CLUSTAL format seed alignment for MF_01698

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

MSHD_ACIFD      -----------------------MHALTTVENPSARLLPGVLALIRDVEAADGHEVLEAH
MSHD_NAKMY      -------------------MTLEPAGEPAAWHAAPDEAAALAALIDAAAAADGVAPISGH
MSHD_MYCTU      -----------------------MTALDWRSALTADEQRSVRALVTATTAVDGVAPVGEQ
MSHD_MYCTA      -----------------------MTALDWRSALTADEQRSVRALVTATTAVDGVAPVGEQ
MSHD_MYCTF      -----------------------MTALDWRSALTADEQRSVRALVTATTAVDGVAPVGEQ
MSHD_MYCTK      -----------------------MTALDWRSALTADEQRSVRALVTATTAVDGVAPVGEQ
MSHD_MYCBO      -----------------------MTALDWRSALTADEQRSVRALVTATTAVDGVAPVGEQ
MSHD_MYCBP      -----------------------MTALDWRSALTADEQRSVRALVTATTAVDGVAPVGEQ
MSHD_MYCBT      -----------------------MTALDWRSALTADEQRSVRALVTATTAVDGVAPVGEQ
MSHD_MYCLB      ------------------------MVLNWRFALSADEQRLVREIISAATEFDEVSPVGEQ
MSHD_MYCLE      ------------------------MVLNWRFALSADEQRLVREIISAATEFDEVSPVGEQ
MSHD_MYCMM      -----------------------MTAVQWRSHLTDDQQRQVRDLVTAATQVDGVAPVGEQ
MSHD_MYCUA      -----------------------MTAGQWRSHLTDDQQRQVRDLVTVATQVDGVAPVGEQ
MSHD_MYCA1      -----------------------MTAADWRRTLNPQEQREVRELVGAATEFDAVAPVGEQ
MSHD_MYCPA      -----------------------MTAADWRRTLNPQEQREVRELVGAATEFDAVAPVGEQ
MSHD_MYCSK      -----------------------MTSIDWRSALTDDEQGSIRDIVAAATRHDGVAPVGDQ
MSHD_MYCSS      -----------------------MTSIDWRSALTDDEQGSIRDIVAAATRHDGVAPVGDQ
MSHD_MYCSJ      -----------------------MTSIDWRSALTDDEQGSIRDIVAAATRHDGVAPVGDQ
MSHD_MYCS2      -----------------------MTSTEWRTGLTGAQQAEIRALIDAATTHDGVAPVGDQ
MSHD_MYCGI      --------------------------MSWQQSLTDDRARQIRELVSAASAADGVAPVGDQ
MSHD_MYCVP      --------------------MTSQDSVDWQDVLPVDERQRIRDLISDATSADGVAPVGDQ
MSHD_MYCA9      -------------------------MTEWVPLLDNRRQLQIRELIVEATRADGIAPVGEQ
MSHD_RHOOB      ---------------------MSASVQSWTDRLDGAQAADVSALLGRATAADGTAPVSEQ
MSHD_RHOJR      ---------------------MSASVQSWTDRLDGKQAADVSALLERATAADGTAPVSEQ
MSHD_RHOE4      --------------------------MGWTDSLPAGSAEQVSALLDRATEFDGKAPVSEQ
MSHD_NOCFA      ---------------------MGDITVRWTQRLDGETADAVRELLAAASAADGVAPVSEQ
MSHD_GORB4      ---------------MPAPTGTDHPDITVTDSLGEHDVARARLMVDGAAAADGISPLSEQ
MSHD_TSUPD      --------------------------MAEVVHGPVADPGAVLALVAEAQAADGIGPLSEQ
MSHD_SEGRD      ----------------------------------------------MDDLVREELPNGTR
MSHD_PSECP      ------MTPAHPEK---------WPVHVVQGGVDRQLLKDCRDLLAAAEESDGNPSISEQ
MSHD_ARTS2      ------MSPAHPEN---------WPVLVVKGGVDDELLRDFTALAAAAEESDGNPPLSEQ
MSHD_PAEAT      ------MSHAHPEN---------WPVLIIAGALDTELLRDVKTLAAAAGESDGNPPFSEQ
MSHD_RENSM      ----MTTGPATPPQTNHAEDRTEWPIQVLRAAPETYLLQEILKLAEVAIDTDGHPPFSDQ
MSHD_KOCRD      ------------------------MSVTVTPYDSIPFPDELVALAERSRAADGEPPFSDQ
