAG
BIOB_FRATW       PLGDKYTNAQ---IDSFELVRFIATTRILFPQA-RLRLSAGRENMSLETQTLC---FLAG
BIOB_FRATM       PLGDKYTNAQ---IDSFELVKFIATTRILFPQA-RLRLSAGRENMSLETQTLC---FLAG
BIOB_FRATF       PLGDKYTNAQ---IDSFELVRFIATTRILFPQA-RLRLSAGRENMSLETQTLC---FLAG
BIOB_FRATH       PLGDKYTNAQ---IDSFELVRFIATTRILFPQA-RLRLSAGRENMSLETQTLC---FLAG
BIOB_FRATO       PLGDKYTNAQ---IDSFELVRFIATTRILFPQA-RLRLSAGRENMSLETQTLC---FLAG
BIOB_FRAP2       PLGDKYTDAQ---IDSFELVRFIATTRILFPQA-RLRLSAGRENMSLETQTLC---FLAG
BIOB_COXB1       PLENTKA------IDPFEFIKTIAITRLLFPTS-VIRLSAGREAMSDELQAWC---FMAG
BIOB_COXB2       PLENTKA------IDPFEFIKTIAITRLLFPTS-VIRLSAGREAMSDELQAWC---FMAG
BIOB_COXBN       PLENTKA------IDPFEFIKTIAITRLLFPTS-VIRLSAGREAMSDELQAWC---FMAG
BIOB_COXBR       PLENTKA------IDPFEFIKTIAITRLLFPTS-VIRLSAGREAMSDELQAWC---FMAG
BIOB_COXBU       PLENTKA------IDPFEFIKTIAITRLLFPTS-VIRLSAGREAMSDELQAWC---FMAG
BIOB_LAWIP       PLNPQSD------IDPFDFVRIIALTRILMPKS-YIRLAAGREQMSDELQTLC---FMGG
BIOB_RICFE       PLENVQD------IDPFDFVRVIALARIMIPKS-YIRLSAGREQMSDELQALC---IMAG
BIOB_NEOSM       PLAEKNA------VDPLDFVRIIALARIMFPKS-YVRLSAGRESMSDELQTLC---FIAG
BIOB_ANAMF       PMEGNPK------IDNIDFVRTIAVARIMMPAS-YVRLAAGRGEMSEEMQALC---MLAG
BIOB_ANAMM       PMEGNPK------IDNIDFVRTIAVARIMMPAS-YVRLAAGRGEMSEEMQALC---MLAG
BIOB_ANAPZ       PLEGAKK------VNSVDFVRTIAVARIMMPAS-YVRLAAGRSDMTEEMHALC---FFAG
BIOB_EHRCJ       PFENNAK------IDNIDFIKTIAVARILMPKS-YIRLAAGRMSMSEEMQALC---LFAG
BIOB_EHRCR       PFENNIK------VDNIDFIKTIAVTRILMPKS-YVRLAAGRKDMSEEMQALC---LFAG
BIOB_EHRRG       PFENNPK------ISNIDFIRTIAVARILMPES-YVRLAAGRESMSHEMQALC---LFAG
BIOB_EHRRW       PFENNPK------ISNIDFIRTIAVARILMPES-YVRLAAGRESMSHEMQALC---LFAG
BIOB_AGRRK       PLAK-RPV-----IAPLELVRMVATARLVMPAS-TVRLSAGRSNLNREAQILC---LVAG
BIOB_AGRVS       PLAA-MPR-----IDPLELVRMVATARIVMPKS-TVRLSAGRSTLNREAQILC---LVSG
BIOB_RUEPO       PLAH-RER-----VGIFDLVRMVATARIIMPLT-RVRLSAGRSDFSAAEQALC---FLAG
BIOB_BEII9       PLGD-RQK-----LDPLEIVRMIATARLVMPDS-RIRLSAGRSSLSREAQILC---MVAG
BIOB_METSB       PLGE-RER-----IDPLEFVRMIAVTRIVLPAS-RVRLSAGRSVLNREAQVLC---MVAG
BIOB_ZYMMO       PLAD-ADP-----VDPLEIVRMIATARLMMPQS-MVRLSAGRSTLSRETQILC---LVAG
BIOB_METC4       PLED-RPP-----IDPLDLVRMCATARIVMPKA-RVRLSAGRKSLTREAQILC---FLAG
BIOB_METEP       PLED-RPP-----IDPLDLVRMCATARIVMPKA-RVRLSAGRKSLTREAQILC---FLAG
BIOB_METPB       PLED-RPP-----IDPLDLVRMCATARIVMPKA-RVRLSAGRKSLTREAQILC---FLAG
BIOB_METRJ       PLED-QPA-----VDPFDLVRMCATARIVMPRS-RVRLSAGRKSLTREAQVLC---FLAG
BIOB_METNO       PLAE-RPP-----VDPLDLVRMCATARIVMPKA-RVRLSAGRRALTREAQVLC---FLAG
BIOB_METS4       PLGE-RPP-----VDPFEMVRMCATARIVMPRA-RVRLSAGRRALSREAQVLC---FLAG
BIOB_PROM2       GLED-NQE-----IDSIEMIRMIATARILMPKS-KIRLSAGREKLSKEAQILC---FQCG
BIOB_PROM9       GLED-NQE-----IDSIEMIRMIATARILMPKS-KIRLSAGREKLSKEAQILC---FQCG
BIOB_PROMS       GLED-NQE-----IDSIEMIRMIATARILMPKS-KIRLSAGREKLSKEAQILC---FQCG
BIOB_PROM0       GLED-TQE-----IDSIEMIRMIATARILMPES-KIRLSAGREKLTKEAQILC---FQCG
BIOB_PROM5       GLEE-KKE-----IDSIEMIRMIATARILMPKS-KIRLSAGREKLTKEAQIIC---FQCG
BIOB_PROMP       GLEG-GKE-----IDSIEMIRMIATARILMPKS-KIRLSAGRENLTKEAQILC---FQCG
BIOB_PROM1       PMED-LSS-----IDPLEMVRMVATARVIMPKS-RIRLSAGRQQLGREAQILC---LQSG
BIOB_PROMT       PMED-LSS-----IDPLEMVRMVATARIIMPKS-RIRLSAGRQQLGREAQILC---LQSG
BIOB_PROM4       PLQD-LPS-----IDPIEMVRMVATARILMPLS-RVRLSAGREQLGDEAQILC---FLAG
BIOB_PROMA       PLEN-LSM-----VDPLEMVRMVATARILMPRS-RVRLSAGREQLGKEAQILC---LLAG
BIOB_PROM3       PLQD-LPA-----VDPLEMVRMVATARILMPRS-RVRLSAGREQLGREAQILC---LQAG
BIOB_PROMM       PLQD-LPA-----VDPLEMVRMVATARILMPRS-RVRLSAGREQLGREAQILC---LQAG
BIOB_SYNPW       PLEA-QPS-----IDPLELVRMVAVARILMPQS-RVRLSAGREQLNREAQILC---LQAG
BIOB_SYNS3       PLEE-LPP-----IDPIELVRMIAVTRILMPGS-RVRLSAGREQLSKEAQILC---LQAG
BIOB_SYNPX       PLED-QAP-----FEPLELVRMVATARILMPRA-RVRLSAGRESMSREAQILC---LQAG
BIOB_SYNSC       PLED-QAP-----FEPLELVRMVATARILMPHA-RVRLSAGRESMSREAQILC---LQAG
BIOB_SYNS9       PLEE-QQP-----FEPLELVRMVATARILMPHA-RVRLSAGREQLSREAQILC---LQAG
BIOB_SYNR3       PLED-QEP-----WEPLELVRMVAVARILMPEA-RVRLSAGRERLSQEAQILC---LLAG
BIOB_SYNE7       PLGD-RDR-----LDPLDLVRMCAVARILMPKA-RVRLSAGRTALSREAQVLC---FLAG
BIOB_SYNP6       PLGD-RDR-----LDPLDLVRMCAVARILMPKA-RVRLSAGRTALSREAQVLC---FLAG
BIOB_SORC5       PLES-LPP-----VDPIEFVRMIAVARVMMPRA-MVRLSAGRTELSRETQLLC---MYAG
BIOB_MYXXD       PLQE-QQR-----VETVDMVRTIATARILMPQS-MVRLSAGRQQMNEEAQLLC---MMAG
BIOB_GLOVI       PLAD-SSP-----VEPLDLVRMVATTRILFPDA-MVRLSAGRLQMSEELQALC---FLAG
BIOB_SYNJA       PLGQ-LPP-----PDPLLLVRTIATARLLLPTA-QIRLSAGRKNLSESEQALC---FLAG
BIOB_NOSS1       PLED-QPD-----VPVWDVVRMIATARIVMPTS-DVRLSAGRARLSQVEQAFC---FMAG
BIOB_TRIV2       PLED-QPD-----VPVWDVVRMIATARIVMPTS-DVRLSAGRARLSQVEQAFC---FMAG
BIOB_NOSP7       PLEN-QPD-----VPIWDIVRMIATARILMPAS-DVRLSAGRARLSQVEQAFC---FMAG
BIOB_CHLAB       PLYD-QAS-----ISFWEILRTIATARIVFPQS-MVRLAAGRAFLSVEQQTLC---FIAG
BIOB_CHLFF       PLQD-QQT-----PSFWEILRTIATARIVFPLS-MVRLAAGRAFLSVEQQTLC---FIAG
BIOB_CHLPN       PLQD-QPP-----ISFWEVLRTIATARVVFPRS-MVRLAAGRAFLTVEQQTLC---FLAG
BIOB_FLAJ1       PMEE-EKP-----VEIWEMIRMVATTRIVMPET-QVRLSAGRTNMSREGQAMC---FFAG
BIOB_FLAPJ       PMEE-EKP-----VEIWEMIRMVATTRIIMPET-QVRLSAGRMNMTREGQAMC---FFAG
BIOB_GRAFK       PMEE-QEP-----VPIWEMIRMVATTRIVMPET-QVRLSAGRTQMSREGQAMC---FFAG
BIOB_CYTH3       PLED-QPR-----VSVWEMVRMIATARIIMPKA-MVRLSAGRVRMNTEEQALC---FLAG
BIOB_HYDCU       PLAHMKDK-----TDSFEFIRVIATARIVMPQT-YVRLSAGRMELTDEAQALC---FLAG
BIOB_BRUA1       RLAK-AAP-----VDPLEFVRVVALARILMPKS-HVRLTAGRTAMSDEMQALC---FFAG
BIOB_BRUA2       RLAK-AAP-----VDPLEFVRVVALARILMPKS-HVRLTAGRTAMSDEMQALC---FFAG
BIOB_BRUAB       RLAK-AAP-----VDPLEFVRVVALARILMPKS-HVRLTAGRTAMSDEMQALC---FFAG
BIOB_BRUC2       RLAK-AAP-----VDPLEFVRVVALARILMPKS-HVRLTAGRTAMSDEMQALC---FFAG
BIOB_BRUMB       RLAK-AAP-----VDPLEFVRVVALARILMPKS-HVRLTAGRTAMSDEMQALC---FFAG
BIOB_BRUME       RLAK-AAP-----VDPLEFVRVVALARILMPKS-HVRLTAGRTAMSDEMQALC---FFAG
BIOB_BRUSI       RLAK-AAP-----VDPLEFVRVVALARILMPKS-HVRLTAGRTAMSDEMQALC---FFAG
BIOB_BRUSU       RLAK-AAP-----VDPLEFVRVVALARILMPKS-HVRLTAGRTAMSDEMQALC---FFAG
BIOB_BRUO2       RLAK-AAP-----VDPLEFVRVVALARILMPKS-HVRLTAGRTAMSDEMQALC---FFAG
BIOB_OCHA4       RLEK-ASP-----VDPIAFVRIIALARLMMPQS-HVRLTAGRNSMSDEMQALC---FFAG
BIOB_AGRFC       KLAN-ADP-----VDPIDFVRTIALARILMPRS-HVRLSAGRTEMSDETQALC---FLAG
BIOB2_PARDP      PLAD-VPR-----LDAIEMVRTIATARILMPAS-YVRLSAGRSEMSDEMQAMC---FFAG
BIOB_LEGPA       PLAQ-AER-----VEGIELVRTIATARILMPKS-AIRLTAGRTEMSDELQALC---YFAG
BIOB_LEGPH       PLAQ-AER-----VEGIELVRTIATARILMPKS-AIRLTAGRTEMSDELQALC---YFAG
BIOB_LEGPL       PLAQ-AER-----VEGIELVRTIATARILMPKS-AIRLTAGRTEMSDELQALC---YFAG
BIOB_LEGPC       PLAQ-AER-----VEGIELVRTIATARILMPKS-AIRLTAGRTEMSDELQALC---YFAG
BIOB_RUTMC       PFENIEP------PTESEFVRTIAVARIMMPKS-VVRLSAGRTKMGEAMQALC---FFAG
BIOB_VESOH       PFENIEP------PTESEFIRTIAVARIMMPKS-VVRLSAGRTKMGDTMQALC---FFAG
BIOB_HAEI8       PLADAEE------LDWTEFVRTIAVARITMPKS-YVRLSAGRSGMTEEMQAMC---FMAG
BIOB_HAEIE       PLADAEE------LDWTEFVRTIAVARITMPKS-YVRLSAGRSGMTEEMQAMC---FMAG
BIOB_HAEIN       PLADAEE------LDWTEFVRTIAVARITMPKS-YVRLSAGRSGMTEEMQAMC---FMAG
BIOB_HAEIG       PLADAEE------LDWTEFVRTIAVARITMPKS-YVRLSAGRSGMTEEMQAMC---FMAG
BIOB_HAES1       PLADAQE------LDWTEFVRTIAVARITMPKS-YVRLSAGRQGMSEEMQAMC---FMAG
BIOB_HISS2       PLADAQE------LDWTEFVRTIAVARITMPKS-YVRLSAGRQGMSEEMQAMC---FMAG
BIOB_PASMU       PLADAAE------LDWTEFVRTIAVARITMPKS-YVRLSAGRQGMSEEMQAMC---FMAG
BIOB_ACTSZ       PLADAEE------LDWTEFVRTIAVARITMPKS-YVRLSAGRQGMSEEMQAMC---FMAG
BIOB_MANSM       PLSDAQE------LDWTEFVRTVAVARITMPKS-YVRLSAGRQGMSEEMQAMC---FMAG
BIOB_ACTP7       PLENAED------LDWTEFVRTIAVARITMPKS-YVRLSAGRTSMPEAMQTLC---FMAG
BIOB_ACTPJ       PLENAED------LDWTEFVRTIAVARITMPKS-YVRLSAGRTSMPEAMQTLC---FMAG
BIOB_ACTP2       PLENAED------LDWTEFVRTIAVARITMPKS-YVRLSAGRTSMPEAMQTLC---FMAG
BIOB_HAEDU       PMAEAED------LDWTEFVRTIAVARITMPKS-YVRLSAGRTAMSEAMQTLC---FIAG
BIOB_HAEPS       PLENAED------LDWTEFVRTIAVARITMPKS-YVRLSAGRSNMPEAMQALC---FMAG
BIOB_NEIG1       PLADAED------LDWTEFVRTVSVARITMPQS-YVRLSAGRSNMPEAMQAMC---FMAG
BIOB_NEIG2       PLADAED------LDWTEFVRTVSVARITMPQS-YVRLSAGRSNMPEAMQAMC---FMAG
BIOB_NEIM0       PLDDAED------LDWTEFVRTIAVARITMPQS-YVRLSAGRSNMPEAMQAMC---FMAG
BIOB_NEIMF       PLADAED------LDWTEFVRTIAVARITMPQS-YVRLSAGRSNMPEAMQAMC---FMAG
BIOB_NEIMA       PLDDAED------LDWTEFVRTIAVARITMPQS-YVRLSAGRSNMPEAMQAMC---FMAG
BIOB_NEIMB       PLADAED------LDWTEFVRTIAVARITMPQS-YVRLSAGRSNMPEAMQAMC---FMAG
BIOB_CHRVO       PLEGAER------LDWTEFVRTIAVARITMPAS-YVRLSAGRREMDEATQALC---FLAG
BIOB_METSK       PMYGMDE------LDPFEFVRTIAAARITMPQS-FVRLSVGRQSMHEGIQALC---FLAG
BIOB_METFK       PMYGMDE------LDPFEFVRTIAAARITMPQS-FVRLSAGRQSMHEGIQALC---FLAG
BIOB_THIDA       PLAETEA------LEPLEFVRTIAVTRLCMPKS-FVRLSAGRQQMSDAVQALC---FLAG
BIOB_NITEC       PLYGIPE------LDPFEFVRSIAAARITMPRA-KVRLSAGRRQMSEAIQALC---FLAG
BIOB_NITEU       PLYGTPE------LDPFEFVRTIAAARITMPKA-MVRLSAGRRQMPEAIQALC---FLAG
BIOB_NITMU       PLHGTEA------LDPLEFVRTIAAARITMPKA-MVRLSAGRREMPDAVQALC---FLAG
BIOB_ACISJ       PLADSEP------VDPLDFVRVIAVARITMPKA-RVRLSAGRQQLGDAVQALC---FLAG
BIOB_ACIET       PLANSEP------VDPLDFVRVIAVARITMPKA-RVRLSAGRQQLGDAVQALC---FLAG
BIOB_DELAS       PLADSEP------VDPLDFVRVIAVARITMPTA-RVRLSAGRQQLGDAVQALC---FMAG
BIOB_ACIAC       PLADSDP------VDPLDFVRVIAVARITMPRA-RVRLSAGRQQMGDAVQALC---FLAG
BIOB_METPP       PLAGSDK------LDPFEFVRTIAVARITMPTA-YVRLSAGRQEMGDAIQALC---FLAG
BIOB1_POLSJ      PLANQAD------LDPFEFVRTIAVARITMPTA-RVRLSAGRQQMGDGVQALC---FLAG
BIOB_HERAR       PLHGTDP------IDPLEFVRTVAVARITMPKA-RVRLSAGRREMGEAIQALC---FVAG
BIOB_JANMA       PLHGTDP------IDPLEFVRTVAVARITMPKA-RVRLSAGRREMGEAIQALC---FVAG
BIOB_RHOFT       PLYGIEP------LDPIEFVRTIAVARITMPKA-RVRLSAGRRQMGDAVQAMC---FLAG
BIOB_POLAQ       PLAEQKP------LDPLEFVRTIAVARITMPKA-RVRLSAGRQELGRAIQAMC---FMAG
BIOB_BORBR       PLAGAET------LDPFEFIRTIAVARITMPLA-KVRLSAGRETMSDSEQALC---FMAG
BIOB_BORPA       PLAGAET------LDPFEFIRTIAVARITMPLA-KVRLSAGRETMSDSEQALC---FMAG
BIOB_BORPE       PLAGAET------LDPFEFIRTIAVARITMPLA-KVRLSAGRETMSDSEQALC---FMAG
BIOB_BORPD       PLAGTEA------LDPFEFVRTIAVARIVMPLA-RVRLSAGRETMSDTLQALC---FLAG
BIOB_BORA1       PLAEAAP------VDVFEFIRTIAVARITMPRA-KVRLSAGRQSMSEAEQALC---LLAG
BIOB_BURCM       PLEGTAP------LDPFEFVRTIAVARITMPKA-VVRLSAGREQLDDGLQAMC---FLAG
BIOB_BURL3       PLEGTAP------LDPFEFVRTIAVARITMPKA-VVRLSAGREQLDDGLQAMC---FLAG
BIOB_BURA4       PLEGTAP------LDPFEFVRTIAVARITMPKA-VVRLSAGREQLDDAMQAMC---FLAG
BIOB_BURVG       PLEGTAP------LDPFEFVRTIAVARITMPKA-VVRLSAGREQLDDGLQALC---FLAG
BIOB_BURM1       PLAGTAP------LDPFEFVRTIAVARITMPKA-VVRLSAGREQLDDGLQALC---FLAG
BIOB_BURCA       PLEGTAP------LDPFEFVRTIAVARITMPKA-VVRLSAGREQLDDAMQAMC---FLAG
BIOB_BURCC       PLEGTAP------LDPFEFVRTIAVARITMPKA-VVRLSAGREQLDDAMQAMC---FLAG
BIOB_BURCH       PLEGTAP------LDPFEFVRTIAVARITMPKA-VVRLSAGREQLDDAMQAMC---FLAG
BIOB_BURCJ       PLEGTAP------LDPFEFVRTIAVARITMPKA-VVRLSAGREQLDDAMQAMC---FLAG
BIOB_BURM7       PLENAQA------LDPFEFVRTIAVARITMPKA-MVRLSAGREQLDDAMQALC---FLAG
BIOB_BURM9       PLENAQA------LDPFEFVRTIAVARITMPKA-MVRLSAGREQLDDAMQALC---FLAG
BIOB_BURP6       PLENAQA------LDPFEFVRTIAVARITMPKA-MVRLSAGREQLDDAMQALC---FLAG
BIOB_BURMA       PLENAQA------LDPFEFVRTIAVARITMPKA-MVRLSAGREQLDDAMQALC---FLAG
BIOB_BURMS       PLENAQA------LDPFEFVRTIAVARITMPKA-MVRLSAGREQLDDAMQALC---FLAG
BIOB_BURP0       PLENAQA------LDPFEFVRTIAVARITMPKA-MVRLSAGREQLDDAMQALC---FLAG
BIOB_BURPS       PLENAQA------LDPFEFVRTIAVARITMPKA-MVRLSAGREQLDDAMQALC---FLAG
BIOB_BURP1       PLANAQA------LDPFEFVRTIAVARITMPKA-MVRLSAGREQLDDAMQALC---FLAG
BIOB_BURTA       PLENAQA------LDPFEFVRTIAVARITMPKA-MVRLSAGREQLDDSMQALC---FLAG
BIOB_PARPJ       PLTGTEA------IDPFEFVRTIAIARITMPRA-MVRLSAGREQMDEALQALC---FLAG
BIOB_PARXL       PLTGTEA------IDPFEFVRTIAIARITMPRA-MVRLSAGREQMNEALQAMC---FLAG
BIOB_PARP8       PLTGTEA------LDPFEFVRTIAVARITMPRA-MVRLSAGREQMDEALQAMC---FLAG
BIOB_CUPTR       PLAGTEA------LDPFEFVRTIAVARITMPRA-MVRLSAGREAMDEALQALC---FMAG
BIOB_CUPNH       PLAGTEA------LDPFEFVRTIAVARITMPRA-MVRLSAGREAMDEALQALC---FMAG
BIOB_CUPPJ       PLAGTEA------LDPFEFVRTIAVARITMPGA-MVRLSAGREAMDEALQALC---FMAG
BIOB_CUPMC       PLAGTEA------LDPFEFVRTIAVARITMPRA-MVRLSAGREAMDEALQALC---FMAG
BIOB_POLNA       PLADTPP------LDPFEFVRTIAVARITMPRT-MVRLSAGREQMDEALQALC---FMAG
BIOB2_POLSJ      PLANTAP------LDPFEFVRTIAVARITMPLT-MVRLSAGREQMDEALQALC---FAAG
BIOB_LEPCP       PLADAEP------IDPFEFVRTIAVARITMPTT-MVRLSAGREQMDEALQALC---FAAG
BIOB_RALPJ       PLAGNEE------LDPFDFVRTIAVARITMPKA-MVRLSAGREAMDDALQALC---FMAG
BIOB_RALSO       PLAGNEA------LDPFEFVRTIAVARITMPKA-MVRLSAGREAMDDALQALC---FMAG
BIOB_AZOSB       PLADGGT------IDGFDFVRTIAAARITMPTS-YVRLSAGRQQMSDEMQALC---FMAG
BIOB_AROAE       PLENVDK------IDPFEFVRTIAAARIMMPTS-FVRLSAGRQQMSDELQALC---FMAG
BIOB_DECAR       PLADNPR------LDPFEFVRTIAAARIAMPTS-WVRLSAGRQEMSDELQAMC---FLAG
BIOB_GLUDA       PLAGADP------VDPIDFVRIIAAARIAMPAS-RVRLAAGREDMTDEAQTLC---FLAG
BIOB_GLUOX       PLGEAEA------VDPITFVRIIATARIMMPES-HVRLAAGRENMTDEAHALC---FLAG
BIOB_GRABC       PLKGQEP------VDTIDFVRMIAVARITMPHA-RVRLSAGREAMTDEAQALC---FLAG
BIOB_ACICJ       KLGESAP------IDPIDFVRTIAAARISMPRS-WVRLSAGREALSDEAQALC---FLAG
BIOB_STRM5       PLHGSAE------LDPFEFVRMIAVARIVMPRS-MVRLSAGREAMSDELQALC---FVAG
BIOB_STRMK       PLHGSAE------LDPFEFVRMIAVARIAMPRS-MVRLSAGREAMSDELQALC---FLAG
BIOB_XANAC       PLHGTQQ------LDPFEFVRMIAVARIAMPKS-MVRLSAGRETMSDELQALC---FLAG
BIOB_XANC5       PLHGTQQ------LDPFEFVRMIAVARIAMPKS-MVRLSAGREAMSDELQALC---FLAG
BIOB_XANOM       PLHGTQQ------LDPFEFVRMIAVARIAMPKS-MVRLSAGREAMSDELQALC---FLAG
BIOB_XANOP       PLHGTQQ------LDPFEFVRMIAVARIAMPKS-MVRLSAGREAMSDELQALC---FLAG
BIOB_XANOR       PLHGTQQ------LDPFEFVRMIAVARIAMPKS-MVRLSAGREAMSDELQALC---FLAG
BIOB_XANC8       PLHGTEP------LDAFEFVRMIAVARIAMPKS-MVRLSAGREAMSDELQALC---FLAG
BIOB_XANCB       PLHGTEP------LDAFEFVRMIAVARIAMPKS-MVRLSAGREAMSDELQALC---FLAG
BIOB_XANCP       PLHGTEP------LDAFEFVRMIAVARIAMPKS-MVRLSAGREAMSDELQALC---FLAG
BIOB_XYLF2       PLHGTQT------LDPFEFVRMIAVARITMPRS-MVRLSAGRESMSDELQLLC---FMAG
BIOB_XYLFT       PLHGTQT------LDPFEFVRMIAVARITMPRS-MVRLSAGRESMSDELQLLC---FMAG
BIOB_XYLFM       PLHGTQT------LDPFEFVRMIAVARITMPRS-MVRLSAGRESMSDELQLLC---FMAG
BIOB_XYLFA       PLHGTQT------LDPFEFVRMIAVARITMPRS-MVRLSAGRESMSDELQLLC---FMAG
BIOB_AZOC5       PVKAFEE-----KVDPIAFVRLVAVARLLMPRS-VVRLSAGRHTLSDEAQALC---FLAG
BIOB_XANP2       PVMGKAD-----KPDPIAFVRLIALARLLMPQS-IVRLSAGRDAMSDEMQALC---FLAG
BIOB_RHOS1       PVQGRAR-----AVDPFALVRIVALARILMPAS-VVRLSAGRTEMSDELQALC---FLAG
BIOB_RHOS4       PVQGRAQ-----AVDPFALVRIVALARILMPAS-VVRLSAGRTEMSDELQALC---FLAG
BIOB_RHOSK       PVQGRAR-----AVDPFALVRIVALARILMPAS-VLRLSAGRTEMSDELQALC---FLAG
BIOB1_PARDP      PVQARAQ-----AVDPFALVRIVALARILMPAS-VVRLSAGRTGMSDELQALC---FLAG
BIOB_BRASB       PVNDTAA-----RPDPIALVRLIAVTRIMMPQS-VVRLSAGRQYMSDELQSLC---LLAG
BIOB_BRASO       PVNDTAE-----RPDGIALARLIAVARIMMPRS-VVRLSAGRQYMSDELQSLC---LLAG
BIOB_NITHX       PVNDTAE-----RPDPIALVRMIAVARIMMPRS-VVRLSAGRQYMTDELQALC---FLAG
BIOB_NITWN       PVNDTAD-----RPDPIALVRMIAVARIMMPKS-VVRLSAGRQYMTDELQALC---FVAG
BIOB_OLICO       PVNATAE-----APDPIAFVRMIAVARIMMPKS-VVRLSAGRQYMSDEMQALC---MLAG
BIOB_BRADU       PVEDTAE-----PPDPIALVRLLATARVMMPRS-VVRLSAGRQYMTDELQALC---FLAG
BIOB_RHOPA       PIAKTAT-----PVDPFEFVRTIALARIMMPKS-DVRLAAGRTAMSDEMQALC---FLAG
BIOB_RHOPT       PIAKTAT-----PVDPFEFVRTIALARIMMPKS-DVRLAAGRTAMSDEMQALC---FLAG
BIOB_RHOPS       PIAATAT-----PVDPFEFVRTIALARIMMPKS-DVRLAAGRTAMSDEMQALC---FLAG
BIOB_RHOP2       PIAKTAK-----PVDPFEFVRTIALARIMMPKS-DVRLAAGRTAMSDEMQSLC---FLAG
BIOB_RHOP5       PIAATAT-----PVDPIEFVRTIALARIMMPKS-DVRLAAGRTAMSDEMQALC---FLAG
BIOB_RHOPB       PISLTAT-----PVDPIAFVRTIALARIMMPLS-DVRLAAGRTAMSDEMQTLC---FLAG
BIOB_CAUVN       PLGDKVLSEG-KAIDAIEFVRTIAVARIVCPKS-MVRLSAGREGMSRELQALC---FMAG
BIOB_CAUVC       PLGDKVLSEG-KAIDAIEFVRTIAVARIVCPKS-MVRLSAGREGMSRELQALC---FMAG
BIOB_CAUSK       PLGDKVKREG--EIDGLEFVRTVAVARIVCPKS-MVRLSAGRDDMSRELQALC---FMAG
BIOB_PHEZH       PLGDSK------AVDPLEFVRMIAVARIVCPKS-MVRIAAGREHMTKELQALC---FLAG
BIOB_HYPNA       PLANSE------ELDTLELARAIAVCRIVFPKS-WVRLSAGRETMSAEGQALC---ILAG
BIOB_MARMM       PLGDSK------PLDGIEFVRTIATARILMPRS-MVRLSAGREGMSRELQALC---FLAG
BIOB_ERYLH       VLGDMLADTPLAKIDDIEFVRTVAVARITMPLS-MVRLSAGRESMSEATQALC---FMAG
BIOB_NOVAD       VLGDMLADTPLAKIDDIEFVRTVAVARITMPLS-MVRLSAGRESMSEATQALC---FMAG
BIOB_SPHAL       VLGDMLADTPLAKIDDIEFVRTVAVARITMPKS-MVRLSAGRESMSEATQALC---FMAG
BIOB_SPHWW       VLGDMLADTPLAKIDEIEFVRTVAVARITMPAS-MVRLSAGRESMSDAAQALC---FMAG
BIOB_PARL1       ALGAS------EKIDPIDFVRLIAVARIAMPQS-VVRLSAGREHMSEETQALC---FLAG
BIOB_ACIF2       PLEAAEP------IDGFEFVRTVAVTRILFPKA-YVRLSAGREAMSDELQALA---FLAG
BIOB_ACIF5       PLEAAEP------IDGFEFVRTVAVTRILFPKA-YVRLSAGREAMSDELQALA---FLAG
BIOB_NITOC       PLAGAPE------LDPFEFVRTVACARILMPAS-FVRLSAGRETMSDELQALC---FLAG
BIOB_THISH       PLAGTEA------LDPFEFVRTIATARILMPAS-YVRLSAGRTEMHDELQALC---FFAG
BIOB_ALKEH       PLHGVEP------PDPFEFVRTIAVARILMPAS-YVRLSAGREQMSDELQALC---FLAG
BIOB_HALHL       PLEAAEP------VDPFEIVRTIAATRLVLPRS-YVRLAAGREQMSDELQALC---LSAG
BIOB_ALCBS       PLADVDD------LDPFEFVRTVAVARILMPQS-YVRLSAGRQEMNDEAQALC---FMAG
BIOB_METCA       PLADTAA------LDPFDFVRTVAVARIMMPAS-RVRLSAGRSDMSDEMQALC---FLAG
BIOB_MAGSA       PLADAER------PDSFDFIRTIAVARITMPKS-FVRLSAGREGMTEEMQALC---FLAG
BIOB_ACIB3       PLADVEK------LDVIEWIRTIAVARIIMPHS-YIRLSAGRESLSDSDQALA---FMAG
BIOB_ACIB5       PLADVEK------LDVIEWIRTIAVARIIMPHS-YIRLSAGRESLSDSDQALA---FMAG
BIOB_ACIBY       PLADVEK------LDVIEWIRTIAVARIIMPHS-YIRLSAGRESLSDSDQALA---FMAG
BIOB_ACIBC       PLADVEK------LDVIEWIRTIAVARIIMPHS-YIRLSAGRESLSDSDQALA---FMAG
BIOB_ACIBT       PLADVEK------LDVIEWIRTIAVARIIMPHS-YIRLSAGRESLSDSDQALA---FMAG
BIOB_ACIBS       PLADVEK------LDVIEWIRTIAVARIIMPHS-YIRLSAGRESLSDSDQALA---FMAG
BIOB_ACICA       PLAEVEK------LDVTEWIRTIAVARIIMPHS-YIRLSAGRESLSDSDQALA---FMAG
BIOB_ACIAD       PLADVEK------LDVTEWIRTIAVARIIMPYS-YIRLSAGRESLSDSDQALA---FMAG
BIOB_PSYA2       PIGDKVLAEG--QLSVLEWIRTIAVTRICCPSS-YVRLSAGRESLSDAEQALA---FMAG
BIOB_PSYCK       PIGDKVLAEG--QLSVLEWIRTIAVTRICCPSS-YVRLSAGRESLSDAEQALA---FMAG
BIOB_PSYWF       PLGDKVLSEG--QLPVLEWIRTIAVTRICCPSS-YVRLSAGRESLSDAEQALA---FMAG
BIOB_CELJU       PLEREAD------LDPIDFIRTIAVARILMPKS-HVRLSAGREQMNEQTQALA---FLAG
BIOB_SACD2       PLEQQEA------LDPFDFIRTIAVARILMPQS-HVRLSAGREDMNDQTQALA---FHAG
BIOB_HAHCH       PLEVQED------IDPFDFIRTIAVARILMPRS-HVRLSAGREDMNEQMQAMC---FLAG
BIOB_MARHV       PLEDVED------LDPFDFIRIIAVARIMMPAS-HVRLSAGREQMNEQMQALC---FMAG
BIOB_CHRSD       PMENVED------MDPLTFIRAIAVARILMPKS-HVRLSAGREQMDESTQALA---FLAG
BIOB_PSE14       PLENAED------VDPFDFIRMLAVARILMPQS-HVRLSAGREAMNEQMQALA---FFAG
BIOB_PSEU2       PLENAED------VDPFDFIRMLAVARILMPKS-HVRLSAGREAMNEQMQALA---FFAG
BIOB_PSESM       PLENAED------VDPFDFIRMLAVARILMPQS-HVRLSAGREAMNEQMQALA---FFAG
BIOB_PSEF5       PLENAEE------VDPFDFIRMLAVARILMPQS-HVRLSAGREAMNEQMQALA---FFAG
BIOB_PSEPF       PLENADD------VDPFDFIRMLAVARILMPQS-HVRLSAGREAMNEQMQALA---FFAG
BIOB_PSEP1       PLAEEED------VDPFDFIRMLAVARILMPKS-HVRLSAGREQMNEQMQALA---FMAG
BIOB_PSEPK       PLAEEED------VDPFDFIRMLAVARILMPKS-HVRLSAGREQMNEQMQALA---FMAG
BIOB_PSEPG       PLAEEED------VDPFDFIRMLAVARILMPKS-HVRLSAGREQMNEQMQALA---FMAG
BIOB_PSEPW       PLAEEED------VDPFDFIRMLAVARLLMPKS-HVRLSAGREQMNEQMQALA---FMAG
BIOB_PSEE4       PLAEEED------VDPFDFIRMLAVARILMPKS-HVRLSAGREQMNEQMQALA---FMAG
BIOB_PSEA8       PLAEEKD------VDPFDFIRTLAVARIMMPKS-HVRLSAGREQMNEQMQALA---FMAG
BIOB_PSEAE       PLAEEKD------VDPFDFIRTLAVARIMMPKS-HVRLSAGREQMNEQMQALA---FMAG
BIOB_PSEAB       PLAEEKD------VDPFDFIRTLAVARIMMPKS-HVRLSAGREQMNEQMQALA---FMAG
BIOB_PSEA7       PLAEEKD------VDPFDFIRTLAVARIMMPKS-HVRLSAGREQMNEQMQALA---FMAG
BIOB_PSEMY       PLAEEKD------VDPFDFIRTLAVARIMMPKS-HVRLSAGREQMNEQMQALA---FMAG
BIOB_PSEU5       PLAEEQD------VDPFDFIRMLAVARIMMPKS-HVRLSAGREQMNEQMQALA---FFAG
BIOB_IDILO       PFAKLED------LDNFEFVRTVAVARILMPAS-HVRLSAGREDMNDEMQALC---FLAG
BIOB_COLP3       PLADIDD------LESFDFIRCIAVARIMMPHS-HVRLSAGRTAMNEQMQAMC---FLAG
BIOB_PSYIN       PLENADD------LDDFTFIKTIAIARLLMPKS-HVRLSAGRDDMNEQTQALC---FMAG
BIOB_MARMS       PLENVDD------LDTFEFIRTIAVARILMPKS-HVRLSAGRQGMNEQTQALC---FMAG
BIOB_PSEHT       PLENVDD------LDHFEFIRTIATARIMMPHS-YVRLSAGRNAMNEQMQSMC---FFAG
BIOB_SHEB2       PFEKLDD------LDPLEFVRTIAVARILMPLS-RVRLSAGRENMSDELQAMC---FFAG
BIOB_SHEB5       PFEKLDD------LDPLEFVRTIAVARILMPLS-RVRLSAGRENMSDELQAMC---FFAG
BIOB_SHEB8       PFEKLDD------LDPLEFVRTIAVARILMPLS-RVRLSAGRENMSDELQAMC---FFAG
BIOB_SHEB9       PFEKLDD------LDPLEFVRTIAVARILMPLS-RVRLSAGRENMSDELQAMC---FFAG
BIOB_SHESA       PFEKLDD------LDPLEFVRTIAVARILMPKS-RVRLSAGRENMTDELQAMC---FFAG
BIOB_SHESM       PFEKLDD------LDPLEFVRTIAVARILMPKS-RVRLSAGRENMTDELQAMC---FFAG
BIOB_SHESR       PFEKLDD------LDPLEFVRTIAVARILMPKS-RVRLSAGRENMTDELQAMC---FFAG
BIOB_SHEON       PFEKLDD------LDPLEFVRTIAVARILMPLS-RVRLSAGRENMSDELQAMC---FFAG
BIOB_SHEPC       PFEKLDD------LDPLEFVRTIAVARILMPLS-RVRLSAGRENMSDELQAMC---FFAG
BIOB_SHESW       PFEKLDD------LDPLEFVRTIAVARILMPLS-RVRLSAGRENMSDELQAMC---FFAG
BIOB_SHEHH       PFEKLDD------LDPLEFVRTIAVARITMPKS-RVRLSAGRENMSDELQAMC---FFAG
BIOB_SHEPA       PFEKLDD------LDPLEFVRTIAVARITMPKS-RVRLSAGRENMSDELQAMC---FFAG
BIOB_SHEPW       PFEKIDD------LDPLEFVRTIAVARIIMPKS-RVRLSAGRENMTDELQAMC---FFAG
BIOB_SHEDO       PFEKIDD------LDPLEFVRTIAVARIIMPKS-RVRLSAGREKMSDELQSMC---FFAG
BIOB_SHEFN       PFENIDD------LDPLEFVRTIAVARILMPKS-RVRLSAGRESMSDELQSMC---FFAG
BIOB_SHESH       PFENLDD------LDPLEFVRTIAVARIIMPHS-RVRLSAGREKMTDEMQAMC---FFAG
BIOB_SHEWM       PFENLED------LDPLVFVRTIAVARILMPHS-RVRLSAGREKMSDEMQAMC---FFAG
BIOB_SHELP       PFENLDD------LDPLEFVRTIAVARIVMPLS-RVRLSAGREKMTDELQAMC---FFAG
BIOB_SHEAM       PLDSVDD------LDPLEFVRTIAVARILMPLS-RVRLSAGRENMSDELQAMC---FFAG
BIOB_AERHH       PLENQEN------LDPFEFIRTIAVARIMMPAS-HVRLSAGREKMNEQMQAMC---FMAG
BIOB_AERS4       PLENEAN------LDSFEFIRTIAVARIMMPAS-HVRLSAGREKMNEQMQAMC---FMAG
BIOB_ALTMD       PLDSVED------LDYFEFIRTIAVARIMMPKS-HVRLSAGREAMNEQMQAMC---FMAG
BIOB_PSEA6       PMENVED------LDYFEFIRTIAVARIMMPKS-FVRLSAGREAMNEQMQAMC---FMAG
BIOB_ALIF1       PLEDAED------VDPFDFIRLIAVARIMMPES-AVRLSAGRESMNEQMQALC---FMAG
BIOB_ALIFM       PLEDAED------VDPFDFIRLIAVARIMMPES-AVRLSAGRESMNEQMQALC---FMAG
BIOB_ALISL       PLEDAED------VDPFDFIRLIAVARIMMPES-AVRLSAGRESMNEQMQALC---FMAG
BIOB_VIBC3       PLEQVDD------VEPFDFVRLIAVARIMMPKS-AVRLSAGREKMNEQMQALC---FMAG
BIOB_VIBCH       PLEQVDD------VEPFDFVRLIAVARIMMPKS-AVRLSAGREKMNEQMQALC---FMAG
BIOB_VIBTL       PMENVDD------VESFDFVKLIAIARIMMPMS-AVRLSAGRENMNEQMQAMC---FMAG
BIOB_VIBCB       PLEEVDD------VEPFDFIRLIAIARIMMPQS-AVRLSAGRENMNEQMQALC---FMAG
BIOB_VIBPA       PLETVDD------VDPFDFIRLIAIARIMMPQS-AVRLSAGRENMNEQMQALC---FMAG
BIOB_VIBVU       PLETAEE------VDPFDFIRLIAVARIMMPTS-AVRLSAGRENMNEQMQTLC---FMAG
BIOB_VIBVY       PLETAEE------VDPFDFIRLIAVARIMMPTS-AVRLSAGRENMNEQMQTLC---FMAG
BIOB_PHOPR       PMEDVED------VDPFDFIRIIAVARIIMPMS-SVRLSAGREDMNEQMQTLC---FMAG
BIOB_BUCA5       PMADNKD------VEPFDFIRIIAVARIMMPKS-YIRLSAGRHKMNDQTQAMC---FMAG
BIOB_BUCAT       PMADNKD------VEPFDFIRIIAVARIMMPKS-YIRLSAGRHKMNDQTQAMC---FMAG
BIOB_BUCAI       PMADNKD------VEPFDFIRIIAVARIMMPKS-YIRLSAGRHKMNDQTQAMC---FMAG
BIOB_BUCAP       PMEKNEN------VDPFEFIRVIAATRIMMPKS-YIRLSAGRENMSDETQAMC---FMAG
BIOB_BUCBP       PLENQTS------IDTFDFIKTIAITRIMMPTS-YIRLSAGRENMNEQTQAMC---FLSG
BIOB_WIGBR       PMEKNKD------VDAFDFIRIIALARIMMPKS-RIRLSAGRENMNEQTQALC---FMAG
BIOB_BAUCH       PMFDNKD------VDPFDLIRMIAVTRIMMPTS-YVRLSAGREQMNEQTQAIC---FMAG
BIOB_PECAS       PLADNED------VDPFDFIRTIAVARIMMPAS-YVRLSAGREQMSEQTQAMC---FMAG
BIOB_ERWT9       PMADNDD------VDPFDFVRTIAVARIMMPRS-HVRLSAGREQMSEQTQAMC---FMAG
BIOB_SERMA       PLADNDD------VDPFDFIRTIAVARIMMPSS-YVRLSAGREQMNEQTQAMC---FMAG
BIOB_SERP5       PLADNED------VDPFDFIRTIAVARIMMPAS-YVRLSAGREQMNEQTQAMC---FMAG
BIOB_YERPA       PLENNAE------VDAFEFIRTIAVARIMMPSS-YVRLSAGREQMNEQTQAMC---FMAG
BIOB_YERPB       PLENNAE------VDAFEFIRTIAVARIMMPSS-YVRLSAGREQMNEQTQAMC---FMAG
BIOB_YERPE       PLENNAE------VDAFEFIRTIAVARIMMPSS-YVRLSAGREQMNEQTQAMC---FMAG
BIOB_YERPG       PLENNAE------VDAFEFIRTIAVARIMMPSS-YVRLSAGREQMNEQTQAMC---FMAG
BIOB_YERPN       PLENNAE------VDAFEFIRTIAVARIMMPSS-YVRLSAGREQMNEQTQAMC---FMAG
BIOB_YERPP       PLENNAE------VDAFEFIRTIAVARIMMPSS-YVRLSAGREQMNEQTQAMC---FMAG
BIOB_YERPS       PLENNAE------VDAFEFIRTIAVARIMMPSS-YVRLSAGREQMNEQTQAMC---FMAG
BIOB_YERPY       PLENNAE------VDAFEFIRTIAVARIMMPSS-YVRLSAGREQMNEQTQAMC---FMAG
BIOB_YERP3       PLENNAE------VDAFEFIRTIAVARIMMPSS-YVRLSAGREQMNEQTQAMC---FMAG
BIOB_YERE8       PLENNDD------VDAFEFIRTIAVARIMMPTS-YVRLSAGREQMNEQTQAMC---FMAG
BIOB_PSEVU       PLADNDD------VDAFDFIRTIAVARIMMPTS-FVRLSAGREQMNEQTQAMC---FMAG
BIOB_ENT38       PMADNDD------VDAFDFIRTIAVARIMMPTS-FVRLSAGREQMSEQTQAMC---FMAG
BIOB_KLEP3       PLADNDD------VDAFDFIRTIAIARIMMPTS-YVRLSAGREQMNEQTQAMC---FMAG
BIOB_KLEP7       PLADNDD------VDAFDFIRTIAIARIMMPTS-YVRLSAGREQMNEQTQAMC---FMAG
BIOB_SALPB       PLADNDD------VDAFDFIRTIAVARIMMPTS-YVRLSAGREQMNEQTQAMC---FMAG
BIOB_SALPC       PLADNDD------VDAFDFIRTIAVARIMMPTS-YVRLSAGREQMNEQTQAMC---FMAG
BIOB_SALNS       PLADNDD------VDAFDFIRTIAVARIMMPTS-YVRLSAGREQMNEQTQAMC---FMAG
BIOB_SALTY       PLADNDD------VDAFDFIRTIAVARIMMPTS-YVRLSAGREQMNEQTQAMC---FMAG
BIOB_SALCH       PLADNDD------VDAFDFIRTIAVARIMMPTS-YVRLSAGREQMNEQTQAMC---FMAG
BIOB_SALA4       PLADNDD------VDAFDFIRTIAVARIMMPTS-YVRLSAGREQMNEQTQAMC---FMAG
BIOB_SALTI       PLADNDD------VDAFDFIRTIAVARIMMPTS-YVRLSAGREQMNEQTQAMC---FMAG
BIOB_SALHS       PLADNDD------VDAFDFIRTIAVARIMMPTS-YVRLSAGREQMNEQTQAMC---FMAG
BIOB_SALPA       PLADNDD------VDAFDFIRTIAVARIMMPTS-YVRLSAGREQMNEQTQAMC---FMAG
BIOB_SALDC       PLADNDD------VDAFDFIRTIAVARIMMPTS-YVRLSAGREQMNEQTQAMC---FMAG
BIOB_SALEP       PLADNDD------VDAFDFIRTIAVARIMMPTS-YVRLSAGREQMNEQTQAMC---FMAG
BIOB_SALSV       PLADNDD------VDAFDFIRTIAVARIMMPTS-YVRLSAGREQMNEQTQAMC---FMAG
BIOB_SALPK       PLADNDD------VDAFDFIRTIAVARIMMPTS-YVRLSAGREQMNEQTQAMC---FMAG
BIOB_SALG2       PLADNDD------VDAFDFIRTIAVARIMMPTS-YVRLSAGREQMNEQTQAMC---FMAG
BIOB_SALAR       PLADNDD------VDAFDFIRTIAVARIMMPTS-YVRLSAGREQMNEQTQAMC---FMAG