MSHD_ROTMD      ----MMVDNQTPDSS---TLSTASTPVYAEPQLTEELLERFDSFAQKVARHDGVSAFSEQ
MSHD_NOCDD      -----------------------MDTPLVTDDLDRTLAEQVLTLAEAARAADGVAPLSEH
MSHD_THEFY      -----------------------MSHILTTDTLSPEQVAAVLALAEAVRDADGVAALSEQ
MSHD_CELFN      ---------------MSSDIEAPTSLTSMRGALPPAVADDVRALHLTTVRHDGVPPLSEQ
MSHD_SANKS      --------------MDHSEIDVETS------PLTAADAQAVHRLARAAEHVDQVAPLSEQ
MSHD_KRIFD      ---------------MTLEAVPSP--------LPPATAVAVTELARLAAQSDGVNPLSEQ
MSHD_XYLCX      ---------------MPVPLQIGP--------LGPSDVEGVRGLARAAETADGVAPLSEQ
MSHD_KYTSD      ---------------MSPDLTHRSP-----EELTPEDSQAIGDLARRAARADGVDPLNEE
MSHD_CLAM3      --------MSAFPPPPIPAPDASRVAR---VEPTPDVVRGILELGDRARADDGVAPFNEQ
MSHD_CLAMS      --------MSAFPPP--PEPDAPRVAH---VEPAPDAVRGILALADRARADDGVAPFNEQ
MSHD_MICLC      --------MAEHPTPTTSDADETTRV----VTPRPEEASAVLDLADRAGAADGHPPLSDQ
MSHD_KINRD      ---------------MSPAPAGATALP---GPLPGDVHDAVLALAAAASRADGATSLSED
MSHD_STRRD      ----------------------MNARVEHRGRLDEREVAAVLTVVEAATEADGVRPLNEH
MSHD_THEBD      ----------------------MTVRVEIRETPGDQE--AVLALAEAAAEADGVRPLNEQ
MSHD_ACIC1      -----------------MTVLPASIRIEPHGRLAPALLPRVFALVDDATDTDGVQPLSEH
MSHD_THECD      ---------------------MDERALVFSDGLTDPQISQVLALAEAATRHDGVAPLSEQ
MSHD_SALAI      ----------------MNSTEPDSARVTRTDRLDPPEIADVLTLARAAGDADGADPFDEH
MSHD_SALTO      ----------------MNSTEPDSDRVTRTDRLNAPEIADVQALARAAGDADGADPFDEH
MSHD_STANL      -----------------------MIRVEIYERLEAAAVAEVLELVEAGARADGLSALNEQ
MSHD_STRAW      ------------MTSDDTVWPGAGRSIETLAALSPGQAEAVLALLDEAARVDGQPAVSEQ
MSHD_STRCO      ------------MTSDDTVRPGRPRSIETLAELTPEQTDAVLALLTEAARTDGQHAVSEQ
MSHD_STRSW      ------------MTSDDTAQPSGARRIETRPDLTAAQKDAVLALLDEAAQVDGQQAVSEQ
MSHD_STRGG      ------------MTTDAPL-PAPGREVHTLDALDSAQAESVLALLSEAARSDGRQAVSEQ
MSHD_STRBB      ----------------MLNEAAGARRIDVLDEVTPTMAEDVLRLVAEAARTDGQQAVSEQ
MSHD_ACTMD      ---------------------MADLTWHDALDPEQ--AEEITRLLAEAEEVDGVAPVGEA
MSHD_SACEN      ------------------MALLRETERADGVAPVG--EHVILRLKAHLDVVHQIEPVQAD
MSHD_AMYMD      --------------------MSGDGEWRQELDEQQ--LEDVRRLLLAVREADGRPEVEPA
MSHD_SACVD      ---------------------MRNFVWAEELDADR--IDDVRALLLAARETDGRPEVEPD
MSHD_CATAD      ---------------------MTGISIGVVRRPNEADVATIRSLAEAAERADGVAPLPEQ
MSHD_NOCSJ      ---------------------MDDHAADLL--------AAVAEVARAAEAADGAAPLDEA
MSHD_FRAAA      -----------MAEGPYGRPVTASLTWQPTLSAAD--VDDIVSLLATAERADGTGPVSED
MSHD_FRACC      ---------------------MTSLSWQQTLSAMD--VDDIVSLLAAAERADGTGPVSED
MSHD_FRASN      ---------------------MTSLSWLRALDVAD--IAAITDLLAAAERADGNGGVSED
MSHD_GEOOG      ------------------MSAAPLVRDVDRLDPAG--VAAVLALLRAATAADGVRPLSEE
MSHD_CORGB      -------------------MNTSDRIKSTQIALDRDLREQALLLLKEVRAVDGVDAFSEQ