BIOB_CITK8       PLADNED------VDAFDFIRTIAVARIMMPTS-YVRLSAGREQMNEQTQAMC---FMAG
BIOB_SHIB3       PLADNDD------VDAFDFIRTIAVARIMMPTS-YVRLSAGREQMNEQTQAMC---FMAG
BIOB_SHIBS       PLADNDD------VDAFDFIRTIAVARIMMPTS-YVRLSAGREQMNEQTQAMC---FMAG
BIOB_ECO81       PLADNDD------VDAFDFIRTIAVARIMMPTS-YVRLSAGREQMNEQTQAMC---FMAG
BIOB_ECOL6       PLADNDD------VDAFDFIRTIAVARIMMPTS-YVRLSAGREQMNEQTQAMC---FMAG
BIOB_ECOK1       PLADNDD------VDAFDFIRTIAVARIMMPTS-YVRLSAGREQMNEQTQAMC---FMAG
BIOB_ECOUT       PLADNDD------VDAFDFIRTIAVARIMMPTS-YVRLSAGREQMNEQTQAMC---FMAG
BIOB_ECO45       PLADNDD------VDAFDFIRTIAVARIMMPTS-YVRLSAGREQMNEQTQAMC---FMAG
BIOB_ECOL5       PLADNDD------VDAFDFIRTIAVARIMMPTS-YVRLSAGREQMNEQTQAMC---FMAG
BIOB_SHIF8       PLADNDD------VDAFDFIRTIAVARIMMPTS-YVRLSAGREQMNEQTQAMC---FMAG
BIOB_SHIFL       PLADNDD------VDAFDFIRTIAVARIMMPTS-YVRLSAGREQMNEQTQAMC---FMAG
BIOB_ECO57       PLADNDD------VDAFDFIRTIAVARIMMPTS-YVRLSAGREQMNEQTQAMC---FMAG
BIOB_ECO5E       PLADNDD------VDAFDFIRTIAVARIMMPTS-YVRLSAGREQMNEQTQAMC---FMAG
BIOB_SHISS       PLADNDD------VDAFDFIRTIAVARIMMPTS-YVRLSAGREQMNEQTQAMC---FMAG
BIOB_ECOLI       PLADNDD------VDAFDFIRTIAVARIMMPTS-YVRLSAGREQMNEQTQAMC---FMAG
BIOB_ECOSM       PLADNDD------VDAFDFIRTIAVARIMMPTS-YVRLSAGREQMNEQTQAMC---FMAG
BIOB_ECOLU       PLADNDD------VDAFDFIRTIAVARIMMPTS-YVRLSAGREQMNEQTQAMC---FMAG
BIOB_ECOLC       PLADNDD------VDAFDFIRTIAVARIMMPTS-YVRLSAGREQMNEQTQAMC---FMAG
BIOB_ECOHS       PLADNDD------VDAFDFIRTIAVARIMMPTS-YVRLSAGREQMNEQTQAMC---FMAG
BIOB_ECODH       PLADNDD------VDAFDFIRTIAVARIMMPTS-YVRLSAGREQMNEQTQAMC---FMAG
BIOB_ECO8A       PLADNDD------VDAFDFIRTIAVARIMMPTS-YVRLSAGREQMNEQTQAMC---FMAG
BIOB_ECO7I       PLADNDD------VDAFDFIRTIAVARIMMPTS-YVRLSAGREQMNEQTQAMC---FMAG
BIOB_ECO55       PLADNDD------VDAFDFIRTIAVARIMMPTS-YVRLSAGREQMNEQTQAMC---FMAG
BIOB_ECO27       PLADNDD------VDAFDFIRTIAVARIMMPTS-YVRLSAGREQMNEQTQAMC---FMAG
BIOB_ECO24       PLADNDD------VDAFDFIRTIAVARIMMPTS-YVRLSAGREQMNEQTQAMC---FMAG
BIOB_SHIDS       PLADNDD------VDAFDFIRTIAVARIMMPTS-YVRLSAGREQMNEQTQAMC---FVAG
BIOB_ECOSE       PLADNDD------VDAFDFIRTIAVARIMMPTS-YVRLSAGREQMNEQTQAMC---FMAG
BIOB_ESCF3       PLADNDD------VDAFDFIRTIAVARIMMPTS-YVRLSAGREQMNEQTQAMC---FMAG
BIOB_CROS8       PLADNED------VDAFDFIRTIAVARIMMPTS-YVRLSAGREQMNEQTQAMC---FMAG
BIOB_PHOLL       PLAENED------VDPFDFIRTIAVARIMMPSS-HVRLSAGREQMNEQTQAMC---FMAG
BIOB_PROMH       PLADNED------VDPFDFIRTIAVARIMMPRS-YVRLSAGREQMSEQTQAFC---FMAG
BIOB_SODGM       PLADNED------VDPFEFIRTIAVARIMMPRS-HVRLSAGREQMNEQTQALC---FMAG
BIOB_METI4       PFYGTPP------LDYMDLIRMIATTRILFPLS-RIRLAAGRKLLDEKTLTLC---YLAG
BIOB_BACSU       PLEG------VNELNPLYCLKVLALFRFINPSK-EIRISGGREVNLRTLQPLG----LYA
BIOB_BACNA       PLEG------VNELNPLYCLKVLALFRFINPSK-EIRISGGREVNLRSLQPLG----LYA
BIOB_BACVZ       PLEG------VSELHPVYCLKVLALFRFINPSK-EIRISGGREVNLRSLQPLG----LYA
BIOB_BACAM       PLEG------VSELHPVYCLKVLALFRFINPSK-EIRISGGREVNLRSLQPLG----LYA
BIOB_BACLD       PLEG------VNELNPLYCLKVLALFRFINPTK-EIRISGGREVNLRSLQPLG----LYA
BIOB_BACHD       PLQG------VHELTPIYCLKVLSLFRYVCPTK-EIRISGGREVNLKSLQPLG----LYA
BIOB_GEOKA       PLAG------TNELNPRYCLKVLALFRYMNPTK-EIRIAGGREVNLRSLQPLG----LYA
BIOB_GEOTN       PLAG------TNELNPRYCLKVLALFRYMNPTK-EIRIAGGREVNLRSLQPLG----LYA
BIOB_ANOFW       PLEG------TKELNPRYCLKVLALFRYINPTK-EIRISGGREVNLRSLQPLG----LYA
BIOB_LYSSH       KLEG------TQDLNPRYCLKVLALFRYMNPSK-EIRISGGREVNLGFLQPFG----LYA
BIOB_LYSSC       KLEG------TKDLNPRYCLKVLALFRYINPTK-EIRISGGREINLGCLQPLG----LYA
BIOB_BACAN       PLEG------QKELTPVECLKVLAMMRFVNPTK-EIRISGGREINLRSVQPIG----LFA
BIOB_BACC0       PLEG------QKELTPVECLKVLAMMRFVNPTK-EIRISGGREINLRSVQPIG----LFA
BIOB_BACCZ       PLEG------QKELTPVECLKVLAMMRFVNPTK-EIRISGGREINLRSVQPIG----LFA
BIOB_BACHK       PLEG------QKELTPVECLKVLAMMRFVNPTK-EIRISGGREINLRSVQPIG----LFA
BIOB_BACAH       PLEG------QKELTPVECLKVLAMMRFVNPTK-EIRISGGREINLRSVQPIG----LFA
BIOB_BACC7       PLEG------QKELTPVECLKVLAMMRFVNPTK-EIRISGGREINLRSVQPIG----LFA
BIOB_BACCQ       PLEG------QKELTPVECLKVLAMMRFVNPTK-EIRISGGREINLRSVQPIG----LFA
BIOB_BACC1       PLEG------QKELTPVECLKVLAMMRFVNPTK-EIRISGGREINLRSVQPIG----LFA
BIOB_BACC2       PLEG------QKELTPVECLKVLAMMRFVNPTK-EIRISGGREINLRSVQPIG----LFA
BIOB_BACC4       PLEG------QKELTPVDCLKVLAMMRFVNPTK-EIRISGGREINLRSVQPIG----LFA
BIOB_BACCR       PLEG------QKELTPVECLKVLAMMRFVNPTK-EIRISGGREINLRSVQPIG----LFA
BIOB_BACMK       PLEG------QKELTPVECLKVLAMMRFVNPTK-EIRISGGRELNLRSVQPLG----LFA
BIOB_BACCN       PFEG------RKELTPVECLKILAMMRFVNPSK-EIRISGGRELNLRSVQPLG----LFA
BIOB_BACP2       PLEH------QERTHPIKALKVLALMRFVNPTK-EIRVSGGREFNLRTLQPLA----LYA
BIOB_STAAM       KFGS------MDDLTPMKCLRIVALFRLINPTK-EIRIAGGREVNLRSLQPLA----LKA
BIOB_STAAN       KFGS------MDDLTPMKCLRIVALFRLINPTK-EIRIAGGREVNLRSLQPLA----LKA
BIOB_STAAS       KFGS------MDDLTPMKCLRIVALFRLINPTK-EIRIAGGREVNLRSLQPLA----LKA
BIOB_STAA9       KFGS------MDDLTPMKCLRIVALFRLINPTK-EIRIAGGREVNLRSLQPLA----LKA
BIOB_STAAB       KFGS------MDDLTPMKCLRIVALFRLINPTK-EIRIAGGREVNLRSLQPLA----LKA
BIOB_STAAW       KFGS------MDDLTPMKCLRIVALFRLINPTK-EIRIAGGREVNLRSLQPLA----LKA
BIOB_STAA1       KFGS------MDDLTPMKCLRIVALFRLINPTK-EIRIAGGREVNLRSLQPLA----LKA
BIOB_STAA2       KFGS------MDDLTPMKCLRIVALFRLINPTK-EIRIAGGREVNLRSLQPLA----LKA
BIOB_STAAR       KFGS------MDDLTPMKCLRIVALFRLINPTK-EIRIAGGREVNLRSLQPLA----LKA
BIOB_STAAC       KFGS------MDDLTPMKCLRIVALFRLINPTK-EIRIAGGREVNLRSLQPLA----LKA
BIOB_STAAT       KFGS------MDDLTPMKCLRIVALFRLINPTK-EIRIAGGREVNLRSLQPLA----LKA
BIOB_STAA8       KFGS------MDDLTPMKCLRIVALFRLINPTK-EIRIAGGREVNLRSLQPLA----LKA
BIOB_STAAE       KFGS------MDDLTPMKCLRIVALFRLINPTK-EIRIAGGREVNLRSLQPLA----LKA
BIOB_STAA3       KFGS------MDDLTPMKCLRIVALFRLINPTK-EIRIAGGREVNLRSLQPLA----LKA
BIOB_STAEQ       KFGG------LDLLSPMKCLRIIAMFRLINPTK-EIRIAGGREVNLRSLQPLA----LKA
BIOB_STAES       KFGG------LDLLSPMKCLRIIAMFRLINPTK-EIRIAGGREVNLRSLQPLA----LKA
BIOB_STAHJ       KFGG------LDLLSPMKCLRIIAMFRLINPSK-EIRIAGGREVNLRSLQAIA----LKA
BIOB_STACT       KFGE------MDELTPMKCLRIIAIFRLVNPTK-EIRIAGGREVNLQSLQPFA----LLA
BIOB_MACCJ       KFGN------EDNLTPERCLRILSMFRLINPSK-EIRIAGGREVNLRTLQPLA----MQA
BIOB_RHOBA       PLEG------TAALTPQDALKALAMFRFVNPDR-ELRIAGGRELHLRQLQPMG----LYV
BIOB_THEEB       PLGE------QHTLNPRHCLRILVLFRFLLPRQ-EIRIAGGREVHLRSLQPLG----LYA
BIOB_SALRD       PLED------VDTVRPQDCLKALAMFRLVHPEA-DLRMAGGREVVLDQMQPLA----LYA
BIOB_STRAW       PLAK------EWNLTPQRCLRILAMVRFVCPDV-EVRIAGGREVHLRTMQPLA----LHL
BIOB_STRCO       PLAK------EWHLTPQRCLRILAMTRFVCPDV-EVRIAGGREVHLRTMQPLA----LHL
BIOB_STRGG       PLAK------EWNLTPQRCLRILAMVRFVCPDV-EVRLAGGREVHLRSMQPLA----LHL
BIOB2_FRACC      PLGA------EWNLNPRQCLRILAMVRFVNPTA-EVRLSGGREIHLGSMQPLA----LSV
BIOB_NOCSJ       PSER------TFELTPIRCVQILAMTRFVCPDT-EIRIAGGREMHLRSLQALA----LHV
BIOB_SACEN       PFEN------TWELSPTRCVKILAMARFVCPDK-EIRIAGGREMHLRSLQSIA----LQV
BIOB_KOCRD       PLAG------TWQLSPQKCLKILAVVRFVCPDK-EIRMAGGREMHLRSLQPLA----LHV
BIOB_RENSM       PLAD------TWLLTPVKCLQILCVARFVAPRS-ELRIAGSREMHLRSLQPLA----LHV
BIOB_CUTAK       PLAGG-----AQHITPQWCLKRLAMVRFAHPDS-EVRAAAGREQHIRTMQPLA----LEV
BIOB_ACAM1       PIYD------CNQLTPQRCLRILCLFRFVNPKA-EIRIGGGREGHLRSLQALA----LYP
BIOB_MAGMM       QLGA------VDQLTPAYALRALALFRFFNPDA-EVRAAGGRESNLRGMESMA----LYP
BIOB_LEPBA       AIQK-------STLTPEFCVRVLSVFRLVNPDS-EIRVGAGREGHLGFLQSMA----LYV
BIOB_LEPBP       AIQK-------STLTPEFCVRVLSVFRLVNPDS-EIRVGAGREGHLGFLQSMA----LYV
BIOB_LEPBJ       AIKN------PGILTPELCVRILCLFRLVNPDS-EIRIAAGREGHLRSLSAMA----LFA
BIOB_LEPBL       AIKN------PGILTPELCVRILCLFRLVNPDS-EIRIAAGREGHLRSLSAMA----LFA
BIOB_LEPIC       TIKN------PSVLTPELCVRILCMFRLINPDS-EIRIAAGREGHLRSLSATA----LFA
BIOB_LEPIN       TIKN------PSVLTPELCVRILCMFRLINPDS-EIRIAAGREGHLRSLSATA----LFA
BIOB_THET2       PLGDGR---TVAGLTPERALKALILFRLLNPKA-ELRASAGRERYLGPYEPLA----FRM
BIOB_THET8       PLGDGR---TVAGLTPERALKALILFRLLNPKA-ELRASAGRERYLGPYEPLA----FRM
BIOB_STRA1       PLGK------YNYLTPIKCLKIMAMLRFVFPFK-ELRLSAGREVHFENFESLV----TLL
BIOB_STRA5       PLGK------YNYLTPIKCLKIMAMLRFVFPFK-ELRLSAGREVHFENFESLV----TLL
BIOB_STRA3       PLGK------YNYLTPIKCLKIMAMLRFVFPFK-ELRLSAGREVHFENFESLV----TLL
BIOB_CORGL       PFA------DRELMDSRDALRSIGAFRLAMPHT-MLRFAGGRELTLGDKGSEQ--ALLGG
BIOB_CORGB       PFA------DRELMDSRDALRSIGAFRLAMPHT-MLRFAGGRELTLGDKGSEQ--ALLGG
BIOB_COREF       PFA------DRPLMESEDALRAIGAFRLAMPHT-MIRFAGGRELTLGAEGSEQ--GLLGG
BIOB1_CORDI      PFA------DYEVLDTTDALRAIGAFRLALPKT-ILRFAGGRELTLGDLGTEQ--GLLGG
BIOB_CORU7       PFA------DYPVMAGSEALKTIGAFRLALPRT-TLRFAGGRELTLEDFGTEA--GLLGG
BIOB_CORJK       PFA------DLEPMPVNDALRTIGAFRLALPRQ-LLRFAGGRELTLGDLGAEK--GLLGG
BIOB_MYCBO       PFA------DLEVMPVGDALKAVAAFRLALPRT-MLRFAGGREITLGDLGAKR--GILGG
BIOB_MYCTU       PFA------DLEVMPVGDALKAVAAFRLALPRT-MLRFAGGREITLGDLGAKR--GILGG
BIOB_MYCTA       PFA------DLEVMPVGDALKAVAAFRLALPRT-MLRFAGGREITLGDLGAKR--GILGG
BIOB_MYCTF       PFA------DLEVMPVGDALKAVAAFRLALPRT-MLRFAGGREITLGDLGAKR--GILGG
BIOB_MYCBP       PFA------DLEVMPVGDALKAVAAFRLALPRT-MLRFAGGREITLGDLGAKR--GILGG
BIOB_MYCMM       PFG------DLEVLPAGEALKAVGAFRLALPRT-MLRFAGGREITLGDLGAKR--GILGG
BIOB_MYCUA       PFG------DLEVLPAGEALKAVGAFRLALPRT-MLRFAGGREITLGDLGAKR--GILGG
BIOB_MYCA1       PFG------DLEVMPATEALKSVAAFRLALPRT-MLRFAGGREITLGDLGAKK--GILGG
BIOB_MYCPA       PFG------DLEVMPATEALKSVAAFRLALPRT-MLRFAGGREITLGDLGAKK--GILGG
BIOB_MYCLE       PFG------ALEVMPPSEALKSVAAFRLALPRT-ILRFAGGREITLGDLGAKQ--GMLGG
BIOB_MYCLB       PFG------ALEVMPPSEALKSVAAFRLALPRT-ILRFAGGREITLGDLGAKQ--GMLGG
BIOB_MYCGI       PFG------DLEVLPATEALKAVAAFRLALPRT-MLRFAGGREITLGDLGAKQ--GILGG
BIOB_MYCVP       PFG------DLEVLPASEALKAVAAFRLALPRT-MLRFAGGREITLGDLGAKQ--GILGG
BIOB_MYCSJ       PFG------DLEVLPAAEALKAVAAFRLALPRT-MLRFAGGREITLGDLGAKK--GILGG
BIOB_MYCSK       PFG------DLEVLPAAEALKAVAAFRLALPRT-MLRFAGGREITLGDLGAKK--GILGG
BIOB_MYCSS       PFG------DLEVLPAAEALKAVAAFRLALPRT-MLRFAGGREITLGDLGAKK--GILGG
BIOB_MYCS2       PFG------DLEVLPASEALKAVAAFRLALPRT-MLRFAGGREITLGDLGAKK--GILGG
BIOB_MYCA9       PFG------DLEVLPASDALRAVAAFRLALPRT-MLRFAGGREITLGDLGAKQ--GILGG
BIOB_NOCFA       PFG------DLEVLPASEALKAVAAFRLALPRT-ILRFAGGREITLGDLGAKQ--GILGG
BIOB_RHOJR       PFG------DLEVLPASEALKSVAAFRLALPRT-ILRFAGGREITLGDLGAKQ--GILGG
BIOB_FRAAA       PFG------DYPPVQPRDALRAIAAFRLALPRT-ILRYSGGREITLGDLEAQ---GMLGG
BIOB1_FRACC      PFG------DLPLVEPRDALRAIAAFRLAMPRT-ILRYSGGREITLGDLDVQ---GMLGG
BIOB_FRASN       PFG------DLPAVDSREALRTIAAFRLALPRT-ILRYAGGREITLGDLDVQ---GMLGG
BIOB_SALAI       PLG------DRPVVEGKDALRAIAAFRLAMPRT-ILRYAGGREITLGDLGTRS--GLLGG
BIOB_SALTO       PLG------DRSVVEGKDALRAIAAFRLAMPRT-ILRYAGGRELTLGDLGTRS--GLLGG
BIOB_PSECP       PLE------NQGLMDGKDALRAIAAFRLAMPRT-VLRYAGGRELTLGDLGTRE--GLLGG
BIOB_ARTS2       PLE------NQGIMDGKDALRAIAAFRLAMPRT-VLRYAGGRELTLGDLGTRE--GLLGG
BIOB_PAEAT       PLE------NQGIMDGKDALRAIAAFRLAMPRT-VLRYAGGRELTLGDLGTRE--GLLGG
BIOB_ACIC1       PFA------DLPVVSVAEALRAAAMFRLALPRT-ILRFAGGREITLGDAGTRD--ALRGG
BIOB_CENSY       PME------LQAPLPPGEAERFFALVRFLLPRS-VVKISGGREKALDD-DGRA--ILRGG
BIOB_NITMS       PLE------LQTDLPNSEIVRMFSVIRFLLPES-VIKISGGRETNLED-SGEE--LLQSG
BIOB_HELPY       PID-------AETLSADEALECVLLAKEFLPNA-RLMVAGGREVVFKDNDKKEAKLFEYG
BIOB_HELPH       PID-------AETLSADEALECVLLAKEFLPNA-RLMVAGGREVVFKDNDKKEAKLFEYG
BIOB_HELPS       PID-------TETLSADEALECVLLAKEFLPNA-RLMVAGGREVVFKDNDKKEAKLFEYG
BIOB_HELPG       PID-------AETLSADEALECVLLAKEFLPNA-RLMVAGGREVVFKDNDKKEAKLFEYG
BIOB_HELPJ       PID-------AETLSADEALECVLLAKEFLPNA-RLMVAGGREVVFKDNDKQEAKLFEYG
BIOB_HELP2       PID-------AETLSADEALECVLLAKEFLPNA-RLMVAGGREVVFKDNDKQEAKLFEYG
BIOB_HELAH       PID-------AETLSADEALECVLLAKEFLPNA-RLMAAGGREVVFKDNDKKEAKLFEYG
BIOB_HELHP       PLP-------MQTLSPQEALECVTLAREYLPNT-RLMIAGGREAVFGDNQKP---LFEAG
BIOB_WOLSU       PLE-------VEALAQEEALECVRLAREYLPSA-RLMIAGGREKVFGQAQKP---LFEAG
BIOB_ARCB4       PLV-------KNPLTKQEAFDLVKLARSYLPNQ-MLMIAGGRELMFGEEQYD---VFKHG
BIOB_NITSB       PLP-------QTTIDPSDALSIIQDMRKRVPNA-MIMVAGGRELVFGEQWPK---ILDAG
BIOB_NAUPA       PL--------KATHNKDFALKTVKRFANEFKEA-IIMLAGGREIVFGNEWTE---ALKVG
BIOB_CAMC1       RLD-------QPPLSADEALKIVRETKSALPET-RVMIAGGREKILGERQYE---IFENG
BIOB_CAMC5       KIK-------TPRLSVDEALKIVDDTVLALPNA-RIMIAGGREAVLGERQYE---IFDHG
BIOB_CAMFF       KIK-------QPLLSTDEALEIIRDTAKTLPQC-RIMVAGGREIVLGDRQYE---ILENG
BIOB_CAMJ8       KLQ-------VPRLSADEALKIVRDTKEALPQS-VVMVAGGREVVLQERQYE---IFQAG
BIOB_CAMJJ       KLQ-------VPRLNADEALKIVRDTKEALPQS-VVMVAGGREVVLRERQYE---IFQAG
BIOB_CAMJE       KLQ-------VPRLSADEALKIVRDTKEALPQS-VVMVAGGREVVLRERQYE---IFQAG
BIOB_CAMJR       KLQ-------VPRLSVDEALKIVRDTKEALPQS-VVMVAGGREVVLRERQYE---IFQAG
BIOB_CAMJD       KLQ-------TPRLSADEALKIVRDTKEALPQS-VVMVAGGREVVLQERQYE---IFQAG
BIOB_CAMLR       KLK-------QALLDPDEALNIIKDTKKDLPNA-HIMVAGGREVVLKERQYE---IFDAG
BIOB_SULDN       ELS-------PNPLSVDEALSLIKLTRAMIPDAQRIMVAGGRELMFGDRESE---IFANG
BIOB_SULNB       PIK-------TRNIGFEEALNIIRRAHTLLGEDRLLMVAGGRELLFNGKEDE---MFKAG
BIOB_METM6       KIYEKIKFGVISPINSIDALKSICIARIALPDK-VIRLCGGREHVLKDMQKYS---LFA-
BIOB_METMP       KIYEKIKSGDISPINSTDALKSICIARIALPNK-VIRLCGGREHVLKDMQKYS---LLA-
BIOB_METM5       KIYDRINSGDISPINSIGALKSLCIARITLPNK-VIRLCGGREHVLKDMQKYS---LLA-
BIOB_METM7       RIYDKINSGEFIEINHTDALKSICIARIALPKK-VIRLCGGREHVLKDMQKYS---LYV-
BIOB_METVS       KMREKINSKEIKSIEPIDALKSICISRIIMPER-VIRLCGGREYVLKDLQSLS---LLA-
BIOB_META3       KTYELLNNNAIKQITPIEALKSIAICKLILPNK-DVRLCGGREYNLRDWQSLS---LLA-
BIOB_METJA       KAYEKIKNGEIKPISVSDALKLIALYKIIMPYA-EIRLAGGRIYNLRDFQSYA---LMV-
BIOB_CALBD       PL------EDIKIIDKNEIFITLALFRIVLPKK-TILLAGGKENALGDMEKMA---YECG
BIOB_CALS8       PF------EDMKIMDQNEIFITLALFRIVLPRK-TILLAGGKENALKDMEKIA---YKCG
BIOB_AQUAE       PME------NAPGVEVMEALKIIAMFRFTNPKA-ELRLCGGREQNLRDFHGMA---TLM-
BIOB_HYDS0       PLE------NNKPLRALDALKIIAMFRFINKSA-ELRLCGGREQTLGDFHGMA---AFM-
BIOB_PERMH       PLE------GNKQLTPQRCLKIISLFKLFNPQA-ELRLCGGREINLREYHDTA---MEI-
BIOB_SULSY       PLG------DKHNLTPLRCLKIIALFRLFNPKS-EIRLCGGRELNLKDYHDIA---FEV-
BIOB_UNCTG       ALE------HLPALPPVEILKTIAVFRIILKTP-DIMICGGREVNLRDLQSWI---FQAG
BIOB_THENN       PFE------NFPELDVVERIKTIAAFRIVLGENVTIKIAAGREK-LGDFQALA---FFAG
BIOB_THEP1       PFE------NFQKLDVVERIRTIAMFRVVLGENVTIKIAAGRED-FGDFQALA---FFAG
BIOB_THEYD       PLE------SKKPLNPMEALRIIILFRLILPDK-DIRVCGGRPL-LGEFASWI---FIAG
BIOB_DESDA       PLAG------QPPLTAGEALRIVAVFRHILPTA-TLRICGGRPLVLGARQKEI---FAAG
BIOB_ALKMQ       TYE------DLEPLTEDEILRTVAMFRFINPTA-NIRLAAGRSLMEDSG-RRA---FHAG
BIOB_CLOB8       PLE------NLKRISNYDILRTIAIFRYINPTA-YIRMAAGRTYFEDGG-IEI---FQSG
BIOB_CLOB1       PLE------NQEILSYEEIIKTLALFRFILPTV-QIRLAGGRTIISDKG-KKA---LESG
BIOB_CLOBH       PLE------NQEILSYEEIIKTLALFRFILPTV-QIRLAGGRTIISDKG-KKA---LESG
BIOB_CLOBK       PLE------NQEILSYEEIIKTLALFRFILPTV-QIRLAGGRTIISDKG-KKA---LESG
BIOB_CLOBL       PLE------NQEILSYEEIIKTLALFRFILPTV-QIRLAGGRTIISDNG-KKA---LESG
BIOB_CLOBM       PLE------NQEILSYEEIIKTLALFRFILPTV-QIRLAGGRALLSDKG-KKV---LESG
BIOB_CLOBA       ALE------NQEKLSYDEITKTFALFRFILPEK-QIRLAGGRALLNDKG-ERL---MKSG
BIOB_CLOBB       ALE------NQEKLSYDEITKTFALFRFILPKK-QIRLAGGRALLNDKG-ERL---MKSG
BIOB_BRAHW       PFE------NIEPLTEDDMRRIVAIYRFINPRA-FIRLAGGRGLMKDKG-KSC---FLSG
BIOB_AKKM8       PYA------DMTPLGEEEQLRIVALVRFIMPDG-FVRIAAGRNTMKDHG-RKI---FMSG
BIOB2_CORDI      PLA------GTEQLRPEEVQRCVAIFRFILPQA-AIRLAGGRELLGDDG-KAC---FQSG
BIOB_CAMHC       PLE------NSAPLCVDEILRSIAIFRLILPHV-FLRLAGGRNNLKNSV-KTA---LNGG
BIOB_FUSNN       PFE------NNEEVNPFEILKTISIYRFIMPKS-FLRYCGGRIKLGEHA-KTG---LRCG
BIOB_CLOD6       PME------NYDVLEPMEILKTTAVFRFIIPNV-YIRYAGGRLSLKGYD-KVG---FNGG
BIOB_HUNT2       PFE------NVRSLSPDEILRTIALFRLIMPYA-HIRYAGGRMCLGEHQ-SKG---FKAG
BIOB_CLOK1       PLE------SAPKLSQNEILKTIAIFRFVNSKA-FIRLAGGRNLIDGFG-ENC---FYAG
BIOB_CLOTE       PLE------YTKRLEQNDILKTIAIFRFINPKA-SIRLAGGRNLIDNFG-KGC---FRAG
BIOB_CLONN       PLE------NQRKLNNEEILKTIAIFKFINPKA-DIRLAGGRGSLENYG-EEA---FLSG
BIOB_CLOP1       KLQ------HMIPLNEEEILRTIAVFRFINPEA-KIRLAGGRYLLKNFG-ENA---FKAG
BIOB_CLOPE       KLQ------NMIPLNEEEILRTIAVFRFINPEA-KIRLAGGRYLLKNFG-ENA---FKAG
BIOB_PORG3       PLE------KTPPLSEEEYLTTVALFRLINPRA-FLRFSGGRAQLSPAVQRKA---IYIG
BIOB_PORGI       PLE------RTLPLSEEEYLTTVALFRLINPRA-FLRFSGGRAQLSPAVQRKA---IYIG
BIOB_PARD8       PME------NTQILEEEEWLTTIALFRLINPNA-FLRFSGGRAQLSEVTQRKS---LHIG
BIOB_CROS5       PLG------HLPKLDVFDALKAIAIFRFLLPEQ-ILRYAGGREAVMGELQSLG---LKSG
BIOB_RIPO1       PLG------DCHRLDPFEALKAIAIFRLILPQQ-ILRYAGGREAIMGDLQSLG---LKSG
BIOB_GLOC7       PLG------HLPKLDPFEALQAIAIFRFILPQQ-ILRYAGGREAIMGELQSLG---LKAG
BIOB_MICAN       PLG------HLPKLEPFTALKAIAIFRFILPQQ-ILRYAGGREAVMGELQNLG---LKSG
BIOB_TRIEI       PLG------GLLKLDPYDALKAIAIFRLILPKQ-IIRYAGGREAVMGDLQALG---LKAG
BIOB_SYNY3       PLG------EQQKLNPYDALKAIAIFRFILPQQ-IIRYAGGREAVMGELQDLG---LKAG
BIOB_CYAP4       LLG------EQSKLDPFTALKAIAIFRLILPQQ-IIRYAGGREAVMGELQALG---LKAG
BIOB_SYNP2       PLG------SNDRLDVYEALKCMAIFRFILPEQ-IIRYAGGREAVMGELQHLG---LKAG
BIOB_CARHZ       KLE------NRPLLSPLEVIKTFAIFRFILPDK-NIRYAGGREVNLRDMQALG---LMAG
BIOB_CLOAB       KLE------NAKPLSPMEIIKTFAIIRFILPDK-IIRYAGGREKNLRSLQPLG---FLSG
BIOB_DESAP       PLA------TQPPLPALEILRTLAVFRLLLPAT-TIRYAGGREHNLRDTQVLG---LAGG
BIOB_PELTS       PLW------GRPLLEPVEVLRTAAMFRLVLPGA-LIRLCGGREAALRDLQPLA---LLAG
BIOB_HELMI       PLE------GQPLIPPLEILKSIALYRLILPSA-RIRMAGGREGALRDLQSLP---FIAG
BIOB_DESPS       PFA------DLPALTEREILITFALFRLINPRA-IVRTAGGRNLLAGQQKKL----FLAG
BIOB_DESRM       PLA------GQQIMSSQDIIKTICLFRLILPTI-SLRFGGGIKESLGELRVLG---FPAG
BIOB_ANAD2       PMA------HLKAITPEECLAAVAVFRLMMPAA-HIFVMGGREVNLGDRQDLI---FRAG
BIOB_ANASK       PLA------HLKAITPEECLAALAVFRLMMPAA-HIFVMGGREVNLGDRQDLI---FRAG
BIOB_ANADE       PME------HLKAITPEECLAALAVFRLMMPAA-HIFVMGGREVNLGDRQHLI---FRAG
BIOB_ANADF       PME------HVQAITAEECLAAVAVFRLMMPAA-HIFVMGGREVNLGGRQHLI---FRAG
BIOB_DESVH       PLQ------HRPTMPPMRALVSIAIYRLMHPAR-DILVCGGREATLGPWQSWI---FLAG
BIOB_DESVV       PLQ------HRPTMPPMRALVSIAIYRLMHPAR-DILVCGGREATLGPWQSWI---FLAG
BIOB_DESVM       RLG------HRSPLPPMEALRAIAVFRLLHPQR-DILVCGGRETTLGQWQSWV---FAAG
BIOB_DESAG       PLE------RMDPLPPFEALRTIAVFRFMHPQA-DILVAGGREHVLGEYRSWT---FISG
BIOB_GEOMG       RLA------GSKLISPLECLKTIALFRLILPTK-KIAVCGGREQNLRDLQSWI---FFAG
BIOB_GEOSL       PLA------GADRITPLECLKTIAVYRLILPDR-KIAVCGGRERNLRDLQSWM---FFAG
BIOB_GEODF       KLE------NAENITPMECLQTIALFRLILPTK-RISICGGREKNLRDLQSWI---FFAG
BIOB_GEOUR       RLE------NAVNITPMECLQTIALFRMILPSK-KISVCGGREKNLRDLQSWI---FFAG
BIOB_GEOBB       RLE------GAANITAQECLKTIAIYRLILPGK-RITVCGGREKNLRDLQSWI---FFAG
BIOB_PELPD       RLE------KADFLTPLECLKTIAIYRFMLPGK-SLSVCGGRETNLRELQSWI---FLAG
BIOB_GEOLS       PLA------VMQQLTSLDCLHTIALYRLILPDV-HITICGGRQRNLRELQSWV---FLAG
BIOB_PELCD       PLA------DATPLEPMEALKIIALYRYLMPDR-HITVCGGRGVTLGDFQSWI---FQAG
BIOB_SYNAS       RMA------DRSLLPPMEALQVIALYRFIHPAK-PLLICGGREITLRDFQSWI---FLAG
BIOB_DESAL       RLE------KSSDLSPLRCLKIISLLRFALGGK-EIVICGGRESNLEELHPLV---FYAG
BIOB_DESOH       AME------KASRLTPLRCLRIIAFLRHVLPDK-EIIVCGGRVHNLGDLHPLV---FYAG
BIOB_SYNFM       RLE------ARPPMKPLDMIRSIAMFRMMNPKA-EVKVCAGR-VRMGDLQAVI---FYAG
BIOB_CHLCH       PLEK------SEPLSAAEVLKTFAICRLLHPRTIIKFAAGRETMMK-DFQGLL---MLAG
BIOB_PELPB       PLAG------KEPLSVAEIVKTFAICRLAHPHKIIKFAAGRETIMK-DFQGLL---MLSG
BIOB_CHLP8       PLEG------AAPVSVPEIAKTFAICRLAHPSKIIKFAAGRETVMK-DFQGLL---MLAG
BIOB_CHLTE       PLEG------AAPVSVPEIAKTFAICRLAHPTKIIKFAAGRETVMK-DFQGLL---MLAG
BIOB_CHLL2       PLEG------HRTADIADIVKTFAICRLVHPRTIIKFAAGRETVMK-DFQGLL---MLSG
BIOB_PELLD       PLEG------APSLPLDEIVKTFAIMRLVHPRKTIKFAAGRETVMK-DFQGLL---MLSG
BIOB_CHLPM       PLQA------AESVPLADIVKVFALARLVHPHSIIKFAAGRETLMK-DFQGLL---MLSG
BIOB_CHLPD       PLEG------SPGIPLDDIVKTFALCRLVHPRKIIKIAAGRETVMK-DFQGLL---MLSG
BIOB_CHLPB       PLQG------AATPALTDIVKTFALCRLVHPGKIIKFAAGRETVMN-DFQGLL---MLAG
BIOB_PROA2       PLEG------SLPLAVSDIVKTFALCRLAHPDKVIKFAAGRETVMK-DFQGLL---MLAG
BIOB_NATPD       PIGDR----EAATISRTELIKTIAVYRFLHPEARVRLTGGREVNLDPDEQHLP---FEAG
                                                                             

BIOB_FRAT1       INSIFYGN--KLLTENN--ATVNSDNFLLAKLGLKSNAELC-------------------
BIOB_FRATT       INSIFYGN--KLLTENN--ATVNSDNFLLAKLGLKSNAELC-------------------
BIOB_FRATN       INSIFYGN--KLLTENN--ATVNSDNFLLAKLGLKSNAELC-------------------
BIOB_FRATW       INSIFYGN--KLLTENN--ATVNSDNFLLAKLGLKSNAELC-------------------
BIOB_FRATM       INSIFYGN--KLLTENN--ATVNSDNFLLAKLGLKSNAELC-------------------
BIOB_FRATF       INSIFYGN--KLLTENN--ATVNSDNFLLAKLGLKSNAELC-------------------
BIOB_FRATH       INSIFYGN--KLLTENN--ATVNSDNFLLAKLGLKSNAELC-------------------
BIOB_FRATO       INSIFYGN--KLLTENN--ATVNSDNFLLAKLGLKSNAELC-------------------
BIOB_FRAP2       INSIFYGN--KLLTENN--ATINSDNFLLAKLGLESNVELC-------------------
BIOB_COXB1       ANSIFYGD--KLLTAKN--PGQNRDVNLLKKLGLKVPVLTEEYACY--------------
BIOB_COXB2       ANSIFYGD--KLLTAKN--PGQNRDVNLLKKLGLKVPVLTEEYACY--------------
BIOB_COXBN       ANSIFYGD--KLLTAKN--PGQNRDVNLLKKLGLKVPVLTEEYACY--------------
BIOB_COXBR       ANSIFYGD--KLLTAKN--PGQNRDVNLLKKLGLKVPVLTEEYACY--------------
BIOB_COXBU       ANSIFYGD--KLLTAKN--PGQNRDVNLLKKLGLKVPVLTEEYACY--------------
BIOB_LAWIP       ANSIFYGG--RLLTTDG--PQPEQDDLLFQKIGLEKVQTICH------------------
BIOB_RICFE       VYSIFYGE--KILTSAN--PMPERDNDLFQKLGIIH------------------------
BIOB_NEOSM       ANSIFYGE--KLLTSAN--SDPESDEKLLLKLGLLREKSKTAVDCSINLGS---------
BIOB_ANAMF       ANSIFCGE--KLLTTPN--ARPEDDQRLFSQLGITPSRAACTTSDAQLA-----------
BIOB_ANAMM       ANSIFCGE--KLLTTPN--ARPEDDQRLFSQLGITPSRAACTTSDAQLA-----------
BIOB_ANAPZ       ANSIFYGE--QLLTTEN--ATPEFDQNLLSRLGVVATPSGAHESCAC-------------
BIOB_EHRCJ       ANSIFYGE--KLLTTPN--ADCNDDRNLLSKLGAKTKEPVFFNS----------------
BIOB_EHRCR       ANSIFYGE--KLLTTPN--SNCDDDKNLLSKLGIKTKEPVLLNSQN--------------
BIOB_EHRRG       ANSLFYGE--KLLTTPN--ADCNDDKNLLSKLGVKTKQAVFFDS----------------
BIOB_EHRRW       ANSLFYGE--KLLTTPN--ADCNDDKNLLSKLGVKTKQAVFFDS----------------
BIOB_AGRRK       ANSVFYGD--TLLTTPN--AGIGEDAELFAAIGELDCDHVSASAA---------------
BIOB_AGRVS       ANSVFYGD--TLLTTPN--AGIGEDEALFAAIGALPHEAAPLAAE---------------
BIOB_RUEPO       ANSVFYGD--VLLTAPN--AGTGADAELFAALGALETA----------------------
BIOB_BEII9       ANSIFSGN--VLLTTPN--ASLDADEALMEALAPR-------------------------
BIOB_METSB       ANSIFYGE--QLLTTPN--VGETDDDALFAALAPQCQLKDALPTD---------------
BIOB_ZYMMO       ANSIFYGN--VLLTTPN--ADMAADDALLEALGVTAE-----------------------
BIOB_METC4       ANSIFYGE--RLLTTAN--NEADADAELLRDIGVPVPEVTLAAAE---------------
BIOB_METEP       ANSIFYGE--RLLTTAN--NEADADAELLRDIGVPVPEVTLAAAE---------------
BIOB_METPB       ANSIFYGE--RLLTTAN--NEADADAELLRDIGVPVPEVTLAAAE---------------
BIOB_METRJ       ANSIFYGE--RLLTTAN--NGQDDDAALLADLGIRVGEPVRAAAE---------------
BIOB_METNO       ANSIFYGE--RLLTTAN--NEADADAQLLRDIGVPVPGIEVLEAAE--------------
BIOB_METS4       ANSIFYGE--RLLTTAN--TDADADAQLLRDIGVPVPAISALEAAE--------------
BIOB_PROM2       ANSIFYGD--ELLTTSN--PSFQSDRKLLKEVGVSFNKDFETREKTLSSL----------
BIOB_PROM9       ANSIFYGD--ELLTTSN--PSFQSDRKLLKEVGVSFNKDFETREKTLFSL----------
BIOB_PROMS       ANSIFYGD--ELLTTSN--PSFQSDRKLLKEVGVSFNKDFETCEKTLSSL----------
BIOB_PROM0       ANSIFYGD--ELLTTSN--PSFQSDRKLLKEVGVSFNKDFETCEKTLSSL----------
BIOB_PROM5       ANSIFYGD--ELLTTSN--PSFQDDRKLLKDVGVLFNKDFEYCDKTVSTV----------
BIOB_PROMP       ANSIFYGD--ELLTTSN--PSFQDDRKLLKDVGVLFNKDFEYCDKTVSTV----------
BIOB_PROM1       ADSIFYGD--TLLTTSN--PEVEADRKLLADAGITANFS---------------------
BIOB_PROMT       ADSIFYGD--TLLTTSN--PEVEADRKLLADAGITANFS---------------------
BIOB_PROM4       ADSIFYGD--TLLTTSN--PAIQADRELLSKAGVQVNWSLHE------------------
BIOB_PROMA       ADSIFYGD--TLLTTSN--PSIKADRELLASAGVSVNWDLYD------------------
BIOB_PROM3       ADSIFYGD--SLLTTSN--PDVKTDRELLSQAGVHANWEESDE-----------------
BIOB_PROMM       ADSIFYGD--SLLTTSN--PDVKTDRELLSQAGVHANWEESDE-----------------
BIOB_SYNPW       ADSIFYGD--SLLTTSN--PAVESDRALLAAAGVQASWHESAAA----------------
BIOB_SYNS3       ADSIFYGE--TLLTTGN--PAVEADRELLRTAGVQANWLSASEKLAA-------------
BIOB_SYNPX       ADSIFYGD--TLLTTGN--PDVEADRQLLADAGVQANWQECQTTA---------------
BIOB_SYNSC       ADSIFYGD--VLLTTGN--PDVEADRQLLSDAGVTANWQEETAAPVNCSPR---------
BIOB_SYNS9       ADSIFYGD--LLLTTGN--PDVEADRRLLADAGVQANWQENASSLAIKAPAST-------
BIOB_SYNR3       ADSIFYGD--SLLTTSN--PAVQADQALLAAAGVSSSLEGVAAA----------------
BIOB_SYNE7       ANSIFYGD--TLLTTAN--PVCEADRQLLADIGAEALEVVTA------------------
BIOB_SYNP6       ANSIFYGD--TLLTTAN--PVCEADRQLLADIGAEALEVVTA------------------
BIOB_SORC5       ANSIFYGD--RLLTTPN--PGQDEDRALIEKAGLQPMAPAAARAAR--------------
BIOB_MYXXD       ANSLFFGE--KLLTTGN--PEYTQDMALLEKAGIRPLEPRQEG-----------------
BIOB_GLOVI       ANSIFTGP--KLLTTPN--PEHSHDQKLLEKLGMEPKTTQ--------------------
BIOB_SYNJA       ANSIFTGE--RLLTTPN--PGQAADAALLEKLGLQPL-----------------------
BIOB_NOSS1       ANSIFSSDDNKMLTVTTPCPDYDADQEMLNLLGLEMRPPSQRPQ----------------
BIOB_TRIV2       ANSIFSSDDNKMLTVTTPCPDYDADQEMLNLLGLEMRPPSQRPQ----------------
BIOB_NOSP7       ANSIFSSDDNKMLTVTTPCPDYDTDREMLNLLGLGMRPPSQRQEK--------------V
BIOB_CHLAB       ANSIFYGE--KLLTVDN--NDMDADTAMLNLLGMRHRPSFSMER----------------
BIOB_CHLFF       ANSIFYGE--KLLTVDN--NDMDEDTAMLNLLGMRHRPAFSRKQ----------------
BIOB_CHLPN       ANSIFYGD--KLLTVEN--NDIDEDAEMIKLLGLIPRPSFGIER----------------
BIOB_FLAJ1       ANSIFAGD--KLLTTPN--PDVNEDMKMFETLGMVAQKPFIKIMQPKTVEAADSQFAPLG
BIOB_FLAPJ       ANSIFAGD--KLLTTPN--PDVNEDMKMFEMLGLNPQKPFTKVSQPTTVEAKDSRYESLG
BIOB_GRAFK       ANSIFAGD--KLLTTPN--PDVSEDMEMFKMLGLNPQKAFEKKSQPESVAAEKSKYQSQG
BIOB_CYTH3       ANSIFAGD--KLLTTPN--PEVNADKEMFQVLNLKPRQSFKN-----------------G
BIOB_HYDCU       ANSIFYGD--KLLTTDN--PEAGHDEQLFAKLGIQMQQNAKVEAAAKKLAEQTTELTA--
BIOB_BRUA1       ANSLFMGD--TLLTAAN--PGDDRDSSLLRRLGIQAETEQPA------------------
BIOB_BRUA2       ANSLFMGD--TLLTAAN--PGDDRDSSLLRRLGIQAETEQPA------------------
BIOB_BRUAB       ANSLFMGD--TLLTAAN--PGDDRDSSLLRRLGIQAETEQPA------------------
BIOB_BRUC2       ANSLFMGD--TLLTAAN--PGDDRDSSLLRRLGIQAETEQPA------------------
BIOB_BRUMB       ANSLFMGD--TLLTAAN--PGDDRDSSLLRRLGIQAETEQPA------------------
BIOB_BRUME       ANSLFMGD--TLLTAAN--PGDDRDSSLLRRLGIQAETEQPA------------------