MSHD_CORGL      -------------------MNTSDRIKSTQIALDRDLREQALLLLKEVRAVDGVDALSEQ
MSHD_COREF      ---------------MATLGPMNTKVTTTHLYNHRDLREQAMIMLKEVRAIDGVEALSEQ
MSHD_CORDI      ----------------------MKMIETSLASASAALRDRVDEILAAATREDGCAPLSES
MSHD_CORA7      -----------------------MNIETNTVPQNLDLAQRVEELAAAAETHDGVAPLSEQ
MSHD_CORK4      MADAPTFNAQPCDIITQLVLGPVSPRVRNARQASADRWMEIETILHESTRHDGVAPFSEQ
MSHD_CORJK      --------------------MAITYDTYEDLWEHSEVLEGVHEVLSEVAEVDGVPAISEA
MSHD_CORU7      --------------------MTCTFHAYEQLHAQPEVVAAVHTLLREVEQADGVAALGEA
MSHD_PROFC      ---------------------MNPVVTGPIIRLSADDRDHIADLVRACTEHDGVSPLNES
MSHD_BRAFD      --------------------------MITTTALVPARRSAVRTLLATVTEHDGVSPLDEA
MSHD_JONDD      --------------------MTTVLLTSTSGPLSDDAARSVRELVALETERLGVPPLSEQ
MSHD_BEUC1      ------------------------MQAYDDEIVGTALASNVLALADRVRTADGVEALSEQ
                                                                            

MSHD_ACIFD      RWIDLANADAE-------SLHGIAVTLDDD----------------------------TV
MSHD_NAKMY      VRDAVRSGAAQ-------VLIDPGASPDDP----------------------------AG
MSHD_MYCTU      VLRELGQQRT---------EHLLVAGSRPGGP---------------------------I
MSHD_MYCTA      VLRELGQQRT---------EHLLVAGSRPGGP---------------------------I
MSHD_MYCTF      VLRELGQQRT---------EHLLVAGSRPGGP---------------------------I
MSHD_MYCTK      VLRELGQQRT---------EHLLVAGSRPGGP---------------------------I
MSHD_MYCBO      VLRELGQQRT---------EHLLVAGSRPGGP---------------------------I
MSHD_MYCBP      VLRELGQQRT---------EHLLVAGSRPGGP---------------------------I
MSHD_MYCBT      VLRELGQQRT---------EHLLVAGSRPGGP---------------------------I
MSHD_MYCLB      VLRELGYDRT---------EHLLVTDSRPYAP---------------------------I
MSHD_MYCLE      VLRELGYDRT---------EHLLVTDSRPYAP---------------------------I
MSHD_MYCMM      VLRELAQQRT---------EHLLVEDQSPGKS---------------------------A
MSHD_MYCUA      VLRELAQQRT---------EHLLVEDQSPGKS---------------------------A
MSHD_MYCA1      VLRELGHDRT---------EHLLIRGSVSGGAAD------------------------AV
MSHD_MYCPA      VLRELGHDRT---------EHLLIRGSVSGGAAD------------------------AV
MSHD_MYCSK      VLRELPADRT---------RHLVAVDPDA--G--------------------------AV
MSHD_MYCSS      VLRELPADRT---------RHLVAVDPDA--G--------------------------AV
MSHD_MYCSJ      VLRELPADRT---------RHLVAVDPDA--G--------------------------AV
MSHD_MYCS2      VLRELGRDRT---------RHLLTTDDD------------------------------RV
MSHD_MYCGI      VLRALAHDRT---------RHLVAVEDDGAGS--------------------------RV
MSHD_MYCVP      VLRELGQQRT---------RHLVALQD----G--------------------------AL
MSHD_MYCA9      VLRELRGTGA---------KHLVAEDGDD------------------------------V
MSHD_RHOOB      GVHAVSGAGGDG------VRHLVETDADR------------------------------I
MSHD_RHOJR      GVHAVSGAGSDG------VRHLVETDADR------------------------------I
MSHD_RHOE4      GRHAVAGRGA--------ARHFVELDGDT------------------------------V
MSHD_NOCFA      AVLSLGEPGA--------ARHLLAEHDGE------------------------------L
MSHD_GORB4      AVAAIDAAAGSG------VRHVISA-----------------------------------
MSHD_TSUPD      FRLGVAGPGP----------HVVAE-----------------------------------
MSHD_SEGRD      RLFARDAQGG-------------------------------------------------E
MSHD_PSECP      TLVTMRAGDSA-------DHSLLTLALYAPDED------------------SDPATGQDL
MSHD_ARTS2      TFVTLRAGESG-------THSLLSLALYAPDEE------------------SDPATAQDL
MSHD_PAEAT      TLVTLRGADAG-------DHSVLSFVLYAPDED------------------SDPATAEDL
MSHD_RENSM      TLIQLRSANA----------PLLILLSYVP---------------------AAPEVPAAL
MSHD_KOCRD      TLVDIRSGRAG-------ATCVAATD------------------------------GDEL
MSHD_ROTMD      TRIELSKALRE-------STLTPPRFFVAED-------------------------NGTL
MSHD_NOCDD      TLLRVRHGAPS-------GSSRFHLALEDGR----------------------------A
MSHD_THEFY      TLLRVRHGAR--------GRGRFHLAYVDAEQ------------------------GRVL
MSHD_CELFN      PLLWLSDQEAP-------VVHVLAWHAVTG-------------------------GAQEL
MSHD_SANKS      PLLRLLDAEAP-------TTHLMVR------------------------------AADDL
MSHD_KRIFD      TLLHVDSEHHG-------DLHVLAYDGEPGTLDV-----------------SGLQTAENL
MSHD_XYLCX      PLLRLSSDEGW-------LTHVVARS-----------------------------KAGQV
MSHD_KYTSD      SLLALRHRTPG-------RVHVLAHD------------------------------QDRL
MSHD_CLAM3      TRLLLGTEDGP-------ALLVVQGT------------------------------DGRP
MSHD_CLAMS      TRLTLGADGGP-------TLLLAHGT------------------------------DDDP
MSHD_MICLC      TRVLLARGGQL-------WWGATQGS------------------------------DGAI
MSHD_KINRD      AVLRLRAGDGA-------VQHLVRHE------------------------------DGVL
MSHD_STRRD      VMLHLRYGGDE------RAGAVLLYV--GDD----------------------------L
MSHD_THEBD      TLLALRYGGPS------GARFLLLYD--GDE----------------------------L
MSHD_ACIC1      VVLHLRYGGDE------RGCNLLLWV--DDDEPR-------------------------L
MSHD_THECD      ALLTLRAG---------RSRSLLSLE--DGV----------------------------I
MSHD_SALAI      TLLRLRDPHAP------AHHLTVRAA--DGI----------------------------L
MSHD_SALTO      TLLRLRDPHAP------THHLTARTA--NGT----------------------------L
MSHD_STANL      TILNLRHGGAE------AEPGAHLMI--RDAEGT-------------------------L
MSHD_STRAW      GRLQLRGGERE------GVRHLLLSA--GDT----------------------------L
MSHD_STRCO      GRLQLRGPARE------GVVHLLLTLD-GGE----------------------------L
MSHD_STRSW      GRLQLRGGPRE------GVRHLLLSV--GED----------------------------L
MSHD_STRGG      GRLRIRGGHRD------GVRHFLLTV--DGA----------------------------L