BIOB_BRUSI       ANSLFMGD--TLLTAAN--PGDDRDSSLLRRLGIQAETEQPA------------------
BIOB_BRUSU       ANSLFMGD--TLLTAAN--PGDDRDSSLLRRLGIQAETEQPA------------------
BIOB_BRUO2       ANSLFMGD--TLLTAAN--PGDDRDSSLLRRLGIQAETEQPA------------------
BIOB_OCHA4       ANSIFIGD--TLLTAAN--PGEDRDTSLMRRLGLTADTLDNHA-----------------
BIOB_AGRFC       ANSIFIGE--TLLTADN--PGEDHDTALFRRLGLKPMELQSSEAGGCR------------
BIOB2_PARDP      ANSIFVGD--TLLTAGN--PDEDKDALLFAKLGLRAEVPEASQEGCAA------------
BIOB_LEGPA       ANSVFIGD--KLLTEDN--PQRFKDKTLFNKLGLTEMV----------------------
BIOB_LEGPH       ANSVFIGD--KLLTEDN--PQRFKDKTLFNKLGLTEMV----------------------
BIOB_LEGPL       ANSVFIGD--KLLTEDN--PQRFKDKTLFNKLGLTEMV----------------------
BIOB_LEGPC       ANSVFIGD--KLLTEDN--PQRFKDKTLFNKLGLTEMA----------------------
BIOB_RUTMC       ANSIFYGE--QLLTTDN--PNINSDKDLFARLGINQKKVNNLQSV---------------
BIOB_VESOH       ANSIFYGE--QLLTTDN--PNTDSDQDLFVRLGINQKQANNLQSV---------------
BIOB_HAEI8       ANSIFYGD--KLLVTDN--PEEDGDQLLMAKLDLEPETAENKKL----------------
BIOB_HAEIE       ANSIFYGD--KLLVTDN--PEEDGDQLLMAKLDLEPETAENKKL----------------
BIOB_HAEIN       ANSIFYGD--KLLVTDN--PEEDGDQLLMAKLDLEPETAENKKL----------------
BIOB_HAEIG       ANSIFYGD--KLLVTDN--PEEDGDQLLMAKLDLEPETAENKK-----------------
BIOB_HAES1       ANSIFYGD--KLLVTVN--PEEDGDQLLMAKLDLKPETQENK------------------
BIOB_HISS2       ANSIFYGD--KLLVTVN--PEEDGDQLLMAKLDLKPET----------------------
BIOB_PASMU       ANSIFYGD--KLLVTGN--PEEDGDQRLMAKLDLEPETEENRYRAE--------------
BIOB_ACTSZ       ANSIFYGD--KLLVTGN--AEEDRDQLLMAKLDLEPETAENRRVSVQPER----------
BIOB_MANSM       ANSIFYGD--KLLVTGN--AEEDCDRLLMEKLDLEPETTENRYLSQNN------------
BIOB_ACTP7       ANSIFYGE--KLLTTCN--PEEDSDRLLMDKLDLYPLAYEPSDA----------------
BIOB_ACTPJ       ANSIFYGE--KLLTTCN--PEEDSDRLLMDKLDLYPLAYEPSDA----------------
BIOB_ACTP2       ANSIFYGE--KLLTTCN--PEEDSDRLLMDKLDLYPLAYEPSDA----------------
BIOB_HAEDU       ANSIFYGE--KLLTTCN--PEEDADCLLMQKLDLYPLQYQEC------------------
BIOB_HAEPS       ANSIFYGD--KLLTTEN--PEEDGDRVLMEKLNLYPLSCSNVE-----------------
BIOB_NEIG1       ANSIFYGD--KLLTTGN--PDEDGDRILMEKLNLYPLQFEPEGEVAEVEKASGIKADY--
BIOB_NEIG2       ANSIFYGD--KLLTTGN--PDEDGDRILMEKLNLYPLQFEPEGEVAEVEKASGIKADY--
BIOB_NEIM0       ANSIFYGD--KLLTTGN--PDEDGDRILMEKLNLYPLQFELEGEVAEVEKASGIKVDY--
BIOB_NEIMF       ANSIFYGD--KLLTTGN--PDEDGDRILMEKLNLYPLQFELEGEVAEVEKASGIKVDY--
BIOB_NEIMA       ANSIFYGD--KLLTTGN--PDEDGDRILMEKLNLYPLQFELEGEVAEVEKASGIKVDY--
BIOB_NEIMB       ANSIFYGD--KLLTTGN--PDEDGDRILMEKLNLYPLQFEPEGEVAEVEKASGIKVDY--
BIOB_CHRVO       ANSIFYGD--KLLTTGN--PDVVADQSLMAKLNLQPL-----------------------
BIOB_METSK       ANSIFYGE--KLLTTGN--PEAEADRKLFDKLGIHPL-----------------------
BIOB_METFK       ANSIFYGE--KLLTTGN--PEAEADRKLFDKLGIHPL-----------------------
BIOB_THIDA       ANSIFYGE--KLLTTGN--PEWERDQRLFDSLGVTAL-----------------------
BIOB_NITEC       ANSIFYGD--KLLTTGN--PDTEQDAALLEKLGLHAL-----------------------
BIOB_NITEU       ANSIFYGD--KLLTTGN--PDTEKDLALFEKLGLHAL-----------------------
BIOB_NITMU       ANSIFYGD--KLLTTGN--PEAERDKALFDRLGLHSI-----------------------
BIOB_ACISJ       ANSIFYGD--KLLVTGN--PDVEADTQLLAKLGLKGTPNQTTTETACGA-----------
BIOB_ACIET       ANSIFYGD--KLLVTSN--PDVEADTQLLAKLGLKGTPNQTTTETACGA-----------
BIOB_DELAS       ANSIFYGD--KLLVTGN--PDVEADTTLLRKLGLSGTRTSVQE-----------------
BIOB_ACIAC       ANSIFYGD--KLLVTGN--PDVDADVQLLAKLGMNGRQVASTEPHDLHHHAP--------
BIOB_METPP       ANSIFYGD--KLLTTGN--PDVERDEALFERLGLTSA-----------------------
BIOB1_POLSJ      ANSIFYGD--KLLTTGN--PDTEADVTLLQRLGMSRSAPDVR------------------
BIOB_HERAR       ANSIFYGD--KLLTTGN--PEALADQELLEKLGMHTRSTAIDARCDVTPS----------
BIOB_JANMA       ANSIFYGD--KLLTTGN--PEAMADQELLEKLGMHTRSTAIDARCDVTPS----------
BIOB_RHOFT       ANSIFYGD--KLLTTGN--PEAGDDLALLAKLGLKTHASTLTEAQKERCGG---------
BIOB_POLAQ       ANSIFYGE--QLLTTGN--PEAEQDLALLAELGLKTKQSCKAEVLV--------------
BIOB_BORBR       ANSIFYGD--VLLTTGN--PQVEADRRLLQRLGMRAEGLPCAAGQA--------------
BIOB_BORPA       ANSIFYGD--VLLTTGN--PQVEADRRLLQRLGMRAEGLPCAAGQA--------------
BIOB_BORPE       ANSIFYGD--VLLTTGN--PQVEADRRLLQRLGMRAEGLPCAAGQA--------------
BIOB_BORPD       ANSLFCGD--VLLTTGN--PQVEADQRLLERLGMHAEGALPALPQATPA-----------
BIOB_BORA1       ANSIFYGA--SLLTTGN--PQVQADRALMSKLGMRPETV---------------------
BIOB_BURCM       ANSMFYGD--QLLTTSN--PQSQKDRALFERLGIRASDADAMQANA--------------
BIOB_BURL3       ANSMFYGD--QLLTTSN--PQSQKDRALFERLGIRSSDADAMSANA--------------
BIOB_BURA4       ANSMFYGD--QLLTTSN--PQTQRDRALFERLGIRASDADAMQANA--------------
BIOB_BURVG       ANSMFYGD--QLLTTSN--PQSQKDRALFERLGMRASDADAMSADA--------------
BIOB_BURM1       ANSMFYGD--QLLTTSN--PQTQKDRALFERLGIRASEADAMSADA--------------
BIOB_BURCA       ANSMFYGD--QLLTTSN--PQTQRDRALFERLGIRASQADALSDNA--------------
BIOB_BURCC       ANSMFYGD--QLLTTSN--PQTQRDRALFERLGIRASQADALSDNA--------------
BIOB_BURCH       ANSMFYGD--QLLTTSN--PQTQRDRALFERLGIRASQADALSDNA--------------
BIOB_BURCJ       ANSMFYGD--QLLTTSN--PQTQRDRALFERLGIRASQADALSDNA--------------
BIOB_BURM7       ANSMFYGD--VLLTTGN--PRAEADRKLLARLGMSASEASQLSA----------------
BIOB_BURM9       ANSMFYGD--VLLTTGN--PRAEADRKLLARLGMSASEASQLSA----------------
BIOB_BURP6       ANSMFYGD--VLLTTGN--PRAEADRKLLARLGMSASEASQLSA----------------
BIOB_BURMA       ANSMFYGD--VLLTTGN--PRAEADRKLLARLGMSASEASQLSA----------------
BIOB_BURMS       ANSMFYGD--VLLTTGN--PRAEADRKLLARLGMSASEASQLSA----------------
BIOB_BURP0       ANSMFYGD--VLLTTGN--PRAEADRKLLARLGMWASEASQLSA----------------
BIOB_BURPS       ANSMFYGD--VLLTTGN--PRAEADRKLLARLGMWASEASQLSA----------------
BIOB_BURP1       ANSMFYGD--VLLTTGN--PRAEADRKLLARLGMWASEASQLSA----------------
BIOB_BURTA       ANSMFYGD--VLLTTGN--PRAEADRKLLARLGMSATEATQLSA----------------
BIOB_PARPJ       ANSIFYGD--QLLTTSN--PQAEADRKLLERLGIRAEAAQQMPLDQSGCEHSCDKHAAPN
BIOB_PARXL       ANSIFYGD--QLLTTSN--PQAEADRKLLERLGIRAEAAQQMPLDQSGCEHGCDKHAAPN
BIOB_PARP8       ANSIFYGD--QLLTTSN--PQAEADRKLLARLGIRAEAAQQMPAERE-CSHGCEGH----
BIOB_CUPTR       ANSIFYGE--KLLTTGN--PQADRDRALLARLDIRAEGYAG-------------------
BIOB_CUPNH       ANSIFYGE--KLLTTGN--PQADRDRALLARLDIRAEGYAG-------------------
BIOB_CUPPJ       ANSIFYGE--KLLTTGN--PQADRDRALLARLDIRAEGYAG-------------------
BIOB_CUPMC       ANSIFYGE--KLLTTGN--PQADRDRALLARLDIRAEGYAG-------------------
BIOB_POLNA       ANSIFYGD--RLLTTSN--PQADKDRQLFARLGLKVQGERPAATVQG-------------
BIOB2_POLSJ      ANSIFYGD--KLLTTSN--PQADRDRQLFERLGLKTQGARPAAQQAQ-------------
BIOB_LEPCP       ANSIFYGD--KLLTTSN--PQAARDRALFERLGLRVQGERPAVRTSDN------------
BIOB_RALPJ       ANSIFYGE--KLLTTDN--PEADADRKLLARLGMRVEVQDHMHH-ESHVGAQSSHCHIDI
BIOB_RALSO       ANSIFYGE--KLLTTDN--PEADADRKLLARLGMRVEVQDHLHQAEGAQHSHSSHCHIDI
BIOB_AZOSB       ANSIFYGE--RLLTTDN--PESDRDDVLFARLGLRSV-----------------------
BIOB_AROAE       ANSIFYGD--RLLTTDN--PDTDRDEALFARLGLRPV-----------------------
BIOB_DECAR       ANSMFYGD--FLLTTGN--PDIERDDALFARLGVKAI-----------------------
BIOB_GLUDA       ANSIFYGE--KLLTTPN--PEASRDARLLARLGMHTSLAQA-------------------
BIOB_GLUOX       ANSIFCGE--KLLTTPN--PAEHRDRQLLSALGMSPMVQSEAEMGTMRPAVTEDAVCEMA
BIOB_GRABC       ANSIFYGE--KLLTTGN--PAAERDRALLSRLGMRLV-----------------------
BIOB_ACICJ       ANSIFYGD--TLLTTAN--PAVARDNALFDRLGMTKLS----------------------
BIOB_STRM5       ANSIFYGD--KLLTTGN--PESERDLALFARLGLQPMAVQVDAEGHD-HGGTVHADISAD
BIOB_STRMK       ANSIFYGD--KLLTTGN--PESERDLALFARLGLQPMAVQVDAEGHD-HGGTVHADISAD
BIOB_XANAC       ANSIFYGE--KLLTTGN--PDTERDQALFQRLGLRPMQVTVDAAEHD-HPGTVHAEITRS
BIOB_XANC5       ANSIFYGE--KLLTTGN--PDTERDQALFQRLGLRPMQITVDAAEHD-HPGTVHAEITRS
BIOB_XANOM       ANSIFYGE--KLLTTGN--PDTERDQTLFQRLGLRPMQITVDAAEHD-HPATVHAEITRS
BIOB_XANOP       ANSIFYGE--KLLTTGN--PDTERDQTLFQRLGLRPMQITVDAAEHD-HPATVHAEITRS
BIOB_XANOR       ANSIFYGE--KLLTTGN--PDTERDQTLFQRLGLRPMQITVDAAEHD-HPATVHAEITRS
BIOB_XANC8       ANSIFYGE--KLLTTGN--PDTERDQGLFQRLGLRPMQITVDAAEHD-HPGTVHADITCG
BIOB_XANCB       ANSIFYGE--KLLTTGN--PDTERDQGLFQRLGLRPMQITVDAAEHD-HPGTVHADITCG
BIOB_XANCP       ANSIFYGE--KLLTTGN--PDTERDQGLFQRLGLRPMQITVDAAEHD-HPGTVHADITCG
BIOB_XYLF2       ANSIFYGE--KLLTTAN--PETERDQALFQRLGLRPMHLMENVSNKDQHHGNVHADI---
BIOB_XYLFT       ANSIFYGE--KLLTTAN--PETERDQALFQRLGLRPMHLMENVSNKDQHHGNVHADI---
BIOB_XYLFM       ANSIFYGE--KLLTTAN--PETERDQALFQRLGLRPMHLMENVSNQDQHHGNVHADI---
BIOB_XYLFA       ANSIFYGE--KLLTTAN--PETERDQALFQRLGLRPMHLMENVSNQDQHHGNVHADI---
BIOB_AZOC5       ANSIFVGD--TLLTTPN--MEESRDAVLLARLGLRPAPAQPSA-----------------
BIOB_XANP2       ANSIFTGD--VLLTTAN--PERDKDAALFARLGIRAAAPAATEMRSAAE-----------
BIOB_RHOS1       ANSIFVGD--QLLTTGN--PAAWKDRDLLSRLGLHIAPARARPPVAAD------------
BIOB_RHOS4       ANSIFVGD--QLLTTGN--PAAWKDRDLLSRLGLHVAPARARPPVAAD------------
BIOB_RHOSK       ANSIFVGD--QLLTTGN--PAAWKDRDLLTRLGLHVAPARARPLVAAN------------
BIOB1_PARDP      ANSIFVGD--QLLTTGN--PAAWKDQDLLSRLGMHIAPAQARPRVAAE------------
BIOB_BRASB       ANSIFIGD--VLLTTAN--PQADRDAALLARLGMTSALSVRPAAATAPSETADSSLVA--
BIOB_BRASO       ANSIFIGD--VLLTTAN--PQAERDADLLTRLGMTSSLSARSVAAVDENVSANA------
BIOB_NITHX       ANSIFIGD--VLLTTKN--PQTARDAALLDRLGIRSRLDDAKAAAPPH------------
BIOB_NITWN       ANSIFIGD--VLLTTKN--PATLRDAALLDRLGMSSPLDGVKMPAASPS-----------
BIOB_OLICO       ANSIFIGD--VLLTTKN--PQTTKDAALLERLGMTSRFDEVATDKANPVSSRAI------
BIOB_BRADU       ANSIFVGD--VLLTTNN--PKVDRDADLLARLGITSGLA---------------------
BIOB_RHOPA       ANSIFIGD--TLLTTPN--PGDSKDRALFNRLGITPRDDLGVHAHS--------------
BIOB_RHOPT       ANSIFIGD--TLLTTPN--PGDSKDRALFNRLGITPRDDLGVHAHS--------------
BIOB_RHOPS       ANSIFIGD--TLLTTPN--PGDSKDRALFARLGITPRDDLGVHAHGNA------------
BIOB_RHOP2       ANSIFIGD--TLLTTPN--PGDSKDRMLFARLGITPREGAPVEAHSHDHDHDHHDHHHGH
BIOB_RHOP5       ANSIFIGD--TLLTTPN--PGDSKDRQLFNRLGINARGELGVHVHSHG------------
BIOB_RHOPB       ANSIFIGD--TLLTTPN--PGDNKDRSLFDRLGLEPRDDHGVHEHSSHSHTHDQGHDHGP
BIOB_CAUVN       ANSIFVGG--KLLTTPL--PGQDEDSQLFQDLDLKPMGGAVRVEAKADAAMVAAE-----
BIOB_CAUVC       ANSIFVGG--KLLTTPL--PGQDEDSQLFQDLDLKPMGGAVRVEAKADAAMVAAE-----
BIOB_CAUSK       ANSIFVGG--KLLTTPL--PNMDDDSKLFLDLNMRPMGSAKIVAPESVAAE---------
BIOB_PHEZH       ANSIFVGA--RLLTTDN--PEKTADEALLADLKMKPMAMA--------------------
BIOB_HYPNA       ANSIFVGD--RLLTTAN--PAMDKDARLLESVGGGCSKC---------------------
BIOB_MARMM       ANSIFVGE--ELLTTPN--PEQNEDFDLFKSLGIEPMRLGETGTVPAE------------
BIOB_ERYLH       ANSIFTGD--KLLTAAN--AGDDKDAALFDKLGLTALQGEE-PLRRAKDEAGKAAIPAE-
BIOB_NOVAD       ANSIFTGD--KLLTAAN--AGDDADAAMFKRLGLKPMEGEE-PMRAMKSVGGCSGGCAA-
BIOB_SPHAL       ANSIFTGD--KLLTTAN--AGDNADAALFAKLGLRPMESEE-PMRMEAAE----------
BIOB_SPHWW       ANSIFTGD--KLLTTDN--AGDDRDAALFARLGVTPMAAEC-KVELAAE-----------
BIOB_PARL1       ANSIFIGE--KLLTTKN--PEADKDQRLFAKLGIRSMPAHSCPSEKDVSADRKAG-----
BIOB_ACIF2       ANSIFLGD--RLLTTGN--ASTGHDQALFNRLGLHRSAD---------------------
BIOB_ACIF5       ANSIFLGD--RLLTTGN--ASTGHDQALFNRLGLHRSAD---------------------
BIOB_NITOC       ANSIFYGE--KLLTTPN--PTTDHDQQLFERLGLELLFPQAQVAAPVPEADEVGSASG--
BIOB_THISH       ANSIFYGD--KLLTTPN--PGENHDRALFERLGIHPL-EHSDEGASCETCGGVDIHAA--
BIOB_ALKEH       ANSIFYGD--KLLTTGN--PEADKDRRLLARLGMGFEAHACAQAEAEDLG----------
BIOB_HALHL       ANSLFLGE--RLLTTDN--PDADADHRLLHRLGMTLEPRTHSCAELEP------------
BIOB_ALCBS       ANSIFYGE--RLLTTDN--PEANHDQRLFKRLGIHPLDPRHEASDEAHEEAIQAQVSEQQ
BIOB_METCA       ANSIFYGD--RLLTTEN--PQAQRDRRLFARLGLRMAGLGC-------------------
BIOB_MAGSA       ANSVFCGQ--KLLTAKN--AAPGKDKSLFGKLGLQPM-----------------------
BIOB_ACIB3       ANSLFSGD--KLLTTPN--AGEGKDQALFNKLGLTAEKPKPTVSD---LSVDAMSA----
BIOB_ACIB5       ANSLFSGD--KLLTTPN--AGEGKDQALFNKLGLTAEKPKPTVSD---LSVDAMSA----
BIOB_ACIBY       ANSLFSGD--KLLTTPN--AGEGKDQALFNKLGLTAEKPKPTVSD---LSVDAMSA----
BIOB_ACIBC       ANSLFSGD--KLLTTPN--AGEGKDQALFNKLGLTAEKPKPTVSD---LSVDAMSA----
BIOB_ACIBT       ANSLFSGD--KLLTTPN--AGEGKDQALFNKLGLTAEKPKPTVSD---LSVDAMSA----
BIOB_ACIBS       ANSLFSGD--KLLTTPN--AGEGKDQALFNKLGLTAEKPKPTVSD---LSVDAMSA----
BIOB_ACICA       ANSLFSGE--KLLTTPN--AGEGKDQILFAKLGLTAEKAKPTVAE---LSVDAMSA----
BIOB_ACIAD       ANSLFSGD--KLLTTPN--AGEGKDQVLFAKLGLVAEKPKVSVRA---MAVDAMSA----
BIOB_PSYA2       ANSFFYGD--KLLTTGN--ASQSGDDRLMRELGLTKQFSAPRLPKQ-VPVLDAMSGHQSQ
BIOB_PSYCK       ANSFFYGD--KLLTTGN--ASQSGDDRLMRELGLTKQFAAPRAPKQ-VPVIDAMSGHQSQ
BIOB_PSYWF       ANSFFYGD--KLLTTGN--ASQSNDDRMMQMLGLIPEAPKPK-----LTVIDALSGHQSQ
BIOB_CELJU       ANSIFYGE--KLLTTPN--PEANKDMQLFNKLGIKPEAYDVH-------ETEEEQEAALV
BIOB_SACD2       ANSIFYGE--KLLTTAN--PESNKDMQLFKRLGINPEKREEH-------KTEQEQVEQIN
BIOB_HAHCH       ANSIFYGE--KLLTTPN--PEADKDMMLFKKLGIRPEQREQA-------HSEDQQEAYLH
BIOB_MARHV       ANSIFYGE--KLLTTSN--PEADADMQLFRKLGIRPEQREQC-------ATEEQEEEAIA
BIOB_CHRSD       ANSIFYGD--TLLTTGN--PQVERDRALFDKLGLHPEPSDPH-------ADDAHRDDEQA
BIOB_PSE14       ANSIFYGD--KLLTTAN--PQADKDMLLFSRLGIKPEAGEGH-------ADEVHQAAIEQ
BIOB_PSEU2       ANSIFYGD--KLLTTAN--PQADKDMLLFSRLGIKPEAGEGH-------ADEVHQAAIEQ
BIOB_PSESM       ANSIFYGD--KLLTTAN--PQADKDMLLFSRLGIKPEAGEGH-------ADEVHQAAIEQ
BIOB_PSEF5       ANSIFYGD--KLLTTAN--PQADKDMQLFARLGIQPEAREEH-------ADEVHQAAIEQ
BIOB_PSEPF       ANSIFYGD--KLLTTAN--PQADKDMQLFARLGIQPEAREEH-------ADEVHQAAIEQ
BIOB_PSEP1       ANSIFYGE--KLLTTAN--PQADKDMQLFARLGIKPEAREEH-------ADEVHQAAIEQ
BIOB_PSEPK       ANSIFYGE--KLLTTAN--PQADKDMQLFARLGIKPEAREEH-------ADEVHQAAIEQ
BIOB_PSEPG       ANSIFYGE--KLLTTAN--PQADKDMQLFARLGIKPEAREEH-------ADEVHQAAIEQ
BIOB_PSEPW       ANSIFYGE--KLLTTAN--PQADKDMQLFARLGIKPEAREEH-------ADEVHQAAIEQ
BIOB_PSEE4       ANSIFYGE--KLLTTAN--PQADKDMQLFARLGIKPEAREEH-------ADEVHQAAIEQ
BIOB_PSEA8       ANSIFYGE--KLLTTKN--PQAEKDMQLFARLGIKPEEREEH-------ADEVHQAAIEQ
BIOB_PSEAE       ANSIFYGE--KLLTTKN--PQAEKDMQLFARLGIKPEEREEH-------ADEVHQAAIEQ
BIOB_PSEAB       ANSIFYGE--KLLTTKN--PQAEKDMQLFARLGIKPEEREEH-------ADEVHQAAIEQ
BIOB_PSEA7       ANSIFYGE--KLLTTKN--PQAEKDMQLFARLGIKPEEREEH-------ADEVHQAAIEQ
BIOB_PSEMY       ANSIFYGE--KLLTTAN--PQADKDMALFKRLGIKPEEREEH-------ADEVHQAAIEQ
BIOB_PSEU5       ANSIFYGE--KLLTTAN--PQADKDMQLFARLGIKPEERQEH-------ADEVHQAAIEQ
BIOB_IDILO       ANSIFYGE--KLLTTAN--PEADADLRLFERLGIKPEQRDGY-------DDEVHTAVIED
BIOB_COLP3       ANSIFYGC--KLLTAEN--PETNQDIALFEKLGINTETVAGD-------TERSDNIVKTA
BIOB_PSYIN       ANSIFYGC--KLLTTAN--PDENSDTRLFEKLGINKEAINFS-------PSEAEKKVDAA
BIOB_MARMS       ANSIFYGE--KLLTTGN--PEADKDMALFANLGINPEKREEH-------SDAAVAEAIAA
BIOB_PSEHT       ANSIFYGD--KLLTTEN--PDADADMALIKKLGMNPETRHDY-------SDEAVAASLSS
BIOB_SHEB2       ANSIFYGC--KLLTTPN--PEESDDMGLFRRLGLRPEQGAA-------AKLEEESAVL--
BIOB_SHEB5       ANSIFYGC--KLLTTPN--PEESDDMGLFRRLGLRPEQGAA-------AKLEEESAVL--
BIOB_SHEB8       ANSIFYGC--KLLTTPN--PEESDDMGLFRRLGLRPEQGAA-------AKLEEESAVL--
BIOB_SHEB9       ANSIFYGC--KLLTTPN--PEESDDMGLFRRLGLRPEQGAA-------AKLEEESAVL--
BIOB_SHESA       ANSIFYGC--KLLTTPN--PEESDDMGLFRRLGLRPEQGAA-------ATIDDEQAVL--
BIOB_SHESM       ANSIFYGC--KLLTTPN--PEESDDMGLFRRLGLRPEQGAA-------ATIDDEQAVL--
BIOB_SHESR       ANSIFYGC--KLLTTPN--PEESDDMGLFRRLGLRPEQGAA-------ATIDDEQAVL--
BIOB_SHEON       ANSIFYGC--KLLTTPN--PEESDDMGLFRRLGLRPEQGAA-------ASIDDEQAVL--
BIOB_SHEPC       ANSIFYGC--KLLTTPN--PEESDDMGLFRRLGLRPEQGAV-------ATLDDEQAVL--
BIOB_SHESW       ANSIFYGC--KLLTTPN--PEESDDMGLFRRLGLRPEQGAV-------ATLDDEQAVL--
BIOB_SHEHH       ANSIFYGC--KLLTTPN--PEENDDMGLFRRLGLHPEQGVA-------STKEQDEAML--
BIOB_SHEPA       ANSIFYGC--KLLTTPN--PEENDDMSLFKRLGLHPEQGIA-------ATKEQDEAML--
BIOB_SHEPW       ANSIFYGC--KLLTTPN--PEENDDMSLFRRLGLHPEQGIA-------ATKEQDEAML--
BIOB_SHEDO       ANSIFYGC--KLLTTAN--PEENDDMSLFKRLGLRPEQGPAAPVAQVATNLDQEQALI--
BIOB_SHEFN       ANSIFYGC--KLLTTPN--PEENDDMSLFRRLGLHPEQGPQ-------ANIENDSALL--
BIOB_SHESH       ANSIFYGC--KLLTTNN--PEENEDMTLFKRLGLHPEQGKY-------ATVEDDKEVMAK
BIOB_SHEWM       ANSIFYGC--KLLTTNN--PEENEDMTLFKRLGLHPEQGKY-------ATIEDDKAVFEK
BIOB_SHELP       ANSIFYGC--KLLTTSN--PEENEDMTLFKRLGLHPEQGKA-------GTVEEDKAVF--
BIOB_SHEAM       ANSIFYGC--KLLTTPN--PEENDDMSLFRRLGLKPEQGKA-------AIVEEDAAVV--
BIOB_AERHH       ANSIFYGC--KLLTTPN--PDENSDMQLFKRLGIRPAQRAQK------PDQVQEEELLAE
BIOB_AERS4       ANSIFYGC--KLLTTPN--PDENSDMQLFKRLGIRPAQRAQK------PDQIQEEEILAE
BIOB_ALTMD       ANSIFYGC--KLLTTSN--PDTHEDVMLFKKLGINTERTRDY------SDEAHQQVLEEE
BIOB_PSEA6       ANSIFYGC--KLLTTSN--PETHEDVMLFKKLGINAKQTREY------SDEAHQAALLDE
BIOB_ALIF1       ANSVFYGC--KLLTTPN--PDEDTDMQLFKKLGVNSEQVAQK------PDQIQEHELLDR
BIOB_ALIFM       ANSVFYGC--KLLTTPN--PDEDTDMQLFKKLGVNSEQVAQK------PDQIQEHELLDR
BIOB_ALISL       TNSVFYGC--KLLTTPN--PDEDSDMQLFKKLGVNSHQVAQK------PDEVQEHELLDR
BIOB_VIBC3       ANSIFYGC--KLLTTPN--PAEDSDMLLFKKLGINREQVAQK------PDEITENELLDR
BIOB_VIBCH       ANSIFYGC--KLLTTPN--PAEDSDMLLFKKLGINREQVAQK------PDEITENELLDR
BIOB_VIBTL       ANSIFYGC--KLLTTPN--PDEDTDMQLFKKLGINSQQVAQK------PDEIQENELLDQ
BIOB_VIBCB       ANSVFYGC--KLLTTPN--PSEDKDMMLFNKLGINSQEVSQK------PDEIEENELLDR
BIOB_VIBPA       ANSVFYGC--KLLTTPN--PSEDKDMMLFKKLGINSQEVSQK------PDEIEENELLDR
BIOB_VIBVU       ANSIFYGC--KLLTTPN--PSEDKDMQLFNKLGINSQQVSQK------PDEITENELLDR
BIOB_VIBVY       ANSIFYGC--KLLTTPN--PSEDKDMQLFNKLGINSQQVSQK------PDEITENELLDR
BIOB_PHOPR       ANSVFYGC--KLLTTPN--PGEDKDMQLFAKLGINSQEQAAK------PDEVQEHELLGQ
BIOB_BUCA5       ANSIFYGC--KLLTSDN--PEEKHDLELFKKLDLIPENKTQT------LLKEDEYKTIIK
BIOB_BUCAT       ANSIFYGC--KLLTSDN--PEEKHDLELFKKLDLIPENKTQT------LLKEDEYKNIIK
BIOB_BUCAI       ANSIFYGC--KLLTSDN--PEEKHDLELFKKLDLIPENKTQT------LLKEDEYKTIIK
BIOB_BUCAP       ANSIFYGC--KLLTSSN--PKEEKDQKLFEKLDLFPDYKIQS------ITEENKNNENLK
BIOB_BUCBP       ANSIFYGC--KLLTTPN--PKKERDKQLFSKLGLNIKHKNTN------LNYSILSDNSLN
BIOB_WIGBR       VNSIFYGC--KLLTTTN--SSSKRDALLFKKLNM----KMEK------IKNKEKYFNKKQ
BIOB_BAUCH       ANSIFYGR--KLLTSSN--PTEDSDKRLFRKLGMQIE-KHTT------IKNSNWKKKKLL
BIOB_PECAS       ANSIFYGC--KLLTTPN--PKEDKDLALFLKLGLNPQQTGTE------FGDNQQQQRLAE
BIOB_ERWT9       ANSIFYGC--KLLTTPN--PDEDKDLLLFRKLGLNPRHGTTE------SGDNAQQQALAA
BIOB_SERMA       ANSIFYGC--KLLTTPN--PEEDKDLQLFRKLGLNPQQTATE------HGDNQQQQVLAK
BIOB_SERP5       ANSIFYGC--KLLTTPN--PEEDKDLQLFRKLGLNPQQTETE------HGDNQQQQALAA
BIOB_YERPA       ANSIFYGC--KLLTTPN--PDEDKDLQLFRKLGLNPQQTATS------HGDREQQQALTE
BIOB_YERPB       ANSIFYGC--KLLTTPN--PDEDKDLQLFRKLGLNPQQTATS------HGDREQQQALTE
BIOB_YERPE       ANSIFYGC--KLLTTPN--PDEDKDLQLFRKLGLNPQQTATS------HGDREQQQALTE
BIOB_YERPG       ANSIFYGC--KLLTTPN--PDEDKDLQLFRKLGLNPQQTATS------HGDREQQQALTE
BIOB_YERPN       ANSIFYGC--KLLTTPN--PDEDKDLQLFRKLGLNPQQTATS------HGDREQQQALTE
BIOB_YERPP       ANSIFYGC--KLLTTPN--PDEDKDLQLFRKLGLNPQQTATS------HGDREQQQALTE
BIOB_YERPS       ANSIFYGC--KLLTTPN--PDEDKDLQLFRKLGLNPQQTATS------HGDREQQQALTE
BIOB_YERPY       ANSIFYGC--KLLTTPN--PDEDKDLQLFRKLGLNPQQTATS------HGDREQQQALTE
BIOB_YERP3       ANSIFYGC--KLLTTPN--PDEDNDLQLFRKLGLNPQQTATS------HGDREQQQALTE
BIOB_YERE8       ANSIFYGC--KLLTTPN--PEEDKDLQLFRKLGLNPQQTATQ------HGDRAQQQVLTE
BIOB_PSEVU       ANSIFYGC--KLLTTPN--PEEDKDVQLFRKLGLNPQQTDVM------TGDNEQQQKLEE
BIOB_ENT38       ANSIFYGC--KLLTTPN--PEEDKDVQLFRKLGLNPTQTDVL------TGDNEQQQRLEQ
BIOB_KLEP3       ANSIFYGC--KLLTTPN--PEEDKDLQLFRKLGINPQQTAVL------EGDNEQQQRLEQ
BIOB_KLEP7       ANSIFYGC--KLLTTPN--PEEDKDLQLFRKLGINPQQTAVL------EGDNEQQQRLEQ
BIOB_SALPB       ANSIFYGC--KLLTTPN--PAEDKDLQLFRKLGLNPQQTRVL------AGDNEQQQRLEQ
BIOB_SALPC       ANSIFYGC--KLLTTPN--PAEDKDLQLFRKLGLNPQQTRVL------AGDNEQQQRLEQ
BIOB_SALNS       ANSIFYGC--KLLTTPN--PAEDKDLQLFRKLGLNPQQTRVL------AGDNEQQQRLEQ
BIOB_SALTY       ANSIFYGC--KLLTTPN--PAEDKDLQLFRKLGLNPQQTRVL------AGDNEQQQRLEQ
BIOB_SALCH       ANSIFYGC--KLLTTPN--PAEDKDLQLFRKLGLNPQQTRVL------AGDNEQQQRLEQ
BIOB_SALA4       ANSIFYGC--KLLTTPN--PAEDKDLQLFRKLGLNPQQTRVL------AGDNEQQQRLEQ
BIOB_SALTI       ANSIFYGC--KLLTTPN--PAEDKDLQLFRKLGLNPQQTRVL------AGDNEQQQRLEQ
BIOB_SALHS       ANSIFYGC--KLLTTPN--PAEDKDLQLFRKLGLNPQQTRVL------AGDNEQQQRLEQ
BIOB_SALPA       ANSIFYGC--KLLTTPN--PAEDKDLQLFRKLGLNPQQTRVL------AGDNEQQQRLEQ
BIOB_SALDC       ANSIFYGC--KLLTTPN--PAEDKDLQLFRKLGLNPQQTRVL------AGDNEQQQRLEQ
BIOB_SALEP       ANSIFYGC--KLLTTPN--PAEDKDLQLFRKLGLNPQQTRVL------AGDNEQQQRLEQ
BIOB_SALSV       ANSIFYGC--KLLTTPN--PAEDKDLQLFRKLGLNPQQTRVL------AGDNEQQQRLEQ
BIOB_SALPK       ANSIFYGC--KLLTTPN--PAEDKDLQLFRKLGLNPQQTRVL------AGDNEQQQRLEQ
BIOB_SALG2       ANSIFYGC--KLLTTPN--PAEDKDLQLFRKLGLNPQQTRVL------AGDNEQQQRLEQ
BIOB_SALAR       ANSIFYGC--KLLTTPN--PAEDKDLQLFRKLGLNPQQTRVL------AGDNEQQQRLEQ
BIOB_CITK8       ANSIFYGC--KLLTTPN--PEEDKDLQLFRKLGLNPQQTSVL------AGDNEQQQRLEQ
BIOB_SHIB3       ANSIFYGC--KLLTTPN--PEEDKDLQLFRKLGLNPQQTAVL------AGDNEQQQRLEQ
BIOB_SHIBS       ANSIFYGC--KLLTTPN--PEEDKDLQLFRKLGLNPQQTAVL------AGDNEQQQRLEQ
BIOB_ECO81       ANSIFYGC--KLLTTPN--PEEDKDLQLFRKLGLNPQQTAVL------AGDNEQQQRLEQ
BIOB_ECOL6       ANSIFYGC--KLLTTPN--PEEDKDLQLFRKLGLNPQQTAVL------AGDNEQQQRLEQ
BIOB_ECOK1       ANSIFYGC--KLLTTPN--PEEDKDLQLFRKLGLNPQQTAVL------AGDNEQQQRLEQ
BIOB_ECOUT       ANSIFYGC--KLLTTPN--PEEDKDLQLFRKLGLNPQQTAVL------AGDNEQQQRLEQ
BIOB_ECO45       ANSIFYGC--KLLTTPN--PEEDKDLQLFRKLGLNPQQTAVL------AGDNEQQQRLEQ
BIOB_ECOL5       ANSIFYGC--KLLTTPN--PEEDKDLQLFRKLGLNPQQTAVL------AGDNEQQQRLEQ
BIOB_SHIF8       ANSIFYGC--KLLTTPN--PEEDKDLQLFRKLGLNPQQTAVL------AGDNEQQQRLGQ
BIOB_SHIFL       ANSIFYGC--KLLTTPN--PEEDKDLQLFRKLGLNPQQTAVL------AGDNEQQQRLGQ
BIOB_ECO57       ANSIFYGC--KLLTTPN--PEEDKDLQLFRKLGLNPQQTAVL------AGDNEQQQRLEQ
BIOB_ECO5E       ANSIFYGC--KLLTTPN--PEEDKDLQLFRKLGLNPQQTAVL------AGDNEQQQRLEQ
BIOB_SHISS       ANSIFYGC--KLLTTPN--PEEDKDLQLFRKLGLNPQQTAVL------AGDNEQQQRLEQ
BIOB_ECOLI       ANSIFYGC--KLLTTPN--PEEDKDLQLFRKLGLNPQQTAVL------AGDNEQQQRLEQ
BIOB_ECOSM       ANSIFYGC--KLLTTPN--PEEDKDLQLFRKLGLNPQQTAVL------AGDNEQQQRLEQ
BIOB_ECOLU       ANSIFYGC--KLLTTPN--PEEDKDLQLFRKLGLNPQQTAVL------AGDNEQQQRLEQ
BIOB_ECOLC       ANSIFYGC--KLLTTPN--PEEDKDLQLFRKLGLNPQQTAVL------AGDNEQQQRLEQ
BIOB_ECOHS       ANSIFYGC--KLLTTPN--PEEDKDLQLFRKLGLNPQQTAVL------AGDNEQQQRLEQ
BIOB_ECODH       ANSIFYGC--KLLTTPN--PEEDKDLQLFRKLGLNPQQTAVL------AGDNEQQQRLEQ
BIOB_ECO8A       ANSIFYGC--KLLTTPN--PEEDKDLQLFRKLGLNPQQTAVL------AGDNEQQQRLEQ
BIOB_ECO7I       ANSIFYGC--KLLTTPN--PEEDKDLQLFRKLGLNPQQTAVL------AGDNEQQQRLEQ
BIOB_ECO55       ANSIFYGC--KLLTTPN--PEEDKDLQLFRKLGLNPQQTAVL------AGDNEQQQRLEQ
BIOB_ECO27       ANSIFYGC--KLLTTPN--PEEDKDLQLFRKLGLNPQQTAVL------AGDNEQQQRLEQ
BIOB_ECO24       ANSIFYGC--KLLTTPN--PEEDKDLQLFRKLGLNPQQTAVL------AGDNEQQQRLEQ
BIOB_SHIDS       ANSIFYGC--KLLTTPN--PEEDKDLQLFRKLGLNPQQTAVL------AGDNEQQQRLEQ
BIOB_ECOSE       ANSIFYGC--KLLTTPN--PEEDKDLQLFRKLGLNPQQTAVL------AGDNEQQQRLEQ
BIOB_ESCF3       ANSIFYGC--KLLTTPN--PEEDKDLQLFRKLGLNPQQTAVL------AGDNEQQQRLEQ
BIOB_CROS8       ANSIFYGC--KLLTTPN--PEEDKDLQLFRKLGLNPQQTAVL------AGDNEQQERLEH
BIOB_PHOLL       ANSIFYGC--KLLTTPN--PAEDKDLQLFRKLGINLQQTQTA------FGDNQQQQHLAE
BIOB_PROMH       ANSIFYGC--KLLTTTN--PTEDKDHQLFRKLGLNPERLSVS------MGDQQQEDVLLQ
BIOB_SODGM       ANSVFYGC--KLLTTPN--PGEDRDMALFHKLGINIERRTAT------QGDVAQQAQLAE
BIOB_METI4       VDSIFIGE--KLLTQSN--VQLEKDYALLKKLNLRKEER---------------------
BIOB_BACSU       ANSIFVGD---YLTTAG--QEETEDHKMLSDLGFEVESVE--------------------
BIOB_BACNA       ANSIFVGD---YLTTAG--QEETEDHKMLSDLGFEVESVE--------------------
BIOB_BACVZ       ANSIFVGD---YLTTAG--QQETEDHQMLHDLGFEVESVE--------------------
BIOB_BACAM       ANSIFVGD---YLTTAG--QQETEDHQMLHDLGFEVESVE--------------------
BIOB_BACLD       ANSIFVGD---YLTTAG--QNETEDHKMLHDLGFEVESVE--------------------
BIOB_BACHD       ANSIFIGD---YLTTAG--QEETADHQILKDLGFEVESVE--------------------
BIOB_GEOKA       ANSIFVGD---YLTTAG--QEKSADYQMLEDLGFEIEFAP--------------------
BIOB_GEOTN       ANSIFVGD---YLTTLG--QEKSADYKMLEDLGFEIEFSP--------------------
BIOB_ANOFW       ANSIFVGD---YLTTAG--QEKHADFQMLEDLGFDIDFAP--------------------
BIOB_LYSSH       ANSIFVGD---YLTTEG--QEANSDYRMLEDLGFEIELTQ--------------------
BIOB_LYSSC       ANSIFVGD---YLTTAG--QEANSDYRMLEDLGFEIELTQ--------------------
BIOB_BACAN       ANSIFVGD---YLTTAG--QEPTADWGMIEDLGFEIEECA--------------------
BIOB_BACC0       ANSIFVGD---YLTTAG--QEPTADWGMIEDLGFEIEECA--------------------
BIOB_BACCZ       ANSIFVGD---YLTTAG--QEPTADWGMIEDLGFEIEECA--------------------
BIOB_BACHK       ANSIFVGD---YLTTAG--QEPTADWGMIEDLGFEIEECA--------------------
BIOB_BACAH       ANSIFVGD---YLTTAG--QEPTADWGMIEDLGFEIEECA--------------------
BIOB_BACC7       ANSIFVGD---YLTTAG--QEPTADWGMIEDLGFEIEECA--------------------
BIOB_BACCQ       ANSIFVGD---YLTTAG--QEPTADWGMIEDLGFEIEECA--------------------
BIOB_BACC1       ANSIFVGD---YLTTAG--QEPTADWGMIEDLGFEIEECA--------------------
BIOB_BACC2       ANSIFVGD---YLTTAG--QEPTADWGMIADLGFEIEECA--------------------
BIOB_BACC4       ANSIFVGD---YLTTAG--QEPTADWGMIADLGFEIEECA--------------------
BIOB_BACCR       ANSIFVGD---YLTTAG--QEPTADWGMIADLGFEIEECA--------------------
BIOB_BACMK       ANSIFVGD---YLTTAG--QEPTADWGMIEDLGFEIEECA--------------------
BIOB_BACCN       ANSIFVGD---YLTTVG--QESTADWEMIQDLGFEIEECA--------------------
BIOB_BACP2       ANSIFVGD---YLTTKG--QQVQTDHHIIEDLGFDIEECA--------------------
BIOB_STAAM       ANSIFVGD---YLITGG--QPNQLDYDMINDLGFEIDYDT--------------------
BIOB_STAAN       ANSIFVGD---YLITGG--QPNQLDYDMINDLGFEIDYDT--------------------
BIOB_STAAS       ANSIFVGD---YLITGG--QPNQLDYDMINDLGFEIDYDT--------------------
BIOB_STAA9       ANSIFVGD---YLITGG--QPNQLDYDMINDLGFEIDYDT--------------------
BIOB_STAAB       ANSIFVGD---YLITGG--QPNQLDYDMINDLGFEIDYDT--------------------
BIOB_STAAW       ANSIFVGD---YLITGG--QPNQLDYDMINDLGFEIDYDT--------------------
BIOB_STAA1       ANSIFVGD---YLITGG--QPNQLDYDMINDLGFEIDYDT--------------------
BIOB_STAA2       ANSIFVGD---YLITGG--QPNQLDYDMINDLGFEIDYDT--------------------
BIOB_STAAR       ANSIFVGD---YLITGG--QPNQLDYDMINDLGFEIDYDT--------------------
BIOB_STAAC       ANSIFVGD---YLITGG--QPNQLDYDMINDLGFEIDYDT--------------------
BIOB_STAAT       ANSIFVGD---YLITGG--QPNQLDYDMINDLGFEIDYDT--------------------
BIOB_STAA8       ANSIFVGD---YLITGG--QPNQLDYDMINDLGFEIDYDT--------------------
BIOB_STAAE       ANSIFVGD---YLITGG--QPNQLDYDMINDLGFEIDYDT--------------------
BIOB_STAA3       ANSIFVGD---YLITGG--QPNQLDYDMINDLGFEIDYDT--------------------
BIOB_STAEQ       ANSIFVGD---YLITGG--QPNEEDYRMIEDLGFEIDS----------------------
BIOB_STAES       ANSIFVGD---YLITGG--QPNEEDYRMIEDLGFEIDS----------------------