MSHD_STRBB      GRLQLRG-RRE------GVRHLLLTEEPSGK----------------------------L
MSHD_ACTMD      VHLRLRPGAS-------GSAHLLAR------------------------------ADGVL
MSHD_SACEN      VP---------------GSEHFVVRD-----------------------------SGGEL
MSHD_AMYMD      GA--LPGEFD-------GGEHLVAC------------------------------VEGEV
MSHD_SACVD      GP--LPGEFS-------GPRHLLCFSGEG--------------------------AAAEL
MSHD_CATAD      VLLHLKRSGDADADADTDAWHFVARRLSP--------------------------QGSEL
MSHD_NOCSJ      TWLALR--------------HHPERVRS----------------------------WVRA
MSHD_FRAAA      VRLTLRPDQRVG-----AARHLLAVSATGVEASG--PRRP-------------------I
MSHD_FRACC      VRLALRPGLRIG-----AGRHLLAVSAAADTSGPNVPDTPGDQNAADTSTMPGRVPAGRI
MSHD_FRASN      VRLTLRPGPVGG-----GVEHLVARAGSA------------------------------V
MSHD_GEOOG      AELRLQHGGPAG-----GRDVLATAADGA------------------------------L
MSHD_CORGB      FVRGLAEPGLGHS-------HLIV-TLNDK-----------------------------L
MSHD_CORGL      FVRGLAEPGLGHS-------HLIV-TLNDK-----------------------------L
MSHD_COREF      FVRGLAEPGLGHT-------HYTV-SVDGR-----------------------------I
MSHD_CORDI      FLNGLRRADDGHV-------HSCVMDSHDQ-----------------------------V
MSHD_CORA7      FLIGLRDDRLGHR-------HLLA-IEGDE-----------------------------V
MSHD_CORK4      FLRGMEEPDLNHW-------HALV-RVDGH-----------------------------V
MSHD_CORJK      FLRGIDE-DRGHK-------HVVA-MNGDR-----------------------------V
MSHD_CORU7      FLKGIDG-DHGHQ-------HIVA-MTDER-----------------------------V
MSHD_PROFC      GWFGLQGLTASHT-------HWIA-RDGKQ-----------------------------V
MSHD_BRAFD      ALLALDGEDARHLLLTADGAATDTHAAEATAG--------------------------SA
MSHD_JONDD      PLLNLR-----------DPRARVVHIMDTQGG--------------------------DV
MSHD_BEUC1      HRLALE--------------HPGLRAHHLVVT--------------------------DP
                                                                            

MSHD_ACIFD      VGYVHLRRH-----HRHGIELELLVAPDHRDEAASIVGALVEAASASLETL---------
MSHD_NAKMY      VAVALAQD-----------PAEVTVAPDRRRQGRG--RSLVRAAVE--------------
MSHD_MYCTU      IGYLNLS----PPRGAGGAMAELVVHPQSRRRGIG--TAMARAALAKT------------
MSHD_MYCTA      IGYLNLS----PPRGAGGAMAELVVHPQSRRRGIG--TAMARAALAKT------------
MSHD_MYCTF      IGYLNLS----PPRGAGGAMAELVVHPQSRRRGIG--TAMARAALAKT------------
MSHD_MYCTK      IGYLNLS----PPRGAGGAMAELVVHPQSRRRGIG--TAMARAALAKT------------
MSHD_MYCBO      IGYLNLS----PPRGAGGAMAELVVHPQSRRRGIG--TAMARAALAKT------------
MSHD_MYCBP      IGYLNLS----PPRGAGGAMAELVVHPQSRRRGIG--TAMARAALAKT------------
MSHD_MYCBT      IGYLNLS----PPRGAGGAMAELVVHPQSRRRGIG--TAMARAALAKT------------
MSHD_MYCLB      IGYLNLS----SPRDAGVAMAELVVHPRERRRGVG--AAMVRAALAKT------------
MSHD_MYCLE      IGYLNLS----SPRDAGVAMAELVVHPRERRRGVG--AAMVRAALAKT------------