BIOB_STAHJ       ANSIFVGD---YLITGG--QPNELDYQMIEDLGFEIDG----------------------
BIOB_STACT       ANSIFVGD---YLITGG--QPNTMDYRMIQDLGFEIDCSN--------------------
BIOB_MACCJ       ANSIFVGD---YLITDG--QPNELDYKMLEDLGFEIDINE--------------------
BIOB_RHOBA       ANSVFVGD---YLTTQG--QAPQADYDMIRDLGFDVTGSC--------------------
BIOB_THEEB       ANSMFIGD---YLTTPG--QAPHQDWQMIADAGFVLEDPE--------------------
BIOB_SALRD       ANSFFTDG---YLTTGG--QGESKDYRMIQQAGFEPVIVE--------------------
BIOB_STRAW       ANSIFLGD---YLTSEG--QAGKADLEMIADAGFEVEGAD------------------QV
BIOB_STRCO       ANSIFLGD---YLTSEG--QAGHADLELIADAGFEVEGAG------------------EV
BIOB_STRGG       VNSIFLGD---YLTSEG--QAGQTDLDMIADAGFEVEGAG------------------TT
BIOB2_FRACC      VNSIFLGD---YLTSEG--QEGHQDLKMIAEAGFTVEGLN------------------TD
BIOB_NOCSJ       ANSIFLGD---YLTSEG--QDARADLEMLRDNGFAILGA-------------------EA
BIOB_SACEN       ANSVFLGD---YLTSEG--QDAKADLEMIRDNGFVVLGS-------------------EE
BIOB_KOCRD       VNSLFLGD---YLTSEG--QAAEADLAMIADAGFTVLGAGPDPSRDRHAGPADVQGSGAE
BIOB_RENSM       ANSIFLGD---YLTSEG--QSAAEDLAMIEDGGFVILDP---------------------
BIOB_CUTAK       VNSIFLGD---YLTSEG--AAGAADLQMIEDGGFIPEGAD------------------GQ
BIOB_ACAM1       ANSLFVEG---YLATRG--HSVDQVYQLIHDAGFEVAGET--------------------
BIOB_MAGMM       ANSLFAEG---YLNTTG--HMAEKTVKMVEDAGFFVEKIE--------------------
BIOB_LEPBA       ANSLFAEG---YLNVKG--SEMEQTMNLIRDCNMVPEFTE--------------------
BIOB_LEPBP       ANSLFAEG---YLNVKG--SEMEQTMNLIRDCNMVPEFTE--------------------
BIOB_LEPBJ       ANSLFSSG---YLNVKG--SEIIETVTMIRDAGFVPELVD--------------------
BIOB_LEPBL       ANSLFSSG---YLNVKG--SEIIETVTMIRDAGFVPELVD--------------------
BIOB_LEPIC       ANSLFSSG---YLNVKG--SEILETVAMIRDAGFVPELSN--------------------
BIOB_LEPIN       ANSLFSSG---YLNVKG--SEILETVAMIRDAGFVPELSN--------------------
BIOB_THET2       VNSIFLQG---YLTQPG--SPWERDRALWESLGLDVEEGACG------------------
BIOB_THET8       VNSIFLQG---YLTQPG--SPWERDRALWESLDLDVEEGACG------------------
BIOB_STRA1       VDSTFLGN---YLTEGG--RNQHTDIEFLEKLQLNHTKKELI------------------
BIOB_STRA5       VDSTFLGN---YLTEGG--RNQHTDIEFLEKLQLNHTKKELI------------------
BIOB_STRA3       VDSTFLGN---YLTEGG--RNQHTDIEFLEKLQLNHTKKELI------------------
BIOB_CORGL       INAMIVGN---YLTTLG--RPMEDDLDMMDRLQLPIK-----VLNKVI------------
BIOB_CORGB       INAMIVGN---YLTTLG--RPMEDDLDMMDRLQLPIK-----VLNKVI------------
BIOB_COREF       INAIIVGN---YLTTLG--RPMEDDLEMMDRLQLPLK-----VLNKVI------------
BIOB1_CORDI      INAVIVGN---YLTTLG--RPMEQDLDMLGKLRLPIK-----ALNASV------------
BIOB_CORU7       INGMIVGN---YLTTLG--RDQEADVDMLNRLSLPIK-----ALNRSV------------
BIOB_CORJK       INAVIVGN---YLTTLG--RPAERDVDMLGKLQLPIK-----ALNATL------------
BIOB_MYCBO       INAVIVGN---YLTTLG--RPAEADLELLDELQMPLK-----ALNASL------------
BIOB_MYCTU       INAVIVGN---YLTTLG--RPAEADLELLDELQMPLK-----ALNASL------------
BIOB_MYCTA       INAVIVGN---YLTTLG--RPAEADLELLDELQMPLK-----ALNASL------------
BIOB_MYCTF       INAVIVGN---YLTTLG--RPAEADLELLDELQMPLK-----ALNASL------------
BIOB_MYCBP       INAVIVGN---YLTTLG--RPAEADLELLDELQMPLK-----ALNASL------------
BIOB_MYCMM       INAVIVGN---YLTTLG--RPAEADLELLEDLQMPLK-----ALNASL------------
BIOB_MYCUA       INAVIVGN---YLTTLG--RPAEADLELLEDLQMPLK-----ALNASL------------
BIOB_MYCA1       INAVIVGN---YLTTLG--RPAESDLELLDDLQMPLK-----GLNASL------------
BIOB_MYCPA       INAVIVGN---YLTTLG--RPAESDLELLDDLQMPLK-----GLNASL------------
BIOB_MYCLE       INAVIVGN---YLTTLG--RPAEADLRLLDDLQMPIK-----ALNASL------------
BIOB_MYCLB       INAVIVGN---YLTTLG--RPAEADLRLLDDLQMPIK-----ALNASL------------
BIOB_MYCGI       INAVIVGN---YLTTLG--RPAEADLQLLDDLQMPIK-----ALNATL------------
BIOB_MYCVP       INAVIVGN---YLTTLG--RPAEADLQLLDDLQMPIK-----ALNATL------------
BIOB_MYCSJ       INAVIVGN---YLTTLG--RPAEADLELLDDLQMPIK-----ALNASL------------
BIOB_MYCSK       INAVIVGN---YLTTLG--RPAEADLELLDDLQMPIK-----ALNASL------------
BIOB_MYCSS       INAVIVGN---YLTTLG--RPAEADLELLDDLQMPIK-----ALNASL------------
BIOB_MYCS2       INAVIVGN---YLTTLG--RPAEADLQLLDDLQMPIK-----ALNATL------------
BIOB_MYCA9       INAVIVGN---YLTTLG--RPAEADLELLDDLQMPIK-----ALNSSL------------
BIOB_NOCFA       INAVIVGN---YLTTLG--RPAESDLDLLGELKMPIK-----ALNETL------------
BIOB_RHOJR       INAVIVGN---YLTTLG--RPAEQDLDLLVDLQMPIK-----ALNDTL------------
BIOB_FRAAA       INAVIVGN---YLTTLG--RPAESDLKMLADLSMPIK-----SLQATL------------
BIOB1_FRACC      INAMIVGN---YLTTLG--RSAEADLKMLAELSMPIK-----SLQATL------------
BIOB_FRASN       INAVIVGN---YLTTLG--KNPESDLAMLTELRMPIK-----SLQATL------------
BIOB_SALAI       INAVIVGN---YLTTLG--RPATTDLELLDDLKMPVK-----ALSATL------------
BIOB_SALTO       INAVIVGN---YLTTLG--RPATTDLELLEDLKMPVK-----ALSATL------------
BIOB_PSECP       INAVIVGN---YLTTLG--RPATADLSLLVDLNMPIR-----ELQKTL------------
BIOB_ARTS2       INAVIVGN---YLTTLG--RPATADLSLLVELNMPIK-----ELQKTL------------
BIOB_PAEAT       INAVIVGN---YLTTLG--RPANADLNLLVELNMPIK-----EFQKSL------------
BIOB_ACIC1       VNGLIVGN---YLTTLG--RDPAADLALLAELGEPIRRSELQALSQAL------------
BIOB_CENSY       ANGIITSG---YLTMGG--NDSSADMEMIREAGLEA------------------------
BIOB_NITMS       ANGIITSG---YLTMGG--NEAQKDHAMIEKIGLKSQ-----------------------
BIOB_HELPY       INAVVLGD---YLTTKG--KAPKKDIEKLLSYGLTMATSCH-------------------
BIOB_HELPH       INAVVLGD---YLTTKG--KAPKKDIEKLLSYGLTMATSCH-------------------
BIOB_HELPS       INAVVLGD---YLTTKG--KAPKKDIEKLLSYGLTMATSCH-------------------
BIOB_HELPG       INAVVLGD---YLTTKG--KAPKKDIEKLLSYGLTMATSCH-------------------
BIOB_HELPJ       INAVVLGD---YLTTKG--KAPKKDIEKLLSYGLTMATSCH-------------------
BIOB_HELP2       INAVVLGD---YLTTKG--KAPKKDIEKLLSYGLTMATSCH-------------------
BIOB_HELAH       INAVVLGD---YLTTKG--KAPKKDIERLLSYGLKMAASCH-------------------
BIOB_HELHP       INGVVLGD---YLTTDG--KAPKDDVAMIESYGYVAATNCH-------------------
BIOB_WOLSU       INAVVLGD---YLTTKG--NRPSEDIAMIRSFGFEIAEACH-------------------
BIOB_ARCB4       ANALVVGD---YLTTGG--RDAQDDIDAVTALGYEIAFACHQ------------------
BIOB_NITSB       ANAIVIGD---YLTTKG--ERPDKDIQTLQKLGVEIATSCHE------------------
BIOB_NAUPA       ANSIVIGD---YLTTKG--ERPDRDLEILLNEGFEIANEC--------------------
BIOB_CAMC1       ADAIVIGD---YLTAKG--EKASKDIEELTKRGFSFASICH-------------------
BIOB_CAMC5       VSAVVIGD---YLTTKG--EESCKDIAKFKQMGFEFASKCH-------------------
BIOB_CAMFF       ASAIVIGD---YLTTSG--EVASKDIEELRNRGFEFASQCH-------------------
BIOB_CAMJ8       AGAIVIGD---YLTTKG--EEPSQDIIKLKEMGFTFASECH-------------------
BIOB_CAMJJ       AGAIVIGD---YLTTKG--EEPSQDIIKLKEMGFTFASECH-------------------
BIOB_CAMJE       AGAIVIGD---YLTTKG--EEPSQDIIKLKEMGFTFASECH-------------------
BIOB_CAMJR       AGAIVIGD---YLTTKG--EEPSQDIIKLKEMGFTFASECH-------------------
BIOB_CAMJD       AGAIVIGD---YLTTKG--EEPSQDIIKLKEMGFTFASECH-------------------
BIOB_CAMLR       ASAIVVGD---YLTTKG--EEPSKDIQKLKQMGFSFASSCH-------------------
BIOB_SULDN       ANSIVIGN---YLTTSG--KAMQRDLEMLKSLNLDVASSVK-------------------
BIOB_SULNB       ANSIVIGD---YLTTSG--SAPKMDQLMLEKLGYEVATSCDSH-----------------
BIOB_METM6       LDGLMIGN---YLTTNG--QNIQSDLKMIKEMGFER------------------------
BIOB_METMP       LDGLMIGN---YLTTNG--QNIQSDLKMIEEMGFER------------------------
BIOB_METM5       IDGLMIGN---YLTTNG--QNIQSDLKMIEEMGFER------------------------
BIOB_METM7       LDGLMIGN---YLTTNG--QNIQSDLKMIDEMGFKQ------------------------
BIOB_METVS       VDGLMIGN---YLTTSG--RNIQSDLRMIEDMGFKKG-----------------------
BIOB_META3       IDGLMIGN---YLTTNG--RNIEDDIKMIVDGGFDGK-----------------------
BIOB_METJA       LDGLMVGN---YLTTKG--RCLEDDLKMIADFHSL-------------------------
BIOB_CALBD       VNGCMVGN---YLTTRG--MGIREKIEMLESLDLKFQTNMHNN-----------------
BIOB_CALS8       INGCMVGN---YLTTQG--MGIKEKVEMLESLGLEV------------------------
BIOB_AQUAE       TNAMMVGG---YLTRAG--RDIKKDYQLLKDLKAKRKVSVE-------------------
BIOB_HYDS0       TNALMAGG---YLTRAG--RDIKKDYKMLEDMNLERLTSEEVCK----------------
BIOB_PERMH       ANCVMAGG---YLTRAG--RAPGKDEEMVRRLGRKLITGRDLFSKYKTAV----------
BIOB_SULSY       ANCLMAGG---YLTRAG--REPGKDEEMARRLGRELIKNGASFSVSNE------------
BIOB_UNCTG       ANGMMTGG---YLTTIG--RDITSDKQMIKDLGLEIEPNHTY------------------
BIOB_THENN       ANGMIVGG---YLTVKG--RSYDDDRKLVEGLKELMGW----------------------
BIOB_THEP1       ANGMIVGG---YLTLKG--RSYDDDIKLIEGLRELMRW----------------------
BIOB_THEYD       ANALMTGN---YLTTTG--RHYSDDIKFIEAHGLEVDSVVS-------------------
BIOB_DESDA       ANALMTGD---YLTTQG--RGLVDDLAMIDSLGLEVDCDQSC------------------
BIOB_ALKMQ       ANATITGD---LLTTSG--NNIDKDKEMLTQMGFHL------------------------
BIOB_CLOB8       SNATITGD---MLTTVG--NNTCQDKIMLQTLGFSI------------------------
BIOB_CLOB1       VNGAISGD---MLTTLG--IETSEDIKMIKNLGFEV------------------------
BIOB_CLOBH       VNGAISGD---MLTTLG--IETSEDIKMIKNLGFEV------------------------
BIOB_CLOBK       VNGAISGD---MLTTLG--IETSEDIKMIKNLGFEV------------------------
BIOB_CLOBL       VNGAISGD---MLTTLG--IETSEDIKMIKNLGFEV------------------------
BIOB_CLOBM       VNGAISGD---MLTTLG--IETSEDIKMIKNLGFEV------------------------
BIOB_CLOBA       VNSAISGD---MLTTSG--IKTFDDIKMIKELGFEV------------------------
BIOB_CLOBB       VNAAISGD---MLTTSG--IKTFDDIKMIKELGFEV------------------------
BIOB_BRAHW       ANAAITGD---MLTTAG--ISIETDKKMVEELGYKIELKED-------------------
BIOB_AKKM8       ANAAISGD---MLTTAG--VTIREDLAMLAELGYEVRMK---------------------
BIOB2_CORDI      ANSAISGD---MLTTTG--TTIASDMALVKDLGYTVTLDHSHS-----------------
BIOB_CAMHC       INSAITGD---FLTTCG--DVAQSDKNLVSECGFVYKKSFDV------------------
BIOB_FUSNN       INSALTGN---FLTTTG--TTIETDKKMIKELGYEI------------------------
BIOB_CLOD6       VNSAIVGD---YLTTVG--SGIENDKKMIIEQGFEL------------------------
BIOB_HUNT2       VSAMLVGN---YLTTVG--NKISDDLEMIQRMGLEI------------------------
BIOB_CLOK1       ANATITGN---YLTTSG--NKICDDKKMINKLKLKIRKNVHKEKKMF-------------
BIOB_CLOTE       ANATISGN---YLTTSG--NKINDDIEMIKSLGLSLDI----------------------
BIOB_CLONN       VSATITGN---YLTTQG--NGIKNDIKLLNKLGLTV------------------------
BIOB_CLOP1       ANATITGN---LLTTCG--NKIKDDKRLIENIGMRIF-----------------------
BIOB_CLOPE       ANATITGN---LLTTCG--NKIKDDKRLIENIGMRIF-----------------------
BIOB_PORG3       INAAITGD---LLTTTG--SKAAEDMQLARECGFQVTNDTDWEVSYDH------------
BIOB_PORGI       INAAITGD---LLTTTG--SKAAEDMQLVRECGFQVTNDTDWEVSYDH------------
BIOB_PARD8       INSAIIGD---LLTTIG--SKVEEDKVLFTSEGYSLTENTDWEK----------------
BIOB_CROS5       INAMLIGH---YLTTLG--QPPENDHAMLESLGLQGGEAPIPGEYKKKTQKKAH------
BIOB_RIPO1       INAMLIGH---YLTTLG--QPPEKDLAMVESLGLQGGEAPIPGEYQTRS-----------
BIOB_GLOC7       INAMLIGH---YLTTLG--QSPQQDQAMLKSLGLEGGEAPIPGEYQP-------------
BIOB_MICAN       INAMLIGH---YLTTLG--QPPQQDQAMLADLSLIGGEAPIPGEYQPQQAT---------
BIOB_TRIEI       INAMLIGH---YLTTLG--QPPEKDQAMLKSLGLQGGETPIATNGL--------------
BIOB_SYNY3       INAMLVGH---YLTTLG--QPPERDQKLLASLGLEGGEAPIPGEYQS-------------
BIOB_CYAP4       INAMLVGH---YLTTMG--QPPEQDHAMLAGLGLQGGEAPIPGEYVRASQVREL------
BIOB_SYNP2       INAMLIGH---YLTTMG--QPPEQDQAMLKSLGLQGGEAPIPGQYSAAQ-----------
BIOB_CARHZ       LNGMLIGH---YLTTKG--REVETDLQMIRDLGLKI------------------------
BIOB_CLOAB       LNGMLIGN---YLTTNG--QSVNDDFNMLKDLELEY------------------------
BIOB_DESAP       VDALITGD---YLTTAG--QGTARDRQLIRDLGLEG------------------------
BIOB_PELTS       VNALMVGN---YLTTSG--RRVEDDLQMVADLKLSVM-----------------------
BIOB_HELMI       ADAALVGS---YLTTSG--RTVAEDIQMLRDLGLNVNNL---------------------
BIOB_DESPS       ANGAIVGD---YLTTSG--DGLKKDIDMFLNLGFSIGSREK-------------------
BIOB_DESRM       INAVIIGN---FLTTTG--YQIDRELSVIRSMGLNIS-----------------------
BIOB_ANAD2       ANGTMVGN---YLTSAG--RAPDLTVGMVERQGLTLRPPDTGKAWAFDGHAPSDADWNRK
BIOB_ANASK       ANGTMVGN---YLTSAG--RAPDLTVGMVERQGLTLRPPDTGKPWAFDGHAPSDADWNRK
BIOB_ANADE       ANGTMVGN---YLTSAG--RAPDLTVGMVERQGLTLRPPDTGKAWAFDGHAPSDADWNRK
BIOB_ANADF       ANGTMVGN---YLTSAG--RGPGETVRMVEEQGLRLRAPDTGREWAFDGSAPAEAEWNRR
BIOB_DESVH       ANGMMVGN---YLTTTG--RDMADDLAMLATLGVRA------------------------
BIOB_DESVV       ANGMMVGN---YLTTTG--RDMADDLAMLATLGVRA------------------------
BIOB_DESVM       ANGLMVGN---YLTTAG--RALAEDMEMLAALGVGEIPRNGEEARA--------------
BIOB_DESAG       ANGLMVGN---YLTTAG--RSTADDYTMLRHMGVLR------------------------
BIOB_GEOMG       ASGTMIGN---YLTTTG--RPAEQDWQMLRDLELAVGGCCE-------------------
BIOB_GEOSL       ASGTMIGN---YLTTTG--RPPEQDWQMLADLGLTVRQCNG-------------------
BIOB_GEODF       ASGTMIGN---YLTTTG--RAAEEDWQMLKDLNLSVASCCE-------------------
BIOB_GEOUR       ASGTMIGN---YLTTTG--RAAEEDWQMLKDLNLSAANCCD-------------------
BIOB_GEOBB       ANGTMIGN---YLTTLG--RNVDTDLTMFSDLGLKTVMCAH-------------------
BIOB_PELPD       ASGMMTGN---YLTTLG--RKPEQDHQMLADLGMGVGGCS--------------------
BIOB_GEOLS       ASGIMTGN---YLTKEG--RQPADDLRMIEDLGLVIAKEMLR------------------
BIOB_PELCD       ASGMMVGD---YLTTAG--RQLSDDLRMVTDAGLTYERC---------------------
BIOB_SYNAS       ASGMIVGN---YLTTQG--RDIGMDRDMIQSGLF--------------------------
BIOB_DESAL       ASGIMTGD---YLTAPG--RNPQKDHAMIRRLGLTALREGE-------------------
BIOB_DESOH       ASGIMTGD---YLTTSG--RNLADDLALLATLGMTPREKAG-------------------
BIOB_SYNFM       ATGMMVGP---LLTVAG--RDVSSDLRMLEDLEFPASALN--------------------
BIOB_CHLCH       VNGFLTGG---YLTTRG--RDVADDQRFAAQLASFA------------------------
BIOB_PELPB       ANGFLTGG---YLTTRG--RDIADDRRFASQIASFN------------------------
BIOB_CHLP8       ANGFLTGG---YLTTRG--RDMEADRQLAGQIARFS------------------------
BIOB_CHLTE       ADGFLTGG---YLTTRG--RDISTDRQLARQLSKFS------------------------
BIOB_CHLL2       ANGFLTGG---YLTTRG--REIDADRELGRQLESFTEG----------------------
BIOB_PELLD       ADGLLTGG---YLTTRG--REVADDTRFRAQLASFS------------------------
BIOB_CHLPM       ADGYLTGG---YLTTRG--RDLADDQRFSERLASFS------------------------
BIOB_CHLPD       ADGLLTGG---YLTTRG--RATADDRMFMRQLQWFN------------------------
BIOB_CHLPB       ANGFLTGG---YLTTRG--RKIGDDREFMRQLAGFAEVSCS-------------------
BIOB_PROA2       ANGFLTGG---YLTTRG--RDVGDDQAFMEQLKHFSGRS---------------------
BIOB_NATPD       ADGLLTGD---YLTTDG--QTPADDIEIIERAGLEPNREANTFDPESVKARHRSPAAETA
                     .       *                                               

BIOB_FRAT1       ------------------------------------------------------------
BIOB_FRATT       ------------------------------------------------------------
BIOB_FRATN       ------------------------------------------------------------
BIOB_FRATW       ------------------------------------------------------------
BIOB_FRATM       ------------------------------------------------------------
BIOB_FRATF       ------------------------------------------------------------
BIOB_FRATH       ------------------------------------------------------------
BIOB_FRATO       ------------------------------------------------------------
BIOB_FRAP2       ------------------------------------------------------------
BIOB_COXB1       ------------------------------------------------------------
BIOB_COXB2       ------------------------------------------------------------
BIOB_COXBN       ------------------------------------------------------------
BIOB_COXBR       ------------------------------------------------------------
BIOB_COXBU       ------------------------------------------------------------
BIOB_LAWIP       ------------------------------------------------------------
BIOB_RICFE       ------------------------------------------------------------
BIOB_NEOSM       ------------------------------------------------------------
BIOB_ANAMF       ------------------------------------------------------------
BIOB_ANAMM       ------------------------------------------------------------
BIOB_ANAPZ       ------------------------------------------------------------
BIOB_EHRCJ       ------------------------------------------------------------
BIOB_EHRCR       ------------------------------------------------------------
BIOB_EHRRG       ------------------------------------------------------------
BIOB_EHRRW       ------------------------------------------------------------
BIOB_AGRRK       ------------------------------------------------------------
BIOB_AGRVS       ------------------------------------------------------------
BIOB_RUEPO       ------------------------------------------------------------
BIOB_BEII9       ------------------------------------------------------------
BIOB_METSB       ------------------------------------------------------------
BIOB_ZYMMO       ------------------------------------------------------------
BIOB_METC4       ------------------------------------------------------------
BIOB_METEP       ------------------------------------------------------------
BIOB_METPB       ------------------------------------------------------------
BIOB_METRJ       ------------------------------------------------------------
BIOB_METNO       ------------------------------------------------------------
BIOB_METS4       ------------------------------------------------------------
BIOB_PROM2       ------------------------------------------------------------
BIOB_PROM9       ------------------------------------------------------------
BIOB_PROMS       ------------------------------------------------------------
BIOB_PROM0       ------------------------------------------------------------
BIOB_PROM5       ------------------------------------------------------------
BIOB_PROMP       ------------------------------------------------------------
BIOB_PROM1       ------------------------------------------------------------
BIOB_PROMT       ------------------------------------------------------------
BIOB_PROM4       ------------------------------------------------------------
BIOB_PROMA       ------------------------------------------------------------
BIOB_PROM3       ------------------------------------------------------------
BIOB_PROMM       ------------------------------------------------------------
BIOB_SYNPW       ------------------------------------------------------------
BIOB_SYNS3       ------------------------------------------------------------
BIOB_SYNPX       ------------------------------------------------------------
BIOB_SYNSC       ------------------------------------------------------------
BIOB_SYNS9       ------------------------------------------------------------
BIOB_SYNR3       ------------------------------------------------------------
BIOB_SYNE7       ------------------------------------------------------------
BIOB_SYNP6       ------------------------------------------------------------
BIOB_SORC5       ------------------------------------------------------------
BIOB_MYXXD       ------------------------------------------------------------
BIOB_GLOVI       ------------------------------------------------------------
BIOB_SYNJA       ------------------------------------------------------------
BIOB_NOSS1       --PVVMGNS---------------------------------------------------
BIOB_TRIV2       --PVVMGNS---------------------------------------------------
BIOB_NOSP7       ASPAVVG-----------------------------------------------------
BIOB_CHLAB       GQPCQSVTC---------------------------------------------------
BIOB_CHLFF       EQPCQSATC---------------------------------------------------
BIOB_CHLPN       GNPCYANNS---------------------------------------------------
BIOB_FLAJ1       EKPKWSRPGHTIERNIEASIKSKI------------------------------------
BIOB_FLAPJ       EKPKWSRPSHTIEKNLELSGKGKN------------------------------------
BIOB_GRAFK       EKPRWSRPEHKIDRNLEAQQNAKTKA----------------------------------
BIOB_CYTH3       DAPKI-----KFEQIPSALVK---------------------------------------
BIOB_HYDCU       ------------------------------------------------------------
BIOB_BRUA1       ------------------------------------------------------------
BIOB_BRUA2       ------------------------------------------------------------
BIOB_BRUAB       ------------------------------------------------------------
BIOB_BRUC2       ------------------------------------------------------------
BIOB_BRUMB       ------------------------------------------------------------
BIOB_BRUME       ------------------------------------------------------------
BIOB_BRUSI       ------------------------------------------------------------
BIOB_BRUSU       ------------------------------------------------------------
BIOB_BRUO2       ------------------------------------------------------------
BIOB_OCHA4       ------------------------------------------------------------
BIOB_AGRFC       ------------------------------------------------------------
BIOB2_PARDP      ------------------------------------------------------------
BIOB_LEGPA       ------------------------------------------------------------
BIOB_LEGPH       ------------------------------------------------------------
BIOB_LEGPL       ------------------------------------------------------------
BIOB_LEGPC       ------------------------------------------------------------
BIOB_RUTMC       ------------------------------------------------------------
BIOB_VESOH       ------------------------------------------------------------
BIOB_HAEI8       ------------------------------------------------------------
BIOB_HAEIE       ------------------------------------------------------------
BIOB_HAEIN       ------------------------------------------------------------
BIOB_HAEIG       ------------------------------------------------------------
BIOB_HAES1       ------------------------------------------------------------
BIOB_HISS2       ------------------------------------------------------------
BIOB_PASMU       ------------------------------------------------------------
BIOB_ACTSZ       ------------------------------------------------------------
BIOB_MANSM       ------------------------------------------------------------
BIOB_ACTP7       ------------------------------------------------------------
BIOB_ACTPJ       ------------------------------------------------------------
BIOB_ACTP2       ------------------------------------------------------------
BIOB_HAEDU       ------------------------------------------------------------
BIOB_HAEPS       ------------------------------------------------------------
BIOB_NEIG1       ------------------------------------------------------------
BIOB_NEIG2       ------------------------------------------------------------
BIOB_NEIM0       ------------------------------------------------------------
BIOB_NEIMF       ------------------------------------------------------------
BIOB_NEIMA       ------------------------------------------------------------
BIOB_NEIMB       ------------------------------------------------------------
BIOB_CHRVO       ------------------------------------------------------------
BIOB_METSK       ------------------------------------------------------------
BIOB_METFK       ------------------------------------------------------------
BIOB_THIDA       ------------------------------------------------------------
BIOB_NITEC       ------------------------------------------------------------
BIOB_NITEU       ------------------------------------------------------------
BIOB_NITMU       ------------------------------------------------------------
BIOB_ACISJ       ------------------------------------------------------------
BIOB_ACIET       ------------------------------------------------------------
BIOB_DELAS       ------------------------------------------------------------
BIOB_ACIAC       ------------------------------------------------------------
BIOB_METPP       ------------------------------------------------------------
BIOB1_POLSJ      ------------------------------------------------------------
BIOB_HERAR       ------------------------------------------------------------
BIOB_JANMA       ------------------------------------------------------------
BIOB_RHOFT       ------------------------------------------------------------
BIOB_POLAQ       ------------------------------------------------------------
BIOB_BORBR       ------------------------------------------------------------
BIOB_BORPA       ------------------------------------------------------------
BIOB_BORPE       ------------------------------------------------------------
BIOB_BORPD       ------------------------------------------------------------
BIOB_BORA1       ------------------------------------------------------------
BIOB_BURCM       ------------------------------------------------------------
BIOB_BURL3       ------------------------------------------------------------
BIOB_BURA4       ------------------------------------------------------------
BIOB_BURVG       ------------------------------------------------------------
BIOB_BURM1       ------------------------------------------------------------
BIOB_BURCA       ------------------------------------------------------------
BIOB_BURCC       ------------------------------------------------------------
BIOB_BURCH       ------------------------------------------------------------
BIOB_BURCJ       ------------------------------------------------------------
BIOB_BURM7       ------------------------------------------------------------
BIOB_BURM9       ------------------------------------------------------------
BIOB_BURP6       ------------------------------------------------------------
BIOB_BURMA       ------------------------------------------------------------
BIOB_BURMS       ------------------------------------------------------------
BIOB_BURP0       ------------------------------------------------------------
BIOB_BURPS       ------------------------------------------------------------
BIOB_BURP1       ------------------------------------------------------------
BIOB_BURTA       ------------------------------------------------------------
BIOB_PARPJ       ------------------------------------------------------------