MSHD_MYCMM      IGYLNLS----PAHGADAAMAELVVHPQARRRGIA--TAMVRAALAKT------------
MSHD_MYCUA      IGYLNLS----PAHGADAAMAELVVHPQARRRGIA--TAMVRAALAKT------------
MSHD_MYCA1      VGYLNLT----PPRDAQPQMAELVVHPRARRRGIG--SALARAALAKT------------
MSHD_MYCPA      VGYLNLT----PPRDAQPQMAELVVHPRARRRGIG--SALARAALAKT------------
MSHD_MYCSK      VGYLNLA----PASDTAPPMAELVVHPDFRRRGTG--AAMARAGLAEG------------
MSHD_MYCSS      VGYLNLA----PASDTAPPMAELVVHPDFRRRGTG--AAMARAGLAEG------------
MSHD_MYCSJ      VGYLNLA----PASDTAPPMAELVVHPDFRRRGTG--AAMARAGLAEG------------
MSHD_MYCS2      VGYLNLA----PAEGDDPAMAELVVHPQARRRGIG--AAMARTALAEG------------
MSHD_MYCGI      RGYLNLA----PADDDAPPMAEVVVHPDARRRGTG--SAMIRAALAEG------------
MSHD_MYCVP      RGYLNLA----PAGDGAPPMAELVVHPDARRRGIG--SAMIRTALSVG------------
MSHD_MYCA9      AAFLNLVVPDEAASENATAMAELVVAPAARRRGIG--SAMVREALAEG------------
MSHD_RHOOB      VGYAQLQ----PGHGEHPAMAELAVDPEARGRGIG--GRLVAEVLSAG------------
MSHD_RHOJR      VGYAQLQ----PGRGDHPAMAELAVDPAARGRGIG--GRLVAEVLSEG------------
MSHD_RHOE4      VGYAQLQ----AGSDEHPDMAELVVDPQARRRGIG--TRLAAAVFDEG------------
MSHD_NOCFA      AGYANLV----PAHGDHPAMAEAAVAPARRGRGIG--TALVREALAAG------------
MSHD_GORB4      AGYANIS----PGRGDEPAMIEAVVDPQLRRRGHG--RALLTTAFGEAER----------
MSHD_TSUPD      GGYAGIV----IPPAGGPGAVEAVVAPSHRGRGLG--RELVATALDVA------------
MSHD_SEGRD      AGFAVIE----PGRPGQPAMVEVQVRPEHRSCGLG--GRLVRAALDEA------------
MSHD_PSECP      AGFAVVVEE---PDR--SGVLEIAVHPSYRNQGVA--DRLVRALQ---------------
MSHD_ARTS2      AGFAVVVEE---ADG--TGVLELAVHPSYRNQGVA--DRLVATLK---------------
MSHD_PAEAT      AGVAVVVEN---GDE--SGVLELAVHPSYRNQGVA--GRLLDALQ---------------
MSHD_RENSM      AGVAVVLEH---DGQPASGTLELVVHPTYRNQGVG--QVLLKSLQ---------------
MSHD_KOCRD      VGAAVVVPQ---QDAASTFTVELTVAPGHRDQGVA--TAIAGQLR---------------
MSHD_ROTMD      AAVFVALTP---ANDEDTGVIEAAVAPEYRGQGVG--SAFFDHAV---------------
MSHD_NOCDD      VGFAFVERV---AGE--PDSGEVVVHPDHRGRGHG--TALLHSVD---------------
MSHD_THEFY      AGCAFAEVS---PGE--PDSAEVAVAPQWRRHGLG--RRLLDELW---------------
MSHD_CELFN      VGYAQVDVG--S---STTARAELVVAPGHRRRGTG--RSLLAHAA---------------
MSHD_SANKS      AGYAQVDRG--A---PGTASAELVVHPFARHHGVG--TALLEHA----------------
MSHD_KRIFD      IGYAAL---------GPDGSAELVVTPAARRQGTG--TALLRML----------------
MSHD_XYLCX      IGYAQVDRG------GEDASAELVVHPEHRRAGVG--GLLLRTAERDATLPQF-------
MSHD_KYTSD      VGYGTL----------AHGSAEVVTDPDARKAGLG--GRLLDAL----------------
MSHD_CLAM3      IGAAVAAR------GDGGIEAEIVVDPARRRRGVG--RALLDA-----------------
MSHD_CLAMS      LGAAVVAH------GDAGIEAELVVDPAHRRRGVG--RALLDA-----------------
MSHD_MICLC      DGAAVLVP------EGAAAVLELVVDPAARRIGRG--TALADAAAD--------------
MSHD_KINRD      AGYAQLVPS--GDGEGDGFEGELLVHPGHRRRGHG--GALLAA-----------------