BIOB_PARXL       ------------------------------------------------------------
BIOB_PARP8       ------------------------------------------------------------
BIOB_CUPTR       ------------------------------------------------------------
BIOB_CUPNH       ------------------------------------------------------------
BIOB_CUPPJ       ------------------------------------------------------------
BIOB_CUPMC       ------------------------------------------------------------
BIOB_POLNA       ------------------------------------------------------------
BIOB2_POLSJ      ------------------------------------------------------------
BIOB_LEPCP       ------------------------------------------------------------
BIOB_RALPJ       TPAD--------------------------------------------------------
BIOB_RALSO       TPAD--------------------------------------------------------
BIOB_AZOSB       ------------------------------------------------------------
BIOB_AROAE       ------------------------------------------------------------
BIOB_DECAR       ------------------------------------------------------------
BIOB_GLUDA       ------------------------------------------------------------
BIOB_GLUOX       VS----------------------------------------------------------
BIOB_GRABC       ------------------------------------------------------------
BIOB_ACICJ       ------------------------------------------------------------
BIOB_STRM5       APGCGCAHAA--------------------------------------------------
BIOB_STRMK       TPGCGCAHAA--------------------------------------------------
BIOB_XANAC       A---ACEHAA--------------------------------------------------
BIOB_XANC5       A---ACEHAA--------------------------------------------------
BIOB_XANOM       A---ACEHTA--------------------------------------------------
BIOB_XANOP       A---ACEHTA--------------------------------------------------
BIOB_XANOR       A---ACEHTA--------------------------------------------------
BIOB_XANC8       A---ACEHAA--------------------------------------------------
BIOB_XANCB       A---ACEHAA--------------------------------------------------
BIOB_XANCP       A---ACEHAA--------------------------------------------------
BIOB_XYLF2       ----ACKHVV--------------------------------------------------
BIOB_XYLFT       ----ACKHVV--------------------------------------------------
BIOB_XYLFM       ----ACKHVV--------------------------------------------------
BIOB_XYLFA       ----ACKHVV--------------------------------------------------
BIOB_AZOC5       ------------------------------------------------------------
BIOB_XANP2       ------------------------------------------------------------
BIOB_RHOS1       ------------------------------------------------------------
BIOB_RHOS4       ------------------------------------------------------------
BIOB_RHOSK       ------------------------------------------------------------
BIOB1_PARDP      ------------------------------------------------------------
BIOB_BRASB       ------------------------------------------------------------
BIOB_BRASO       ------------------------------------------------------------
BIOB_NITHX       ------------------------------------------------------------
BIOB_NITWN       ------------------------------------------------------------
BIOB_OLICO       ------------------------------------------------------------
BIOB_BRADU       ------------------------------------------------------------
BIOB_RHOPA       ------------------------------------------------------------
BIOB_RHOPT       ------------------------------------------------------------
BIOB_RHOPS       ------------------------------------------------------------
BIOB_RHOP2       SHS---------------------------------------------------------
BIOB_RHOP5       ------------------------------------------------------------
BIOB_RHOPB       HGHSHG------------------------------------------------------
BIOB_CAUVN       ------------------------------------------------------------
BIOB_CAUVC       ------------------------------------------------------------
BIOB_CAUSK       ------------------------------------------------------------
BIOB_PHEZH       ------------------------------------------------------------
BIOB_HYPNA       ------------------------------------------------------------
BIOB_MARMM       ------------------------------------------------------------
BIOB_ERYLH       ------------------------------------------------------------
BIOB_NOVAD       ------------------------------------------------------------
BIOB_SPHAL       ------------------------------------------------------------
BIOB_SPHWW       ------------------------------------------------------------
BIOB_PARL1       ------------------------------------------------------------
BIOB_ACIF2       ------------------------------------------------------------
BIOB_ACIF5       ------------------------------------------------------------
BIOB_NITOC       ------------------------------------------------------------
BIOB_THISH       ------------------------------------------------------------
BIOB_ALKEH       ------------------------------------------------------------
BIOB_HALHL       ------------------------------------------------------------
BIOB_ALCBS       AEEAGLFYNAMDSKRTAKHVLDKDTGRPTATEH---------------------------
BIOB_METCA       ------------------------------------------------------------
BIOB_MAGSA       ------------------------------------------------------------
BIOB_ACIB3       ------------------------------------------------------------
BIOB_ACIB5       ------------------------------------------------------------
BIOB_ACIBY       ------------------------------------------------------------
BIOB_ACIBC       ------------------------------------------------------------
BIOB_ACIBT       ------------------------------------------------------------
BIOB_ACIBS       ------------------------------------------------------------
BIOB_ACICA       ------------------------------------------------------------
BIOB_ACIAD       ------------------------------------------------------------
BIOB_PSYA2       VILASLS-----------------------------------------------------
BIOB_PSYCK       VVLAS-------------------------------------------------------
BIOB_PSYWF       L-----------------------------------------------------------
BIOB_CELJU       HQLEEAK---------LDAFFYNAAR----------------------------------
BIOB_SACD2       QQVAEAA---------LDKVFYNAAS----------------------------------
BIOB_HAHCH       DVIQAHD-QQQR----MESMFYDATKTA--------------------------------
BIOB_MARHV       EAVEYEA-TRH--------MFYDATRESA-------------------------------
BIOB_CHRSD       EIALAHAIQRQR----DDALFYDATRG---------------------------------
BIOB_PSE14       ALVEQQS----------SSMFYDAASA---------------------------------
BIOB_PSEU2       ALVEQQS----------SSMFYDAASA---------------------------------
BIOB_PSESM       ALVEQQS----------SAMFYDAASA---------------------------------
BIOB_PSEF5       ALVEQKS----------SEQFYNAAV----------------------------------
BIOB_PSEPF       ALVEQKS----------SEQFYNAAV----------------------------------
BIOB_PSEP1       ALVEQRS----------SEMFYDAATA---------------------------------
BIOB_PSEPK       ALVEQRS----------SEMFYDAATA---------------------------------
BIOB_PSEPG       ALVEQRS----------SEMFYNAASA---------------------------------
BIOB_PSEPW       ALVEQRS----------SELFYNAASA---------------------------------
BIOB_PSEE4       ALVEQRN----------SELFYDAASA---------------------------------
BIOB_PSEA8       ALVEQRE----------SKLFYNAASA---------------------------------
BIOB_PSEAE       ALVEQRE----------SKLFYNAASA---------------------------------
BIOB_PSEAB       ALVEQRE----------SKLFYNAASA---------------------------------
BIOB_PSEA7       ALVEQRD----------SQLFYNAASA---------------------------------
BIOB_PSEMY       ALVEQRD----------SKLFYNAASA---------------------------------
BIOB_PSEU5       ALIEQRD----------SKLFYNAAV----------------------------------
BIOB_IDILO       AIKEQQN----------PVRYYDAS-----------------------------------
BIOB_COLP3       IVDQQNS----------D-LFYNASA----------------------------------
BIOB_PSYIN       IVRFNEK----------DELFFDATSKA--------------------------------
BIOB_MARMS       QVVKQEE----------SKLFYEASV----------------------------------
BIOB_PSEHT       QVADKAT----------SKLFYEA------------------------------------
BIOB_SHEB2       --AKAAAYQ-----DKSSAQFYDAGAL---------------------------------
BIOB_SHEB5       --AKAAAYQ-----DKSSAQFYDAGAL---------------------------------
BIOB_SHEB8       --AKAAAYQ-----DKSSAQFYDAGAL---------------------------------
BIOB_SHEB9       --AKAAAYQ-----DKSSAQFYDAGAL---------------------------------
BIOB_SHESA       --AKAAAHQ-----DKASAPFYDAAAL---------------------------------
BIOB_SHESM       --AKAAAHQ-----DKASAPFYDAAAL---------------------------------
BIOB_SHESR       --AKAAAHQ-----DKASAPFYDAAAL---------------------------------
BIOB_SHEON       --AKAAAYQ-----DKASAQFYDAAAL---------------------------------
BIOB_SHEPC       --AKAAAHQ-----DKSTAQFYDAAAL---------------------------------
BIOB_SHESW       --AKAAAHQ-----DKSTAQFYDAAAL---------------------------------
BIOB_SHEHH       --AKAAAQQ-----DKKVSAFYDAGAL---------------------------------
BIOB_SHEPA       --AKAAAHQ-----DKKSAAFYDAGAL---------------------------------
BIOB_SHEPW       --AKAAAQQ-----DKKASAFYDAGAL---------------------------------
BIOB_SHEDO       --AKASALN-----EKATQQFYDAGAL---------------------------------
BIOB_SHEFN       --AKASAKQ-----DKSTKQFFDAAAL---------------------------------
BIOB_SHESH       ASAKANAIK-----DKQSGAFYDAGAL---------------------------------
BIOB_SHEWM       ATAKANAIK-----DKQSSAFYDAAAL---------------------------------
BIOB_SHELP       --AKAQAVK-----DKASQPFYDAAAL---------------------------------
BIOB_SHEAM       --ARAAREQQAEGEAKTKPLFYDAAN----------------------------------
BIOB_AERHH       VSRQSEPA----------EMFYDATRPRAGAARS--------------------------
BIOB_AERS4       VSRQNAPD----------EMFYDATRPRAGVARS--------------------------
BIOB_ALTMD       IAQQQEQAE------GSNDLFIDATKPKVAAKQQHATEA---------------------
BIOB_PSEA6       I--QTNEAP------QAPEMFYDATQKKPETVNI--------------------------
BIOB_ALIF1       VAERVAARP------NKDDLFYEASV----------------------------------
BIOB_ALIFM       VAERVAARP------NKDDLFYEASV----------------------------------
BIOB_ALISL       VAERVASRP------DKNDLFYEASV----------------------------------
BIOB_VIBC3       VVERVAARP------TASDLFYDAAL----------------------------------
BIOB_VIBCH       VVERVAARP------TASDLFYDAAL----------------------------------
BIOB_VIBTL       VVERVAARP------TKDDMFYDATV----------------------------------
BIOB_VIBCB       VVERVTARP------TKDDLFYDASV----------------------------------
BIOB_VIBPA       VVERVAARP------TKDDLFYDASV----------------------------------
BIOB_VIBVU       VVESVAARP------TKDDLFYDASL----------------------------------
BIOB_VIBVY       VVESVAARP------TKDDLFYDASL----------------------------------
BIOB_PHOPR       VAQRVAARP------GKDDLFYDATV----------------------------------
BIOB_BUCA5       -SSKIKKD-----------QYYNAAII---------------------------------
BIOB_BUCAT       -SSKIKKD-----------QYYNAAII---------------------------------
BIOB_BUCAI       -SSKIKKD-----------QYYNAAII---------------------------------
BIOB_BUCAP       -ISDVNKA-----------QYYNAAI----------------------------------
BIOB_BUCBP       YTSKIHSQ-----------QFYNAETA---------------------------------
BIOB_WIGBR       NSDLYENK-----------NYYNAVC----------------------------------
BIOB_BAUCH       LHDNQQHD-----------NTISS------------------------------------
BIOB_PECAS       QLINADSE-----------QFYNAAV----------------------------------
BIOB_ERWT9       QLLSADTE-----------QFYNAAR----------------------------------
BIOB_SERMA       QLLNADTA-----------EFYNAAP----------------------------------
BIOB_SERP5       QLMQADTA-----------EFYNAAL----------------------------------
BIOB_YERPA       QLLHGDTA-----------QFYNAAV----------------------------------
BIOB_YERPB       QLLHGDTA-----------QFYNAAV----------------------------------
BIOB_YERPE       QLLHGDTA-----------QFYNAAV----------------------------------
BIOB_YERPG       QLLHGDTA-----------QFYNAAV----------------------------------
BIOB_YERPN       QLLHGDTA-----------QFYNAAV----------------------------------
BIOB_YERPP       QLLHGDTA-----------QFYNAAV----------------------------------
BIOB_YERPS       QLLHGDTA-----------QFYNAAV----------------------------------
BIOB_YERPY       QLLHGDTA-----------QFYNAAV----------------------------------
BIOB_YERP3       QLLHGDTA-----------QFYNAAV----------------------------------
BIOB_YERE8       QLLHSDSLP------EDSVQFYNAAH----------------------------------
BIOB_PSEVU       QIFNADTD-----------QFYNAAAL---------------------------------
BIOB_ENT38       QLFNADTE-----------QYYNAATV---------------------------------
BIOB_KLEP3       ALLTPDTE-----------EYYNAAAL---------------------------------
BIOB_KLEP7       ALLTPDTE-----------EYYNAAAL---------------------------------
BIOB_SALPB       TLMTPDTD-----------DYYNAAAL---------------------------------
BIOB_SALPC       TLMTPDTD-----------DYYNAAAL---------------------------------
BIOB_SALNS       TLMTPDTD-----------DYYNAAAL---------------------------------
BIOB_SALTY       TLMTPDTD-----------DYYNAAAL---------------------------------
BIOB_SALCH       TLMTPDTD-----------DYYNAAAL---------------------------------
BIOB_SALA4       TLMTPDTD-----------DYYNAAAL---------------------------------
BIOB_SALTI       TLMTPDTD-----------DYYNAAAL---------------------------------
BIOB_SALHS       TLMTPDTD-----------DYYNAAAL---------------------------------
BIOB_SALPA       TLMTPDTD-----------DYYNAAAL---------------------------------
BIOB_SALDC       TLMTPDTD-----------DYYNAAAL---------------------------------
BIOB_SALEP       TLMTPDTD-----------DYYNAAAL---------------------------------
BIOB_SALSV       TLMTPDTD-----------DYYNAAAL---------------------------------
BIOB_SALPK       TLMTPDTD-----------DYYNAAAL---------------------------------
BIOB_SALG2       TLMTPDTD-----------DYYNAAAL---------------------------------
BIOB_SALAR       TLMTPDTD-----------DYYNAAAL---------------------------------
BIOB_CITK8       ALMTPDTD-----------DYYNAAAV---------------------------------
BIOB_SHIB3       ALMTPDTD-----------EYYNAAAL---------------------------------
BIOB_SHIBS       ALMTPDTD-----------EYYNAAAL---------------------------------
BIOB_ECO81       ALMTPDTD-----------EYYNAAAL---------------------------------
BIOB_ECOL6       ALMTPDTD-----------EYYNAAAL---------------------------------
BIOB_ECOK1       ALMTPDTD-----------EYYNAAAL---------------------------------
BIOB_ECOUT       ALMTPDTD-----------EYYNAAAL---------------------------------
BIOB_ECO45       ALMTPDTD-----------EYYNAAAL---------------------------------
BIOB_ECOL5       ALMTPDTD-----------EYYNAAAL---------------------------------
BIOB_SHIF8       ALMTPDTD-----------EYYNAAAL---------------------------------
BIOB_SHIFL       ALMTPDTD-----------EYYNAAAL---------------------------------
BIOB_ECO57       ALMTPDTD-----------EYYNAAAL---------------------------------
BIOB_ECO5E       ALMTPDTD-----------EYYNAAAL---------------------------------
BIOB_SHISS       ALMTPDTD-----------EYYNAAAL---------------------------------
BIOB_ECOLI       ALMTPDTD-----------EYYNAAAL---------------------------------
BIOB_ECOSM       ALMTPDTD-----------EYYNAAAL---------------------------------
BIOB_ECOLU       ALMTPDTD-----------EYYNAAAL---------------------------------
BIOB_ECOLC       ALMTPDTD-----------EYYNAAAL---------------------------------
BIOB_ECOHS       ALMTPDTD-----------EYYNAAAL---------------------------------
BIOB_ECODH       ALMTPDTD-----------EYYNAAAL---------------------------------
BIOB_ECO8A       ALMTPDTD-----------EYYNAAAL---------------------------------
BIOB_ECO7I       ALMTPDTD-----------EYYNAAAL---------------------------------
BIOB_ECO55       ALMTPDTD-----------EYYNAAAL---------------------------------
BIOB_ECO27       ALMTPDTD-----------EYYNAAAL---------------------------------
BIOB_ECO24       ALMTPDTD-----------EYYNAAAL---------------------------------
BIOB_SHIDS       ALMTPDTD-----------EYYNAAAL---------------------------------
BIOB_ECOSE       ALMTPDTD-----------EYYNAAAL---------------------------------
BIOB_ESCF3       ALMTPDTD-----------EYYNAAAL---------------------------------
BIOB_CROS8       ALRDADNQ-----------QYYNAAAV---------------------------------
BIOB_PHOLL       AIINADNE-----------QFYNAAL----------------------------------
BIOB_PROMH       AVAEKDTE-----------QFYNAAL----------------------------------
BIOB_SODGM       ELLTADTA-----------HYYNAAR----------------------------------
BIOB_METI4       ------------------------------------------------------------
BIOB_BACSU       ------------------------------------------------------------
BIOB_BACNA       ------------------------------------------------------------
BIOB_BACVZ       ------------------------------------------------------------
BIOB_BACAM       ------------------------------------------------------------
BIOB_BACLD       ------------------------------------------------------------
BIOB_BACHD       ------------------------------------------------------------
BIOB_GEOKA       ------------------------------------------------------------
BIOB_GEOTN       ------------------------------------------------------------
BIOB_ANOFW       ------------------------------------------------------------
BIOB_LYSSH       ------------------------------------------------------------
BIOB_LYSSC       ------------------------------------------------------------
BIOB_BACAN       ------------------------------------------------------------
BIOB_BACC0       ------------------------------------------------------------
BIOB_BACCZ       ------------------------------------------------------------
BIOB_BACHK       ------------------------------------------------------------
BIOB_BACAH       ------------------------------------------------------------
BIOB_BACC7       ------------------------------------------------------------
BIOB_BACCQ       ------------------------------------------------------------
BIOB_BACC1       ------------------------------------------------------------
BIOB_BACC2       ------------------------------------------------------------
BIOB_BACC4       ------------------------------------------------------------
BIOB_BACCR       ------------------------------------------------------------
BIOB_BACMK       ------------------------------------------------------------
BIOB_BACCN       ------------------------------------------------------------
BIOB_BACP2       ------------------------------------------------------------
BIOB_STAAM       ------------------------------------------------------------
BIOB_STAAN       ------------------------------------------------------------
BIOB_STAAS       ------------------------------------------------------------
BIOB_STAA9       ------------------------------------------------------------
BIOB_STAAB       ------------------------------------------------------------
BIOB_STAAW       ------------------------------------------------------------
BIOB_STAA1       ------------------------------------------------------------
BIOB_STAA2       ------------------------------------------------------------
BIOB_STAAR       ------------------------------------------------------------
BIOB_STAAC       ------------------------------------------------------------
BIOB_STAAT       ------------------------------------------------------------
BIOB_STAA8       ------------------------------------------------------------
BIOB_STAAE       ------------------------------------------------------------
BIOB_STAA3       ------------------------------------------------------------
BIOB_STAEQ       ------------------------------------------------------------
BIOB_STAES       ------------------------------------------------------------
BIOB_STAHJ       ------------------------------------------------------------
BIOB_STACT       ------------------------------------------------------------
BIOB_MACCJ       ------------------------------------------------------------
BIOB_RHOBA       ------------------------------------------------------------
BIOB_THEEB       ------------------------------------------------------------
BIOB_SALRD       ------------------------------------------------------------
BIOB_STRAW       TLPEHRAPA--GGCGSEQ-------------------------------------SAGCG
BIOB_STRCO       TLPEHRASVRGGGCGSHEGGGACGSHDGAD------------------------GDAGCG
BIOB_STRGG       TLPRHRADALSGGCGTRDATAGSGCGSHEDS-----------------------GAGGCG
BIOB2_FRACC      AEAALAMGA---------------------------------------------------
BIOB_NOCSJ       KPAGTATAAHRAQTAHDIAGGTSVAGSAP-------------------------------
BIOB_SACEN       DLAQQAREPI--------------------------------------------------
BIOB_KOCRD       QGAGERTTTPCGSVCGSAAGSSSGDGSAPDGGRAPADVSRSGPAEAVGSSPEDGSRNAGG
BIOB_RENSM       ----RASAPQGG------------------------------------------------
BIOB_CUTAK       PMVHTDVNSHHSANLP--------------------------------------------
BIOB_ACAM1       ------------------------------------------------------------
BIOB_MAGMM       ------------------------------------------------------------
BIOB_LEPBA       ------------------------------------------------------------
BIOB_LEPBP       ------------------------------------------------------------
BIOB_LEPBJ       ------------------------------------------------------------
BIOB_LEPBL       ------------------------------------------------------------
BIOB_LEPIC       ------------------------------------------------------------
BIOB_LEPIN       ------------------------------------------------------------
BIOB_THET2       ------------------------------------------------------------
BIOB_THET8       ------------------------------------------------------------
BIOB_STRA1       ------------------------------------------------------------
BIOB_STRA5       ------------------------------------------------------------
BIOB_STRA3       ------------------------------------------------------------
BIOB_CORGL       ------------------------------------------------------------
BIOB_CORGB       ------------------------------------------------------------
BIOB_COREF       ------------------------------------------------------------
BIOB1_CORDI      ------------------------------------------------------------
BIOB_CORU7       ------------------------------------------------------------
BIOB_CORJK       ------------------------------------------------------------
BIOB_MYCBO       ------------------------------------------------------------
BIOB_MYCTU       ------------------------------------------------------------
BIOB_MYCTA       ------------------------------------------------------------
BIOB_MYCTF       ------------------------------------------------------------
BIOB_MYCBP       ------------------------------------------------------------
BIOB_MYCMM       ------------------------------------------------------------
BIOB_MYCUA       ------------------------------------------------------------
BIOB_MYCA1       ------------------------------------------------------------
BIOB_MYCPA       ------------------------------------------------------------
BIOB_MYCLE       ------------------------------------------------------------
BIOB_MYCLB       ------------------------------------------------------------
BIOB_MYCGI       ------------------------------------------------------------
BIOB_MYCVP       ------------------------------------------------------------
BIOB_MYCSJ       ------------------------------------------------------------
BIOB_MYCSK       ------------------------------------------------------------
BIOB_MYCSS       ------------------------------------------------------------
BIOB_MYCS2       ------------------------------------------------------------
BIOB_MYCA9       ------------------------------------------------------------
BIOB_NOCFA       ------------------------------------------------------------
BIOB_RHOJR       ------------------------------------------------------------
BIOB_FRAAA       ------------------------------------------------------------
BIOB1_FRACC      ------------------------------------------------------------
BIOB_FRASN       ------------------------------------------------------------
BIOB_SALAI       ------------------------------------------------------------
BIOB_SALTO       ------------------------------------------------------------
BIOB_PSECP       ------------------------------------------------------------
BIOB_ARTS2       ------------------------------------------------------------
BIOB_PAEAT       ------------------------------------------------------------
BIOB_ACIC1       ------------------------------------------------------------
BIOB_CENSY       ------------------------------------------------------------
BIOB_NITMS       ------------------------------------------------------------
BIOB_HELPY       ------------------------------------------------------------
BIOB_HELPH       ------------------------------------------------------------
BIOB_HELPS       ------------------------------------------------------------
BIOB_HELPG       ------------------------------------------------------------
BIOB_HELPJ       ------------------------------------------------------------
BIOB_HELP2       ------------------------------------------------------------
BIOB_HELAH       ------------------------------------------------------------
BIOB_HELHP       ------------------------------------------------------------