MSHD_STRRD      AGYAHVD----PTDPVEGPSGELVIHPAFRGQGHG--RHLLEAVLDRTGGR---------
MSHD_THEBD      AGFAYLE----PSDP---PSGELVVHPGFRGRGLG--GRLLAAVLDTGGKG---------
MSHD_ACIC1      AGYAHLD----ATDPVEAPSAELVIAPDFRGRGLG--TMLVEAILARTGGR---------
MSHD_THECD      AGYAHLD----PAPDGAGASGEVVVHPGRRRRGHG--RALLRALRERARGP---------
MSHD_SALAI      AGYAHLD----STDPAAGTGVELAVHPTYRRQGIG--RALARAVRATVTGP---------
MSHD_SALTO      TGYAHLD----ITNPTSGTGVELAVHPAYRRRGTG--RALARSVRAAVTGP---------
MSHD_STANL      VGYANLE----LDND-GVAAVEMLVHPTHRHNGHG--EALLAALIKRATAAKC-------
MSHD_STRAW      VGYAQLE----DTDPVEAPAAELVVHPAHRGRGHG--RALGTALLAATGKR---------
MSHD_STRCO      VGYAQLE----GTDPVEPPAAELVVHPSHRGQGHG--RALGSALLAASGKR---------
MSHD_STRSW      VGYAQLE----DNDPVEAPAAELVVHPSHRGHGHG--RALGSALLAESGKR---------
MSHD_STRGG      AGYAQLE----DTDPVEAPAAELVVHPDRRGHGHG--RALGAALLAATGKR---------
MSHD_STRBB      VGYAQLE----DTDPVEAPAAELVVHPAHRGQGHG--RALGVTLLRESGKR---------
MSHD_ACTMD      AGYAHLDLL--GD-SDGNLVAELAVRPGSRRAGVG--SELAGALLGAAADRGK-------
MSHD_SACEN      AGYAHVDTA--EEKTAGQLVAELAVHPRHRRRGAG--ARLVEALLDRADLPVE-------
MSHD_AMYMD      VGYAHLNTT--GN-SFGHQVAELFVHPAHRNRGYG--AKLLQALDERAAV----------
MSHD_SACVD      VGYAHLDVR--GD-AFGRQVAELIVHPAHRRRGHG--TALLEEV-LRHAD----------
MSHD_CATAD      TGYAFLDKS--NA--EEGPTAEVVVLPDARRQGVG--GALLDALRMKVRRGD--------
MSHD_NOCSJ      GGFALV----------IGADLSLVVHPQARGRGLG--AGLLSSALAGLSAG---------
MSHD_FRAAA      VGYAHLG----GALDS--RQAEIVVDPGHRGLGIG--RALATALTEALGDP---------
MSHD_FRACC      IGYAHLG----GVDQA--RQAEVVVHPDHRGRGVG--TALVGGLTEALAAP---------
MSHD_FRASN      VGYAALG----GTATE--RQAELVVHPDHRRRGVG--TALVHALFATTS-----------
MSHD_GEOOG      TGYARFE----GGEGTGDAEAELVVAPGSRRRGVG--RALLTRLEELAG-----------
MSHD_CORGB      VGLAATD----------EETTELAVHPAHRRQGIG--KALIDAAPTSSI-----------
MSHD_CORGL      VGLAATD----------EETTELAVHPAHRRQGIG--KALIDATPTSSI-----------
MSHD_COREF      IGLGATD----------GETSELAVHPAHRRQGIG--RELIDALPTDGV-----------
MSHD_CORDI      VGVAARD----------GDSAEVVVDPAFRRQGYG--SFLIRHVVSQGVK----------
MSHD_CORA7      LGVAALD----------GQTVELFVGVDNRGRGIG--KALVDALPASPQ-----------
MSHD_CORK4      RGIAAVDP--------SGPAVELAVHPSYRRGGLA--TALQRAVRAHASSLGLGD-----
MSHD_CORJK      AGVLAID---------PDRVIELAVAPEVRHSRVG--IALFEALRDQLGVSG--------
MSHD_CORU7      VGVLALDGAVTASVSGENPTAELAVAPDVRRQGVA--RGMLAAAREDLGLTG--------
MSHD_PROFC      VGYAQADA--------REHTVQLMVAPPARRQGIA--TTLAKAAWQLHPAMW--------
MSHD_BRAFD      ASADPADPA------DPAAPADPADPADETLLGYVSVLGDGTVQGMVDPAHRRRGHGSAL
MSHD_JONDD      TGYAQLDVS------REGGSLELTARCADRTQCVGALLNEAELIAQDHDVVVRP------
MSHD_BEUC1      AGAVVGYAS------VLGSSVEMLVDAAHRGEGVGHRLAEAALAVEPTLAF---------
                 .                   .                                      