BIOB_WOLSU       ------------------------------------------------------------
BIOB_ARCB4       ------------------------------------------------------------
BIOB_NITSB       ------------------------------------------------------------
BIOB_NAUPA       ------------------------------------------------------------
BIOB_CAMC1       ------------------------------------------------------------
BIOB_CAMC5       ------------------------------------------------------------
BIOB_CAMFF       ------------------------------------------------------------
BIOB_CAMJ8       ------------------------------------------------------------
BIOB_CAMJJ       ------------------------------------------------------------
BIOB_CAMJE       ------------------------------------------------------------
BIOB_CAMJR       ------------------------------------------------------------
BIOB_CAMJD       ------------------------------------------------------------
BIOB_CAMLR       ------------------------------------------------------------
BIOB_SULDN       ------------------------------------------------------------
BIOB_SULNB       ------------------------------------------------------------
BIOB_METM6       ------------------------------------------------------------
BIOB_METMP       ------------------------------------------------------------
BIOB_METM5       ------------------------------------------------------------
BIOB_METM7       ------------------------------------------------------------
BIOB_METVS       ------------------------------------------------------------
BIOB_META3       ------------------------------------------------------------
BIOB_METJA       ------------------------------------------------------------
BIOB_CALBD       ------------------------------------------------------------
BIOB_CALS8       ------------------------------------------------------------
BIOB_AQUAE       ------------------------------------------------------------
BIOB_HYDS0       ------------------------------------------------------------
BIOB_PERMH       ------------------------------------------------------------
BIOB_SULSY       ------------------------------------------------------------
BIOB_UNCTG       ------------------------------------------------------------
BIOB_THENN       ------------------------------------------------------------
BIOB_THEP1       ------------------------------------------------------------
BIOB_THEYD       ------------------------------------------------------------
BIOB_DESDA       ------------------------------------------------------------
BIOB_ALKMQ       ------------------------------------------------------------
BIOB_CLOB8       ------------------------------------------------------------
BIOB_CLOB1       ------------------------------------------------------------
BIOB_CLOBH       ------------------------------------------------------------
BIOB_CLOBK       ------------------------------------------------------------
BIOB_CLOBL       ------------------------------------------------------------
BIOB_CLOBM       ------------------------------------------------------------
BIOB_CLOBA       ------------------------------------------------------------
BIOB_CLOBB       ------------------------------------------------------------
BIOB_BRAHW       ------------------------------------------------------------
BIOB_AKKM8       ------------------------------------------------------------
BIOB2_CORDI      ------------------------------------------------------------
BIOB_CAMHC       ------------------------------------------------------------
BIOB_FUSNN       ------------------------------------------------------------
BIOB_CLOD6       ------------------------------------------------------------
BIOB_HUNT2       ------------------------------------------------------------
BIOB_CLOK1       ------------------------------------------------------------
BIOB_CLOTE       ------------------------------------------------------------
BIOB_CLONN       ------------------------------------------------------------
BIOB_CLOP1       ------------------------------------------------------------
BIOB_CLOPE       ------------------------------------------------------------
BIOB_PORG3       ------------------------------------------------------------
BIOB_PORGI       ------------------------------------------------------------
BIOB_PARD8       ------------------------------------------------------------
BIOB_CROS5       ------------------------------------------------------------
BIOB_RIPO1       ------------------------------------------------------------
BIOB_GLOC7       ------------------------------------------------------------
BIOB_MICAN       ------------------------------------------------------------
BIOB_TRIEI       ------------------------------------------------------------
BIOB_SYNY3       ------------------------------------------------------------
BIOB_CYAP4       ------------------------------------------------------------
BIOB_SYNP2       ------------------------------------------------------------
BIOB_CARHZ       ------------------------------------------------------------
BIOB_CLOAB       ------------------------------------------------------------
BIOB_DESAP       ------------------------------------------------------------
BIOB_PELTS       ------------------------------------------------------------
BIOB_HELMI       ------------------------------------------------------------
BIOB_DESPS       ------------------------------------------------------------
BIOB_DESRM       ------------------------------------------------------------
BIOB_ANAD2       AAEPR-PRPLPVVR----------------------------------------------
BIOB_ANASK       AAEPR-PRPLPVVR----------------------------------------------
BIOB_ANADE       AAEPR-PRALPVVR----------------------------------------------
BIOB_ANADF       AAEPGGKRGLPVVGPPRGGCA---------------------------------------
BIOB_DESVH       ------------------------------------------------------------
BIOB_DESVV       ------------------------------------------------------------
BIOB_DESVM       ------------------------------------------------------------
BIOB_DESAG       ------------------------------------------------------------
BIOB_GEOMG       ------------------------------------------------------------
BIOB_GEOSL       ------------------------------------------------------------
BIOB_GEODF       ------------------------------------------------------------
BIOB_GEOUR       ------------------------------------------------------------
BIOB_GEOBB       ------------------------------------------------------------
BIOB_PELPD       ------------------------------------------------------------
BIOB_GEOLS       ------------------------------------------------------------
BIOB_PELCD       ------------------------------------------------------------
BIOB_SYNAS       ------------------------------------------------------------
BIOB_DESAL       ------------------------------------------------------------
BIOB_DESOH       ------------------------------------------------------------
BIOB_SYNFM       ------------------------------------------------------------
BIOB_CHLCH       ------------------------------------------------------------
BIOB_PELPB       ------------------------------------------------------------
BIOB_CHLP8       ------------------------------------------------------------
BIOB_CHLTE       ------------------------------------------------------------
BIOB_CHLL2       ------------------------------------------------------------
BIOB_PELLD       ------------------------------------------------------------
BIOB_CHLPM       ------------------------------------------------------------
BIOB_CHLPD       ------------------------------------------------------------
BIOB_CHLPB       ------------------------------------------------------------
BIOB_PROA2       ------------------------------------------------------------
BIOB_NATPD       SNANRTNATTETDD----------------------------------------------
                                                                             

BIOB_FRAT1       ------------------------------------------------------------
BIOB_FRATT       ------------------------------------------------------------
BIOB_FRATN       ------------------------------------------------------------
BIOB_FRATW       ------------------------------------------------------------
BIOB_FRATM       ------------------------------------------------------------
BIOB_FRATF       ------------------------------------------------------------
BIOB_FRATH       ------------------------------------------------------------
BIOB_FRATO       ------------------------------------------------------------
BIOB_FRAP2       ------------------------------------------------------------
BIOB_COXB1       ------------------------------------------------------------
BIOB_COXB2       ------------------------------------------------------------
BIOB_COXBN       ------------------------------------------------------------
BIOB_COXBR       ------------------------------------------------------------
BIOB_COXBU       ------------------------------------------------------------
BIOB_LAWIP       ------------------------------------------------------------
BIOB_RICFE       ------------------------------------------------------------
BIOB_NEOSM       ------------------------------------------------------------
BIOB_ANAMF       ------------------------------------------------------------
BIOB_ANAMM       ------------------------------------------------------------
BIOB_ANAPZ       ------------------------------------------------------------
BIOB_EHRCJ       ------------------------------------------------------------
BIOB_EHRCR       ------------------------------------------------------------
BIOB_EHRRG       ------------------------------------------------------------
BIOB_EHRRW       ------------------------------------------------------------
BIOB_AGRRK       ------------------------------------------------------------
BIOB_AGRVS       ------------------------------------------------------------
BIOB_RUEPO       ------------------------------------------------------------
BIOB_BEII9       ------------------------------------------------------------
BIOB_METSB       ------------------------------------------------------------
BIOB_ZYMMO       ------------------------------------------------------------
BIOB_METC4       ------------------------------------------------------------
BIOB_METEP       ------------------------------------------------------------
BIOB_METPB       ------------------------------------------------------------
BIOB_METRJ       ------------------------------------------------------------
BIOB_METNO       ------------------------------------------------------------
BIOB_METS4       ------------------------------------------------------------
BIOB_PROM2       ------------------------------------------------------------
BIOB_PROM9       ------------------------------------------------------------
BIOB_PROMS       ------------------------------------------------------------
BIOB_PROM0       ------------------------------------------------------------
BIOB_PROM5       ------------------------------------------------------------
BIOB_PROMP       ------------------------------------------------------------
BIOB_PROM1       ------------------------------------------------------------
BIOB_PROMT       ------------------------------------------------------------
BIOB_PROM4       ------------------------------------------------------------
BIOB_PROMA       ------------------------------------------------------------
BIOB_PROM3       ------------------------------------------------------------
BIOB_PROMM       ------------------------------------------------------------
BIOB_SYNPW       ------------------------------------------------------------
BIOB_SYNS3       ------------------------------------------------------------
BIOB_SYNPX       ------------------------------------------------------------
BIOB_SYNSC       ------------------------------------------------------------
BIOB_SYNS9       ------------------------------------------------------------
BIOB_SYNR3       ------------------------------------------------------------
BIOB_SYNE7       ------------------------------------------------------------
BIOB_SYNP6       ------------------------------------------------------------
BIOB_SORC5       ------------------------------------------------------------
BIOB_MYXXD       ------------------------------------------------------------
BIOB_GLOVI       ------------------------------------------------------------
BIOB_SYNJA       ------------------------------------------------------------
BIOB_NOSS1       ------------------------------------------------------------
BIOB_TRIV2       ------------------------------------------------------------
BIOB_NOSP7       ------------------------------------------------------------
BIOB_CHLAB       ------------------------------------------------------------
BIOB_CHLFF       ------------------------------------------------------------
BIOB_CHLPN       ------------------------------------------------------------
BIOB_FLAJ1       ------------------------------------------------------------
BIOB_FLAPJ       ------------------------------------------------------------
BIOB_GRAFK       ------------------------------------------------------------
BIOB_CYTH3       ------------------------------------------------------------
BIOB_HYDCU       ------------------------------------------------------------
BIOB_BRUA1       ------------------------------------------------------------
BIOB_BRUA2       ------------------------------------------------------------
BIOB_BRUAB       ------------------------------------------------------------
BIOB_BRUC2       ------------------------------------------------------------
BIOB_BRUMB       ------------------------------------------------------------
BIOB_BRUME       ------------------------------------------------------------
BIOB_BRUSI       ------------------------------------------------------------
BIOB_BRUSU       ------------------------------------------------------------
BIOB_BRUO2       ------------------------------------------------------------
BIOB_OCHA4       ------------------------------------------------------------
BIOB_AGRFC       ------------------------------------------------------------
BIOB2_PARDP      ------------------------------------------------------------
BIOB_LEGPA       ------------------------------------------------------------
BIOB_LEGPH       ------------------------------------------------------------
BIOB_LEGPL       ------------------------------------------------------------
BIOB_LEGPC       ------------------------------------------------------------
BIOB_RUTMC       ------------------------------------------------------------
BIOB_VESOH       ------------------------------------------------------------
BIOB_HAEI8       ------------------------------------------------------------
BIOB_HAEIE       ------------------------------------------------------------
BIOB_HAEIN       ------------------------------------------------------------
BIOB_HAEIG       ------------------------------------------------------------
BIOB_HAES1       ------------------------------------------------------------
BIOB_HISS2       ------------------------------------------------------------
BIOB_PASMU       ------------------------------------------------------------
BIOB_ACTSZ       ------------------------------------------------------------
BIOB_MANSM       ------------------------------------------------------------
BIOB_ACTP7       ------------------------------------------------------------
BIOB_ACTPJ       ------------------------------------------------------------
BIOB_ACTP2       ------------------------------------------------------------
BIOB_HAEDU       ------------------------------------------------------------
BIOB_HAEPS       ------------------------------------------------------------
BIOB_NEIG1       ------------------------------------------------------------
BIOB_NEIG2       ------------------------------------------------------------
BIOB_NEIM0       ------------------------------------------------------------
BIOB_NEIMF       ------------------------------------------------------------
BIOB_NEIMA       ------------------------------------------------------------
BIOB_NEIMB       ------------------------------------------------------------
BIOB_CHRVO       ------------------------------------------------------------
BIOB_METSK       ------------------------------------------------------------
BIOB_METFK       ------------------------------------------------------------
BIOB_THIDA       ------------------------------------------------------------
BIOB_NITEC       ------------------------------------------------------------
BIOB_NITEU       ------------------------------------------------------------
BIOB_NITMU       ------------------------------------------------------------
BIOB_ACISJ       ------------------------------------------------------------
BIOB_ACIET       ------------------------------------------------------------
BIOB_DELAS       ------------------------------------------------------------
BIOB_ACIAC       ------------------------------------------------------------
BIOB_METPP       ------------------------------------------------------------
BIOB1_POLSJ      ------------------------------------------------------------
BIOB_HERAR       ------------------------------------------------------------
BIOB_JANMA       ------------------------------------------------------------
BIOB_RHOFT       ------------------------------------------------------------
BIOB_POLAQ       ------------------------------------------------------------
BIOB_BORBR       ------------------------------------------------------------
BIOB_BORPA       ------------------------------------------------------------
BIOB_BORPE       ------------------------------------------------------------
BIOB_BORPD       ------------------------------------------------------------
BIOB_BORA1       ------------------------------------------------------------
BIOB_BURCM       ------------------------------------------------------------
BIOB_BURL3       ------------------------------------------------------------
BIOB_BURA4       ------------------------------------------------------------
BIOB_BURVG       ------------------------------------------------------------
BIOB_BURM1       ------------------------------------------------------------
BIOB_BURCA       ------------------------------------------------------------
BIOB_BURCC       ------------------------------------------------------------
BIOB_BURCH       ------------------------------------------------------------
BIOB_BURCJ       ------------------------------------------------------------
BIOB_BURM7       ------------------------------------------------------------
BIOB_BURM9       ------------------------------------------------------------
BIOB_BURP6       ------------------------------------------------------------
BIOB_BURMA       ------------------------------------------------------------
BIOB_BURMS       ------------------------------------------------------------
BIOB_BURP0       ------------------------------------------------------------
BIOB_BURPS       ------------------------------------------------------------
BIOB_BURP1       ------------------------------------------------------------
BIOB_BURTA       ------------------------------------------------------------
BIOB_PARPJ       ------------------------------------------------------------
BIOB_PARXL       ------------------------------------------------------------
BIOB_PARP8       ------------------------------------------------------------
BIOB_CUPTR       ------------------------------------------------------------
BIOB_CUPNH       ------------------------------------------------------------
BIOB_CUPPJ       ------------------------------------------------------------
BIOB_CUPMC       ------------------------------------------------------------
BIOB_POLNA       ------------------------------------------------------------
BIOB2_POLSJ      ------------------------------------------------------------
BIOB_LEPCP       ------------------------------------------------------------
BIOB_RALPJ       ------------------------------------------------------------
BIOB_RALSO       ------------------------------------------------------------
BIOB_AZOSB       ------------------------------------------------------------
BIOB_AROAE       ------------------------------------------------------------
BIOB_DECAR       ------------------------------------------------------------
BIOB_GLUDA       ------------------------------------------------------------
BIOB_GLUOX       ------------------------------------------------------------
BIOB_GRABC       ------------------------------------------------------------
BIOB_ACICJ       ------------------------------------------------------------
BIOB_STRM5       ------------------------------------------------------------
BIOB_STRMK       ------------------------------------------------------------
BIOB_XANAC       ------------------------------------------------------------
BIOB_XANC5       ------------------------------------------------------------
BIOB_XANOM       ------------------------------------------------------------
BIOB_XANOP       ------------------------------------------------------------
BIOB_XANOR       ------------------------------------------------------------
BIOB_XANC8       ------------------------------------------------------------
BIOB_XANCB       ------------------------------------------------------------
BIOB_XANCP       ------------------------------------------------------------
BIOB_XYLF2       ------------------------------------------------------------
BIOB_XYLFT       ------------------------------------------------------------
BIOB_XYLFM       ------------------------------------------------------------
BIOB_XYLFA       ------------------------------------------------------------
BIOB_AZOC5       ------------------------------------------------------------
BIOB_XANP2       ------------------------------------------------------------
BIOB_RHOS1       ------------------------------------------------------------
BIOB_RHOS4       ------------------------------------------------------------
BIOB_RHOSK       ------------------------------------------------------------
BIOB1_PARDP      ------------------------------------------------------------
BIOB_BRASB       ------------------------------------------------------------
BIOB_BRASO       ------------------------------------------------------------
BIOB_NITHX       ------------------------------------------------------------
BIOB_NITWN       ------------------------------------------------------------
BIOB_OLICO       ------------------------------------------------------------
BIOB_BRADU       ------------------------------------------------------------
BIOB_RHOPA       ------------------------------------------------------------
BIOB_RHOPT       ------------------------------------------------------------
BIOB_RHOPS       ------------------------------------------------------------
BIOB_RHOP2       ------------------------------------------------------------
BIOB_RHOP5       ------------------------------------------------------------
BIOB_RHOPB       ------------------------------------------------------------
BIOB_CAUVN       ------------------------------------------------------------
BIOB_CAUVC       ------------------------------------------------------------
BIOB_CAUSK       ------------------------------------------------------------
BIOB_PHEZH       ------------------------------------------------------------
BIOB_HYPNA       ------------------------------------------------------------
BIOB_MARMM       ------------------------------------------------------------
BIOB_ERYLH       ------------------------------------------------------------
BIOB_NOVAD       ------------------------------------------------------------
BIOB_SPHAL       ------------------------------------------------------------
BIOB_SPHWW       ------------------------------------------------------------
BIOB_PARL1       ------------------------------------------------------------
BIOB_ACIF2       ------------------------------------------------------------
BIOB_ACIF5       ------------------------------------------------------------
BIOB_NITOC       ------------------------------------------------------------
BIOB_THISH       ------------------------------------------------------------
BIOB_ALKEH       ------------------------------------------------------------
BIOB_HALHL       ------------------------------------------------------------
BIOB_ALCBS       ------------------------------------------------------------
BIOB_METCA       ------------------------------------------------------------
BIOB_MAGSA       ------------------------------------------------------------
BIOB_ACIB3       ------------------------------------------------------------
BIOB_ACIB5       ------------------------------------------------------------
BIOB_ACIBY       ------------------------------------------------------------
BIOB_ACIBC       ------------------------------------------------------------
BIOB_ACIBT       ------------------------------------------------------------
BIOB_ACIBS       ------------------------------------------------------------
BIOB_ACICA       ------------------------------------------------------------
BIOB_ACIAD       ------------------------------------------------------------
BIOB_PSYA2       ------------------------------------------------------------
BIOB_PSYCK       ------------------------------------------------------------
BIOB_PSYWF       ------------------------------------------------------------
BIOB_CELJU       ------------------------------------------------------------
BIOB_SACD2       ------------------------------------------------------------
BIOB_HAHCH       ------------------------------------------------------------
BIOB_MARHV       ------------------------------------------------------------
BIOB_CHRSD       ------------------------------------------------------------
BIOB_PSE14       ------------------------------------------------------------
BIOB_PSEU2       ------------------------------------------------------------
BIOB_PSESM       ------------------------------------------------------------
BIOB_PSEF5       ------------------------------------------------------------
BIOB_PSEPF       ------------------------------------------------------------
BIOB_PSEP1       ------------------------------------------------------------
BIOB_PSEPK       ------------------------------------------------------------
BIOB_PSEPG       ------------------------------------------------------------
BIOB_PSEPW       ------------------------------------------------------------
BIOB_PSEE4       ------------------------------------------------------------
BIOB_PSEA8       ------------------------------------------------------------
BIOB_PSEAE       ------------------------------------------------------------
BIOB_PSEAB       ------------------------------------------------------------
BIOB_PSEA7       ------------------------------------------------------------
BIOB_PSEMY       ------------------------------------------------------------
BIOB_PSEU5       ------------------------------------------------------------
BIOB_IDILO       ------------------------------------------------------------
BIOB_COLP3       ------------------------------------------------------------
BIOB_PSYIN       ------------------------------------------------------------
BIOB_MARMS       ------------------------------------------------------------
BIOB_PSEHT       ------------------------------------------------------------
BIOB_SHEB2       ------------------------------------------------------------
BIOB_SHEB5       ------------------------------------------------------------
BIOB_SHEB8       ------------------------------------------------------------
BIOB_SHEB9       ------------------------------------------------------------
BIOB_SHESA       ------------------------------------------------------------
BIOB_SHESM       ------------------------------------------------------------
BIOB_SHESR       ------------------------------------------------------------
BIOB_SHEON       ------------------------------------------------------------
BIOB_SHEPC       ------------------------------------------------------------
BIOB_SHESW       ------------------------------------------------------------
BIOB_SHEHH       ------------------------------------------------------------
BIOB_SHEPA       ------------------------------------------------------------
BIOB_SHEPW       ------------------------------------------------------------
BIOB_SHEDO       ------------------------------------------------------------
BIOB_SHEFN       ------------------------------------------------------------
BIOB_SHESH       ------------------------------------------------------------
BIOB_SHEWM       ------------------------------------------------------------
BIOB_SHELP       ------------------------------------------------------------
BIOB_SHEAM       ------------------------------------------------------------
BIOB_AERHH       ------------------------------------------------------------
BIOB_AERS4       ------------------------------------------------------------
BIOB_ALTMD       ------------------------------------------------------------
BIOB_PSEA6       ------------------------------------------------------------
BIOB_ALIF1       ------------------------------------------------------------
BIOB_ALIFM       ------------------------------------------------------------
BIOB_ALISL       ------------------------------------------------------------
BIOB_VIBC3       ------------------------------------------------------------
BIOB_VIBCH       ------------------------------------------------------------
BIOB_VIBTL       ------------------------------------------------------------
BIOB_VIBCB       ------------------------------------------------------------
BIOB_VIBPA       ------------------------------------------------------------
BIOB_VIBVU       ------------------------------------------------------------
BIOB_VIBVY       ------------------------------------------------------------
BIOB_PHOPR       ------------------------------------------------------------
BIOB_BUCA5       ------------------------------------------------------------
BIOB_BUCAT       ------------------------------------------------------------
BIOB_BUCAI       ------------------------------------------------------------
BIOB_BUCAP       ------------------------------------------------------------
BIOB_BUCBP       ------------------------------------------------------------
BIOB_WIGBR       ------------------------------------------------------------
BIOB_BAUCH       ------------------------------------------------------------
BIOB_PECAS       ------------------------------------------------------------
BIOB_ERWT9       ------------------------------------------------------------
BIOB_SERMA       ------------------------------------------------------------
BIOB_SERP5       ------------------------------------------------------------
BIOB_YERPA       ------------------------------------------------------------
BIOB_YERPB       ------------------------------------------------------------
BIOB_YERPE       ------------------------------------------------------------
BIOB_YERPG       ------------------------------------------------------------
BIOB_YERPN       ------------------------------------------------------------
BIOB_YERPP       ------------------------------------------------------------
BIOB_YERPS       ------------------------------------------------------------
BIOB_YERPY       ------------------------------------------------------------
BIOB_YERP3       ------------------------------------------------------------
BIOB_YERE8       ------------------------------------------------------------
BIOB_PSEVU       ------------------------------------------------------------
BIOB_ENT38       ------------------------------------------------------------
BIOB_KLEP3       ------------------------------------------------------------
BIOB_KLEP7       ------------------------------------------------------------
BIOB_SALPB       ------------------------------------------------------------
BIOB_SALPC       ------------------------------------------------------------
BIOB_SALNS       ------------------------------------------------------------
BIOB_SALTY       ------------------------------------------------------------
BIOB_SALCH       ------------------------------------------------------------
BIOB_SALA4       ------------------------------------------------------------
BIOB_SALTI       ------------------------------------------------------------
BIOB_SALHS       ------------------------------------------------------------
BIOB_SALPA       ------------------------------------------------------------
BIOB_SALDC       ------------------------------------------------------------
BIOB_SALEP       ------------------------------------------------------------
BIOB_SALSV       ------------------------------------------------------------
BIOB_SALPK       ------------------------------------------------------------
BIOB_SALG2       ------------------------------------------------------------
BIOB_SALAR       ------------------------------------------------------------
BIOB_CITK8       ------------------------------------------------------------
BIOB_SHIB3       ------------------------------------------------------------
BIOB_SHIBS       ------------------------------------------------------------
BIOB_ECO81       ------------------------------------------------------------
BIOB_ECOL6       ------------------------------------------------------------
BIOB_ECOK1       ------------------------------------------------------------
BIOB_ECOUT       ------------------------------------------------------------
BIOB_ECO45       ------------------------------------------------------------
BIOB_ECOL5       ------------------------------------------------------------
BIOB_SHIF8       ------------------------------------------------------------
BIOB_SHIFL       ------------------------------------------------------------
BIOB_ECO57       ------------------------------------------------------------
BIOB_ECO5E       ------------------------------------------------------------
BIOB_SHISS       ------------------------------------------------------------
BIOB_ECOLI       ------------------------------------------------------------
BIOB_ECOSM       ------------------------------------------------------------
BIOB_ECOLU       ------------------------------------------------------------
BIOB_ECOLC       ------------------------------------------------------------
BIOB_ECOHS       ------------------------------------------------------------
BIOB_ECODH       ------------------------------------------------------------
BIOB_ECO8A       ------------------------------------------------------------
BIOB_ECO7I       ------------------------------------------------------------
BIOB_ECO55       ------------------------------------------------------------
BIOB_ECO27       ------------------------------------------------------------
BIOB_ECO24       ------------------------------------------------------------
BIOB_SHIDS       ------------------------------------------------------------
BIOB_ECOSE       ------------------------------------------------------------
BIOB_ESCF3       ------------------------------------------------------------
BIOB_CROS8       ------------------------------------------------------------
BIOB_PHOLL       ------------------------------------------------------------
BIOB_PROMH       ------------------------------------------------------------
BIOB_SODGM       ------------------------------------------------------------
BIOB_METI4       ------------------------------------------------------------
BIOB_BACSU       ------------------------------------------------EMKASLSAKS--
BIOB_BACNA       ------------------------------------------------EMKASLSAKS--
BIOB_BACVZ       ------------------------------------------------EMKAGLQSACNT
BIOB_BACAM       ------------------------------------------------EMKAGLQSACNT
BIOB_BACLD       ------------------------------------------------EMKASLQR----
BIOB_BACHD       ------------------------------------------------EMKASLQGQ---
BIOB_GEOKA       ------------------------------------------------APQAGVVS----
BIOB_GEOTN       ------------------------------------------------APQIGVV-----
BIOB_ANOFW       ------------------------------------------------ASYAR-------
BIOB_LYSSH       ------------------------------------------------KQEEAFCS----
BIOB_LYSSC       ------------------------------------------------KQEAAFC-----
BIOB_BACAN       ------------------------------------------------L-----------
BIOB_BACC0       ------------------------------------------------L-----------
BIOB_BACCZ       ------------------------------------------------L-----------
BIOB_BACHK       ------------------------------------------------L-----------
BIOB_BACAH       ------------------------------------------------L-----------
BIOB_BACC7       ------------------------------------------------L-----------
BIOB_BACCQ       ------------------------------------------------L-----------
BIOB_BACC1       ------------------------------------------------L-----------
BIOB_BACC2       ------------------------------------------------L-----------
BIOB_BACC4       ------------------------------------------------L-----------
BIOB_BACCR       ------------------------------------------------L-----------
BIOB_BACMK       ------------------------------------------------L-----------
BIOB_BACCN       ------------------------------------------------L-----------
BIOB_BACP2       ------------------------------------------------L-----------
BIOB_STAAM       ------------------------------------------------CENKENKNDVSR
BIOB_STAAN       ------------------------------------------------CENKENKNDVSR
BIOB_STAAS       ------------------------------------------------CENKENKNDVSR
BIOB_STAA9       ------------------------------------------------CENKENKNDVSR
BIOB_STAAB       ------------------------------------------------CENKENKNDVSR
BIOB_STAAW       ------------------------------------------------CENKENKNDVSR
BIOB_STAA1       ------------------------------------------------CENKENKNDVSR
BIOB_STAA2       ------------------------------------------------CENKENKNDVSR
BIOB_STAAR       ------------------------------------------------CENKENKNDVSR
BIOB_STAAC       ------------------------------------------------CENKENKNEVSR
BIOB_STAAT       ------------------------------------------------CENKENKNEVSR
BIOB_STAA8       ------------------------------------------------CENKENKNEVSR
BIOB_STAAE       ------------------------------------------------CENKENKNEVSR
BIOB_STAA3       ------------------------------------------------CENKENKNEVSR
BIOB_STAEQ       ------------------------------------------------------------
BIOB_STAES       ------------------------------------------------------------
BIOB_STAHJ       ------------------------------------------------------------
BIOB_STACT       ------------------------------------------------LPEDTAEKITET
BIOB_MACCJ       ------------------------------------------------SEINKAALKI--
BIOB_RHOBA       ------------------------------------------------EEMSI-------
BIOB_THEEB       ------------------------------------------------GRAIAP------
BIOB_SALRD       ------------------------------------------------DGPERQTPATAD
BIOB_STRAW       SHEGGGACGSAPAPRT-----------------------DEARTDLVAVRRRGAGTDLAP
BIOB_STRCO       SHAGGGVCAPAPAATTPR-------------------PAEEPRTDLVAVRRRGAGTDLAP
BIOB_STRGG       SHGGGAGCGPCGGHGEREPVAVADSAAGESVPGARTETSGAARTDLVAVRRRGAGTDLAP
BIOB2_FRACC      ------------------------------------------GLERVALRQRGAGTDLPP
BIOB_NOCSJ       ---------------------------------------------DPAIRRRGAGTDVPA
BIOB_SACEN       ---------------------------------------------DPAIRQRGAGTDVVP
BIOB_KOCRD       PARTRSAAASSAPTGAGMSPALAALLGSDDGPEQDEDDTRVRVELSPTVRRRGAGTSVAP
BIOB_RENSM       --------------------------------------------VEPVLRKRGAGTELQP
BIOB_CUTAK       -------------------------------------------VNAVPIRHRGIGTEVPA
BIOB_ACAM1       -----------------------------------SLTGDLSATSQFQLDDNPNILNPQT
BIOB_MAGMM       -----------------------------------EE-----------------------
BIOB_LEPBA       -----------------------------------GIPEGWEDYDSKFLYDEKNFPELYK
BIOB_LEPBP       -----------------------------------GIPEGWEDYDSKFLYDEKNFPELYK
BIOB_LEPBJ       -----------------------------------GGILP-EESGTEMLYSEKNFPELYK
BIOB_LEPBL       -----------------------------------GGILP-EESGTEMLYSEKNFPELYK
BIOB_LEPIC       -----------------------------------GEILP-ENFGTESFYSEKNFPELYK
BIOB_LEPIN       -----------------------------------GEILP-ENFGTESFYSEKNFPELYK
BIOB_THET2       ------------------------------------------------------------
BIOB_THET8       ------------------------------------------------------------
BIOB_STRA1       ------------------------------------------------------------
BIOB_STRA5       ------------------------------------------------------------
BIOB_STRA3       ------------------------------------------------------------
BIOB_CORGL       ------------------------------------------------------------
BIOB_CORGB       ------------------------------------------------------------
BIOB_COREF       ------------------------------------------------------------
BIOB1_CORDI      ------------------------------------------------------------
BIOB_CORU7       ------------------------------------------------------------
BIOB_CORJK       ------------------------------------------------------------
BIOB_MYCBO       ------------------------------------------------------------
BIOB_MYCTU       ------------------------------------------------------------
BIOB_MYCTA       ------------------------------------------------------------
BIOB_MYCTF       ------------------------------------------------------------
BIOB_MYCBP       ------------------------------------------------------------
BIOB_MYCMM       ------------------------------------------------------------
BIOB_MYCUA       ------------------------------------------------------------
BIOB_MYCA1       ------------------------------------------------------------
BIOB_MYCPA       ------------------------------------------------------------
BIOB_MYCLE       ------------------------------------------------------------
BIOB_MYCLB       ------------------------------------------------------------
BIOB_MYCGI       ------------------------------------------------------------
BIOB_MYCVP       ------------------------------------------------------------
BIOB_MYCSJ       ------------------------------------------------------------
BIOB_MYCSK       ------------------------------------------------------------
BIOB_MYCSS       ------------------------------------------------------------
BIOB_MYCS2       ------------------------------------------------------------
BIOB_MYCA9       ------------------------------------------------------------
BIOB_NOCFA       ------------------------------------------------------------
BIOB_RHOJR       ------------------------------------------------------------
BIOB_FRAAA       ------------------------------------------------------------
BIOB1_FRACC      ------------------------------------------------------------
BIOB_FRASN       ------------------------------------------------------------
BIOB_SALAI       ------------------------------------------------------------
BIOB_SALTO       ------------------------------------------------------------
BIOB_PSECP       ------------------------------------------------------------
BIOB_ARTS2       ------------------------------------------------------------
BIOB_PAEAT       ------------------------------------------------------------
BIOB_ACIC1       ------------------------------------------------------------
BIOB_CENSY       ------------------------------------------------------------
BIOB_NITMS       ------------------------------------------------------------
BIOB_HELPY       ------------------------------------------------------------
BIOB_HELPH       ------------------------------------------------------------
BIOB_HELPS       ------------------------------------------------------------
BIOB_HELPG       ------------------------------------------------------------
BIOB_HELPJ       ------------------------------------------------------------
BIOB_HELP2       ------------------------------------------------------------
BIOB_HELAH       ------------------------------------------------------------
BIOB_HELHP       ------------------------------------------------------------
BIOB_WOLSU       ------------------------------------------------------------
BIOB_ARCB4       ------------------------------------------------------------
BIOB_NITSB       ------------------------------------------------------------
BIOB_NAUPA       ------------------------------------------------------------
BIOB_CAMC1       ------------------------------------------------------------
BIOB_CAMC5       ------------------------------------------------------------
BIOB_CAMFF       ------------------------------------------------------------
BIOB_CAMJ8       ------------------------------------------------------------
BIOB_CAMJJ       ------------------------------------------------------------
BIOB_CAMJE       ------------------------------------------------------------
BIOB_CAMJR       ------------------------------------------------------------
BIOB_CAMJD       ------------------------------------------------------------
BIOB_CAMLR       ------------------------------------------------------------
BIOB_SULDN       ------------------------------------------------------------
BIOB_SULNB       ------------------------------------------------------------
BIOB_METM6       ------------------------------------------------------------
BIOB_METMP       ------------------------------------------------------------
BIOB_METM5       ------------------------------------------------------------
BIOB_METM7       ------------------------------------------------------------
BIOB_METVS       ------------------------------------------------------------
BIOB_META3       ------------------------------------------------------------
BIOB_METJA       ------------------------------------------------------------
BIOB_CALBD       ------------------------------------------------------------
BIOB_CALS8       ------------------------------------------------------------
BIOB_AQUAE       ------------------------------------------------------------
BIOB_HYDS0       ------------------------------------------------------------
BIOB_PERMH       ------------------------------------------------------------
BIOB_SULSY       ------------------------------------------------------------
BIOB_UNCTG       ------------------------------------------------------------
BIOB_THENN       ------------------------------------------------------------
BIOB_THEP1       ------------------------------------------------------------
BIOB_THEYD       ------------------------------------------------------------
BIOB_DESDA       ------------------------------------------------------------
BIOB_ALKMQ       ------------------------------------------------------------
BIOB_CLOB8       ------------------------------------------------------------
BIOB_CLOB1       ------------------------------------------------------------
BIOB_CLOBH       ------------------------------------------------------------
BIOB_CLOBK       ------------------------------------------------------------
BIOB_CLOBL       ------------------------------------------------------------
BIOB_CLOBM       ------------------------------------------------------------
BIOB_CLOBA       ------------------------------------------------------------
BIOB_CLOBB       ------------------------------------------------------------
BIOB_BRAHW       ------------------------------------------------------------
BIOB_AKKM8       ------------------------------------------------------------
BIOB2_CORDI      ------------------------------------------------------------
BIOB_CAMHC       ------------------------------------------------------------
BIOB_FUSNN       ------------------------------------------------------------
BIOB_CLOD6       ------------------------------------------------------------
BIOB_HUNT2       ------------------------------------------------------------
BIOB_CLOK1       ------------------------------------------------------------
BIOB_CLOTE       ------------------------------------------------------------
BIOB_CLONN       ------------------------------------------------------------
BIOB_CLOP1       ------------------------------------------------------------
BIOB_CLOPE       ------------------------------------------------------------
BIOB_PORG3       ------------------------------------------------------------
BIOB_PORGI       ------------------------------------------------------------
BIOB_PARD8       ------------------------------------------------------------
BIOB_CROS5       ------------------------------------------------------------
BIOB_RIPO1       ------------------------------------------------------------
BIOB_GLOC7       ------------------------------------------------------------
BIOB_MICAN       ------------------------------------------------------------
BIOB_TRIEI       ------------------------------------------------------------
BIOB_SYNY3       ------------------------------------------------------------
BIOB_CYAP4       ------------------------------------------------------------
BIOB_SYNP2       ------------------------------------------------------------
BIOB_CARHZ       ------------------------------------------------------------
BIOB_CLOAB       ------------------------------------------------------------
BIOB_DESAP       ------------------------------------------------------------
BIOB_PELTS       ------------------------------------------------------------
BIOB_HELMI       ------------------------------------------------------------
BIOB_DESPS       ------------------------------------------------------------
BIOB_DESRM       ------------------------------------------------------------
BIOB_ANAD2       ------------------------------------------------------------
BIOB_ANASK       ------------------------------------------------------------
BIOB_ANADE       ------------------------------------------------------------
BIOB_ANADF       ------------------------------------------------------------
BIOB_DESVH       ------------------------------------------------------------
BIOB_DESVV       ------------------------------------------------------------
BIOB_DESVM       ------------------------------------------------------------
BIOB_DESAG       ------------------------------------------------------------
BIOB_GEOMG       ------------------------------------------------------------
BIOB_GEOSL       ------------------------------------------------------------
BIOB_GEODF       ------------------------------------------------------------
BIOB_GEOUR       ------------------------------------------------------------
BIOB_GEOBB       ------------------------------------------------------------
BIOB_PELPD       ------------------------------------------------------------
BIOB_GEOLS       ------------------------------------------------------------
BIOB_PELCD       ------------------------------------------------------------
BIOB_SYNAS       ------------------------------------------------------------
BIOB_DESAL       ------------------------------------------------------------
BIOB_DESOH       ------------------------------------------------------------
BIOB_SYNFM       ------------------------------------------------------------
BIOB_CHLCH       ------------------------------------------------------------
BIOB_PELPB       ------------------------------------------------------------
BIOB_CHLP8       ------------------------------------------------------------
BIOB_CHLTE       ------------------------------------------------------------
BIOB_CHLL2       ------------------------------------------------------------
BIOB_PELLD       ------------------------------------------------------------
BIOB_CHLPM       ------------------------------------------------------------
BIOB_CHLPD       ------------------------------------------------------------
BIOB_CHLPB       ------------------------------------------------------------
BIOB_PROA2       ------------------------------------------------------------
BIOB_NATPD       ------------------------------------------------------------
                                                                             

BIOB_FRAT1       ----------------------
BIOB_FRATT       ----------------------
BIOB_FRATN       ----------------------
BIOB_FRATW       ----------------------
BIOB_FRATM       ----------------------
BIOB_FRATF       ----------------------
BIOB_FRATH       ----------------------
BIOB_FRATO       ----------------------
BIOB_FRAP2       ----------------------
BIOB_COXB1       ----------------------
BIOB_COXB2       ----------------------
BIOB_COXBN       ----------------------
BIOB_COXBR       ----------------------
BIOB_COXBU       ----------------------
BIOB_LAWIP       ----------------------
BIOB_RICFE       ----------------------
BIOB_NEOSM       ----------------------
BIOB_ANAMF       ----------------------
BIOB_ANAMM       ----------------------
BIOB_ANAPZ       ----------------------
BIOB_EHRCJ       ----------------------
BIOB_EHRCR       ----------------------
BIOB_EHRRG       ----------------------
BIOB_EHRRW       ----------------------
BIOB_AGRRK       ----------------------
BIOB_AGRVS       ----------------------
BIOB_RUEPO       ----------------------
BIOB_BEII9       ----------------------
BIOB_METSB       ----------------------
BIOB_ZYMMO       ----------------------
BIOB_METC4       ----------------------
BIOB_METEP       ----------------------
BIOB_METPB       ----------------------
BIOB_METRJ       ----------------------
BIOB_METNO       ----------------------
BIOB_METS4       ----------------------
BIOB_PROM2       ----------------------
BIOB_PROM9       ----------------------
BIOB_PROMS       ----------------------
BIOB_PROM0       ----------------------
BIOB_PROM5       ----------------------
BIOB_PROMP       ----------------------
BIOB_PROM1       ----------------------
BIOB_PROMT       ----------------------
BIOB_PROM4       ----------------------
BIOB_PROMA       ----------------------
BIOB_PROM3       ----------------------
BIOB_PROMM       ----------------------
BIOB_SYNPW       ----------------------
BIOB_SYNS3       ----------------------
BIOB_SYNPX       ----------------------
BIOB_SYNSC       ----------------------
BIOB_SYNS9       ----------------------
BIOB_SYNR3       ----------------------
BIOB_SYNE7       ----------------------
BIOB_SYNP6       ----------------------
BIOB_SORC5       ----------------------
BIOB_MYXXD       ----------------------
BIOB_GLOVI       ----------------------
BIOB_SYNJA       ----------------------
BIOB_NOSS1       ----------------------
BIOB_TRIV2       ----------------------
BIOB_NOSP7       ----------------------
BIOB_CHLAB       ----------------------
BIOB_CHLFF       ----------------------
BIOB_CHLPN       ----------------------
BIOB_FLAJ1       ----------------------
BIOB_FLAPJ       ----------------------
BIOB_GRAFK       ----------------------
BIOB_CYTH3       ----------------------
BIOB_HYDCU       ----------------------
BIOB_BRUA1       ----------------------
BIOB_BRUA2       ----------------------
BIOB_BRUAB       ----------------------
BIOB_BRUC2       ----------------------
BIOB_BRUMB       ----------------------
BIOB_BRUME       ----------------------
BIOB_BRUSI       ----------------------
BIOB_BRUSU       ----------------------
BIOB_BRUO2       ----------------------
BIOB_OCHA4       ----------------------
BIOB_AGRFC       ----------------------
BIOB2_PARDP      ----------------------
BIOB_LEGPA       ----------------------
BIOB_LEGPH       ----------------------
BIOB_LEGPL       ----------------------
BIOB_LEGPC       ----------------------
BIOB_RUTMC       ----------------------
BIOB_VESOH       ----------------------
BIOB_HAEI8       ----------------------
BIOB_HAEIE       ----------------------
BIOB_HAEIN       ----------------------
BIOB_HAEIG       ----------------------
BIOB_HAES1       ----------------------
BIOB_HISS2       ----------------------
BIOB_PASMU       ----------------------
BIOB_ACTSZ       ----------------------
BIOB_MANSM       ----------------------
BIOB_ACTP7       ----------------------
BIOB_ACTPJ       ----------------------
BIOB_ACTP2       ----------------------
BIOB_HAEDU       ----------------------
BIOB_HAEPS       ----------------------
BIOB_NEIG1       ----------------------
BIOB_NEIG2       ----------------------
BIOB_NEIM0       ----------------------
BIOB_NEIMF       ----------------------
BIOB_NEIMA       ----------------------
BIOB_NEIMB       ----------------------
BIOB_CHRVO       ----------------------
BIOB_METSK       ----------------------
BIOB_METFK       ----------------------
BIOB_THIDA       ----------------------
BIOB_NITEC       ----------------------
BIOB_NITEU       ----------------------
BIOB_NITMU       ----------------------
BIOB_ACISJ       ----------------------
BIOB_ACIET       ----------------------
BIOB_DELAS       ----------------------
BIOB_ACIAC       ----------------------
BIOB_METPP       ----------------------
BIOB1_POLSJ      ----------------------
BIOB_HERAR       ----------------------
BIOB_JANMA       ----------------------
BIOB_RHOFT       ----------------------
BIOB_POLAQ       ----------------------
BIOB_BORBR       ----------------------
BIOB_BORPA       ----------------------
BIOB_BORPE       ----------------------
BIOB_BORPD       ----------------------
BIOB_BORA1       ----------------------
BIOB_BURCM       ----------------------
BIOB_BURL3       ----------------------
BIOB_BURA4       ----------------------
BIOB_BURVG       ----------------------
BIOB_BURM1       ----------------------
BIOB_BURCA       ----------------------
BIOB_BURCC       ----------------------
BIOB_BURCH       ----------------------
BIOB_BURCJ       ----------------------
BIOB_BURM7       ----------------------
BIOB_BURM9       ----------------------
BIOB_BURP6       ----------------------
BIOB_BURMA       ----------------------
BIOB_BURMS       ----------------------
BIOB_BURP0       ----------------------
BIOB_BURPS       ----------------------
BIOB_BURP1       ----------------------
BIOB_BURTA       ----------------------
BIOB_PARPJ       ----------------------
BIOB_PARXL       ----------------------
BIOB_PARP8       ----------------------
BIOB_CUPTR       ----------------------
BIOB_CUPNH       ----------------------
BIOB_CUPPJ       ----------------------
BIOB_CUPMC       ----------------------
BIOB_POLNA       ----------------------
BIOB2_POLSJ      ----------------------
BIOB_LEPCP       ----------------------
BIOB_RALPJ       ----------------------
BIOB_RALSO       ----------------------
BIOB_AZOSB       ----------------------
BIOB_AROAE       ----------------------
BIOB_DECAR       ----------------------
BIOB_GLUDA       ----------------------
BIOB_GLUOX       ----------------------
BIOB_GRABC       ----------------------
BIOB_ACICJ       ----------------------
BIOB_STRM5       ----------------------
BIOB_STRMK       ----------------------
BIOB_XANAC       ----------------------
BIOB_XANC5       ----------------------
BIOB_XANOM       ----------------------
BIOB_XANOP       ----------------------
BIOB_XANOR       ----------------------
BIOB_XANC8       ----------------------
BIOB_XANCB       ----------------------
BIOB_XANCP       ----------------------
BIOB_XYLF2       ----------------------
BIOB_XYLFT       ----------------------
BIOB_XYLFM       ----------------------
BIOB_XYLFA       ----------------------
BIOB_AZOC5       ----------------------
BIOB_XANP2       ----------------------
BIOB_RHOS1       ----------------------
BIOB_RHOS4       ----------------------
BIOB_RHOSK       ----------------------
BIOB1_PARDP      ----------------------
BIOB_BRASB       ----------------------
BIOB_BRASO       ----------------------
BIOB_NITHX       ----------------------
BIOB_NITWN       ----------------------
BIOB_OLICO       ----------------------
BIOB_BRADU       ----------------------
BIOB_RHOPA       ----------------------
BIOB_RHOPT       ----------------------
BIOB_RHOPS       ----------------------
BIOB_RHOP2       ----------------------
BIOB_RHOP5       ----------------------
BIOB_RHOPB       ----------------------
BIOB_CAUVN       ----------------------
BIOB_CAUVC       ----------------------
BIOB_CAUSK       ----------------------
BIOB_PHEZH       ----------------------
BIOB_HYPNA       ----------------------
BIOB_MARMM       ----------------------
BIOB_ERYLH       ----------------------
BIOB_NOVAD       ----------------------
BIOB_SPHAL       ----------------------
BIOB_SPHWW       ----------------------
BIOB_PARL1       ----------------------
BIOB_ACIF2       ----------------------
BIOB_ACIF5       ----------------------
BIOB_NITOC       ----------------------
BIOB_THISH       ----------------------
BIOB_ALKEH       ----------------------
BIOB_HALHL       ----------------------
BIOB_ALCBS       ----------------------
BIOB_METCA       ----------------------
BIOB_MAGSA       ----------------------
BIOB_ACIB3       ----------------------
BIOB_ACIB5       ----------------------
BIOB_ACIBY       ----------------------
BIOB_ACIBC       ----------------------
BIOB_ACIBT       ----------------------
BIOB_ACIBS       ----------------------
BIOB_ACICA       ----------------------
BIOB_ACIAD       ----------------------
BIOB_PSYA2       ----------------------
BIOB_PSYCK       ----------------------
BIOB_PSYWF       ----------------------
BIOB_CELJU       ----------------------
BIOB_SACD2       ----------------------
BIOB_HAHCH       ----------------------
BIOB_MARHV       ----------------------
BIOB_CHRSD       ----------------------
BIOB_PSE14       ----------------------
BIOB_PSEU2       ----------------------
BIOB_PSESM       ----------------------
BIOB_PSEF5       ----------------------
BIOB_PSEPF       ----------------------
BIOB_PSEP1       ----------------------
BIOB_PSEPK       ----------------------
BIOB_PSEPG       ----------------------
BIOB_PSEPW       ----------------------
BIOB_PSEE4       ----------------------
BIOB_PSEA8       ----------------------
BIOB_PSEAE       ----------------------
BIOB_PSEAB       ----------------------
BIOB_PSEA7       ----------------------
BIOB_PSEMY       ----------------------
BIOB_PSEU5       ----------------------
BIOB_IDILO       ----------------------
BIOB_COLP3       ----------------------
BIOB_PSYIN       ----------------------
BIOB_MARMS       ----------------------
BIOB_PSEHT       ----------------------
BIOB_SHEB2       ----------------------
BIOB_SHEB5       ----------------------
BIOB_SHEB8       ----------------------
BIOB_SHEB9       ----------------------
BIOB_SHESA       ----------------------
BIOB_SHESM       ----------------------
BIOB_SHESR       ----------------------
BIOB_SHEON       ----------------------
BIOB_SHEPC       ----------------------
BIOB_SHESW       ----------------------
BIOB_SHEHH       ----------------------
BIOB_SHEPA       ----------------------
BIOB_SHEPW       ----------------------
BIOB_SHEDO       ----------------------
BIOB_SHEFN       ----------------------
BIOB_SHESH       ----------------------
BIOB_SHEWM       ----------------------
BIOB_SHELP       ----------------------
BIOB_SHEAM       ----------------------
BIOB_AERHH       ----------------------
BIOB_AERS4       ----------------------
BIOB_ALTMD       ----------------------
BIOB_PSEA6       ----------------------
BIOB_ALIF1       ----------------------
BIOB_ALIFM       ----------------------
BIOB_ALISL       ----------------------
BIOB_VIBC3       ----------------------
BIOB_VIBCH       ----------------------
BIOB_VIBTL       ----------------------
BIOB_VIBCB       ----------------------
BIOB_VIBPA       ----------------------
BIOB_VIBVU       ----------------------
BIOB_VIBVY       ----------------------
BIOB_PHOPR       ----------------------
BIOB_BUCA5       ----------------------
BIOB_BUCAT       ----------------------
BIOB_BUCAI       ----------------------
BIOB_BUCAP       ----------------------
BIOB_BUCBP       ----------------------
BIOB_WIGBR       ----------------------
BIOB_BAUCH       ----------------------
BIOB_PECAS       ----------------------
BIOB_ERWT9       ----------------------
BIOB_SERMA       ----------------------
BIOB_SERP5       ----------------------
BIOB_YERPA       ----------------------
BIOB_YERPB       ----------------------
BIOB_YERPE       ----------------------
BIOB_YERPG       ----------------------
BIOB_YERPN       ----------------------
BIOB_YERPP       ----------------------
BIOB_YERPS       ----------------------
BIOB_YERPY       ----------------------
BIOB_YERP3       ----------------------
BIOB_YERE8       ----------------------
BIOB_PSEVU       ----------------------
BIOB_ENT38       ----------------------
BIOB_KLEP3       ----------------------
BIOB_KLEP7       ----------------------
BIOB_SALPB       ----------------------
BIOB_SALPC       ----------------------
BIOB_SALNS       ----------------------
BIOB_SALTY       ----------------------
BIOB_SALCH       ----------------------
BIOB_SALA4       ----------------------
BIOB_SALTI       ----------------------
BIOB_SALHS       ----------------------
BIOB_SALPA       ----------------------
BIOB_SALDC       ----------------------
BIOB_SALEP       ----------------------
BIOB_SALSV       ----------------------
BIOB_SALPK       ----------------------
BIOB_SALG2       ----------------------
BIOB_SALAR       ----------------------
BIOB_CITK8       ----------------------
BIOB_SHIB3       ----------------------
BIOB_SHIBS       ----------------------
BIOB_ECO81       ----------------------
BIOB_ECOL6       ----------------------
BIOB_ECOK1       ----------------------
BIOB_ECOUT       ----------------------
BIOB_ECO45       ----------------------
BIOB_ECOL5       ----------------------
BIOB_SHIF8       ----------------------
BIOB_SHIFL       ----------------------
BIOB_ECO57       ----------------------
BIOB_ECO5E       ----------------------
BIOB_SHISS       ----------------------
BIOB_ECOLI       ----------------------
BIOB_ECOSM       ----------------------
BIOB_ECOLU       ----------------------
BIOB_ECOLC       ----------------------
BIOB_ECOHS       ----------------------
BIOB_ECODH       ----------------------
BIOB_ECO8A       ----------------------
BIOB_ECO7I       ----------------------
BIOB_ECO55       ----------------------
BIOB_ECO27       ----------------------
BIOB_ECO24       ----------------------
BIOB_SHIDS       ----------------------
BIOB_ECOSE       ----------------------
BIOB_ESCF3       ----------------------
BIOB_CROS8       ----------------------
BIOB_PHOLL       ----------------------
BIOB_PROMH       ----------------------
BIOB_SODGM       ----------------------
BIOB_METI4       ----------------------
BIOB_BACSU       ----------------------
BIOB_BACNA       ----------------------
BIOB_BACVZ       EV--------------------
BIOB_BACAM       EV--------------------
BIOB_BACLD       ----------------------
BIOB_BACHD       ----------------------
BIOB_GEOKA       ----------------------
BIOB_GEOTN       ----------------------
BIOB_ANOFW       ----------------------
BIOB_LYSSH       ----------------------
BIOB_LYSSC       ----------------------
BIOB_BACAN       ----------------------
BIOB_BACC0       ----------------------
BIOB_BACCZ       ----------------------
BIOB_BACHK       ----------------------
BIOB_BACAH       ----------------------
BIOB_BACC7       ----------------------
BIOB_BACCQ       ----------------------
BIOB_BACC1       ----------------------
BIOB_BACC2       ----------------------
BIOB_BACC4       ----------------------
BIOB_BACCR       ----------------------
BIOB_BACMK       ----------------------
BIOB_BACCN       ----------------------
BIOB_BACP2       ----------------------
BIOB_STAAM       AN--------------------
BIOB_STAAN       AN--------------------
BIOB_STAAS       AN--------------------
BIOB_STAA9       AN--------------------
BIOB_STAAB       AN--------------------
BIOB_STAAW       AN--------------------
BIOB_STAA1       AN--------------------
BIOB_STAA2       AN--------------------
BIOB_STAAR       AN--------------------
BIOB_STAAC       AN--------------------
BIOB_STAAT       AN--------------------
BIOB_STAA8       AN--------------------
BIOB_STAAE       AN--------------------
BIOB_STAA3       AN--------------------
BIOB_STAEQ       ----------------------
BIOB_STAES       ----------------------
BIOB_STAHJ       ----------------------
BIOB_STACT       LEA-------------------
BIOB_MACCJ       ----------------------
BIOB_RHOBA       ----------------------
BIOB_THEEB       ----------------------
BIOB_SALRD       DTPSGDPEAADRRRQPSAGPAG
BIOB_STRAW       NA--------------------
BIOB_STRCO       NA--------------------
BIOB_STRGG       NA--------------------
BIOB2_FRACC      NA--------------------
BIOB_NOCSJ       NA--------------------
BIOB_SACEN       NA--------------------
BIOB_KOCRD       NA--------------------
BIOB_RENSM       NA--------------------
BIOB_CUTAK       NA--------------------
BIOB_ACAM1       TISFSNS---------------
BIOB_MAGMM       ----------------------
BIOB_LEPBA       HKK-------------------
BIOB_LEPBP       HKK-------------------
BIOB_LEPBJ       FKKS------------------
BIOB_LEPBL       FKKS------------------
BIOB_LEPIC       FKKF------------------
BIOB_LEPIN       FKKF------------------
BIOB_THET2       ----------------------
BIOB_THET8       ----------------------
BIOB_STRA1       ----------------------
BIOB_STRA5       ----------------------
BIOB_STRA3       ----------------------
BIOB_CORGL       ----------------------
BIOB_CORGB       ----------------------
BIOB_COREF       ----------------------
BIOB1_CORDI      ----------------------
BIOB_CORU7       ----------------------
BIOB_CORJK       ----------------------
BIOB_MYCBO       ----------------------
BIOB_MYCTU       ----------------------
BIOB_MYCTA       ----------------------
BIOB_MYCTF       ----------------------
BIOB_MYCBP       ----------------------
BIOB_MYCMM       ----------------------
BIOB_MYCUA       ----------------------
BIOB_MYCA1       ----------------------
BIOB_MYCPA       ----------------------
BIOB_MYCLE       ----------------------
BIOB_MYCLB       ----------------------
BIOB_MYCGI       ----------------------
BIOB_MYCVP       ----------------------
BIOB_MYCSJ       ----------------------
BIOB_MYCSK       ----------------------
BIOB_MYCSS       ----------------------
BIOB_MYCS2       ----------------------
BIOB_MYCA9       ----------------------
BIOB_NOCFA       ----------------------
BIOB_RHOJR       ----------------------
BIOB_FRAAA       ----------------------
BIOB1_FRACC      ----------------------
BIOB_FRASN       ----------------------
BIOB_SALAI       ----------------------
BIOB_SALTO       ----------------------
BIOB_PSECP       ----------------------
BIOB_ARTS2       ----------------------
BIOB_PAEAT       ----------------------
BIOB_ACIC1       ----------------------
BIOB_CENSY       ----------------------
BIOB_NITMS       ----------------------
BIOB_HELPY       ----------------------
BIOB_HELPH       ----------------------
BIOB_HELPS       ----------------------
BIOB_HELPG       ----------------------
BIOB_HELPJ       ----------------------
BIOB_HELP2       ----------------------
BIOB_HELAH       ----------------------
BIOB_HELHP       ----------------------
BIOB_WOLSU       ----------------------
BIOB_ARCB4       ----------------------
BIOB_NITSB       ----------------------
BIOB_NAUPA       ----------------------
BIOB_CAMC1       ----------------------
BIOB_CAMC5       ----------------------
BIOB_CAMFF       ----------------------
BIOB_CAMJ8       ----------------------
BIOB_CAMJJ       ----------------------
BIOB_CAMJE       ----------------------
BIOB_CAMJR       ----------------------
BIOB_CAMJD       ----------------------
BIOB_CAMLR       ----------------------
BIOB_SULDN       ----------------------
BIOB_SULNB       ----------------------
BIOB_METM6       ----------------------
BIOB_METMP       ----------------------
BIOB_METM5       ----------------------
BIOB_METM7       ----------------------
BIOB_METVS       ----------------------
BIOB_META3       ----------------------
BIOB_METJA       ----------------------
BIOB_CALBD       ----------------------
BIOB_CALS8       ----------------------
BIOB_AQUAE       ----------------------
BIOB_HYDS0       ----------------------
BIOB_PERMH       ----------------------
BIOB_SULSY       ----------------------
BIOB_UNCTG       ----------------------
BIOB_THENN       ----------------------
BIOB_THEP1       ----------------------
BIOB_THEYD       ----------------------
BIOB_DESDA       ----------------------
BIOB_ALKMQ       ----------------------
BIOB_CLOB8       ----------------------
BIOB_CLOB1       ----------------------
BIOB_CLOBH       ----------------------
BIOB_CLOBK       ----------------------
BIOB_CLOBL       ----------------------
BIOB_CLOBM       ----------------------
BIOB_CLOBA       ----------------------
BIOB_CLOBB       ----------------------
BIOB_BRAHW       ----------------------
BIOB_AKKM8       ----------------------
BIOB2_CORDI      ----------------------
BIOB_CAMHC       ----------------------
BIOB_FUSNN       ----------------------
BIOB_CLOD6       ----------------------
BIOB_HUNT2       ----------------------
BIOB_CLOK1       ----------------------
BIOB_CLOTE       ----------------------
BIOB_CLONN       ----------------------
BIOB_CLOP1       ----------------------
BIOB_CLOPE       ----------------------
BIOB_PORG3       ----------------------
BIOB_PORGI       ----------------------
BIOB_PARD8       ----------------------
BIOB_CROS5       ----------------------
BIOB_RIPO1       ----------------------
BIOB_GLOC7       ----------------------
BIOB_MICAN       ----------------------
BIOB_TRIEI       ----------------------
BIOB_SYNY3       ----------------------
BIOB_CYAP4       ----------------------
BIOB_SYNP2       ----------------------
BIOB_CARHZ       ----------------------
BIOB_CLOAB       ----------------------
BIOB_DESAP       ----------------------
BIOB_PELTS       ----------------------
BIOB_HELMI       ----------------------
BIOB_DESPS       ----------------------
BIOB_DESRM       ----------------------
BIOB_ANAD2       ----------------------
BIOB_ANASK       ----------------------
BIOB_ANADE       ----------------------
BIOB_ANADF       ----------------------
BIOB_DESVH       ----------------------
BIOB_DESVV       ----------------------
BIOB_DESVM       ----------------------
BIOB_DESAG       ----------------------
BIOB_GEOMG       ----------------------
BIOB_GEOSL       ----------------------
BIOB_GEODF       ----------------------
BIOB_GEOUR       ----------------------
BIOB_GEOBB       ----------------------
BIOB_PELPD       ----------------------
BIOB_GEOLS       ----------------------
BIOB_PELCD       ----------------------
BIOB_SYNAS       ----------------------
BIOB_DESAL       ----------------------
BIOB_DESOH       ----------------------
BIOB_SYNFM       ----------------------
BIOB_CHLCH       ----------------------
BIOB_PELPB       ----------------------
BIOB_CHLP8       ----------------------
BIOB_CHLTE       ----------------------
BIOB_CHLL2       ----------------------
BIOB_PELLD       ----------------------
BIOB_CHLPM       ----------------------
BIOB_CHLPD       ----------------------
BIOB_CHLPB       ----------------------
BIOB_PROA2       ----------------------
BIOB_NATPD       ----------------------