MSHD_ACIFD      ------GPHEIFAWVPRH------SRQVIDALEGLGFRADRAVRQLRRPLPLESDH----
MSHD_NAKMY      --------RQGAVWAYGD------LPAAQALASALNLRPTRVLLQMRRPLPIEPLG----
MSHD_MYCTU      -------AGRNQFWAHGT------LDPARATASALGLVGVRELIQMRRPLR---------
MSHD_MYCTA      -------AGRNQFWAHGT------LDPARATASALGLVGVRELIQMRRPLR---------
MSHD_MYCTF      -------AGRNQFWAHGT------LDPARATASALGLVGVRELIQMRRPLR---------
MSHD_MYCTK      -------AGRNQFWAHGT------LDPARATASALGLVGVRELIQMRRPLR---------
MSHD_MYCBO      -------AGRNQFWAHGT------LDPARATASALGLVGVRELIQMRRPLR---------
MSHD_MYCBP      -------AGRNQFWAHGT------LDPARATASALGLVGVRELIQMRRPLR---------
MSHD_MYCBT      -------AGRNQFWAHGT------LDPARATASALGLVGVRELIQMRRPLR---------
MSHD_MYCLB      -------GGRNRFWAHGT------LASARATASVLGLVPVRELVQMQRSLR---------
MSHD_MYCLE      -------GGRNRFWAHGT------LASARATASVLGLVPVRELVQMQRSLR---------
MSHD_MYCMM      -------GGRNQFWAHGT------LAPAQATASALGLTPVRELVQMRRSLR---------
MSHD_MYCUA      -------GGRNQFWAHGT------LAPARATASALGLTPVRELVQMRRSLR---------
MSHD_MYCA1      -------GAANRFWAHGT------LEPARATAAALGLSPVRELMQMRRSLR---------
MSHD_MYCPA      -------GAANRFWAHGT------LEPARATAAALGLSPVRELMQMRRSLR---------
MSHD_MYCSK      -------GTHARIWAHGN------LEAARATARTLGLQVVRELLQMRRPLT---------
MSHD_MYCSS      -------GTHARIWAHGN------LEAARATARTLGLQVVRELLQMRRPLT---------
MSHD_MYCSJ      -------GTHARIWAHGN------LEAARATARTLGLQVVRELLQMRRPLT---------
MSHD_MYCS2      -------GPGARIWAHGN------IAAAQAMASSLRLVVVRELLQMRRPLT---------
MSHD_MYCGI      -------GPQTRVWAHGN------LVAARATAEALGLTAVRELLQMQRPLA---------
MSHD_MYCVP      -------GPDTRIWAHGD------LEPARATAAALGLSAVRELLQMRRSLA---------
MSHD_MYCA9      -------GAGTRVWAHGD------LPAAQSLATKLGLVALRRLHQMRRALA---------
MSHD_RHOOB      -------GPDTRVWAHGN------LPAAQAVAQRLGLTGARELLQLRRPLA--GA-----
MSHD_RHOJR      -------GPDARVWAHGN------LPAAQAVAQRLGLIGARELLQLRRPLA--DA-----
MSHD_RHOE4      -------RPGTRVWAHGN------VDAAVEFAKSLDLVSVRELLQLRRPLD--AP-----
MSHD_NOCFA      -------GADARVWAHGD------RPAAKAVAARLGLRTARELWQMRRSLA--TP-----
MSHD_GORB4      -------AGDARVWAHGD------LPGAQALAASMGLVRRRELLQLRRGLGTGAP-----
MSHD_TSUPD      -------GAGATVWAHGD------LTPARAVAARLGLTPVRTLLNLRRPLA---D-----
MSHD_SEGRD      -------GPGAYLWDHEN------SPASQAIVRRNGLVPVRTLCQMRRWLA--YP-----
MSHD_PSECP      -DRRGFDGLKA--WSHGN------HEAAADLAARYGYAPVRELWKMRMT-TAEADLP---
MSHD_ARTS2      -ASRGFDGLKA--WSHGN------HEAAADLAAKYGYAPIRELWKMRLT-ASDAELP---
MSHD_PAEAT      -GKRGLGGLSA--WSHGN------HEAAAELATRFGYGPVRELWKMRLM-SSTSALP---
MSHD_RENSM      -SARGFESLNA--WSHGS------HAAAQQLADQFGFEAVRALRRLRLALDAGHQLP---
MSHD_KOCRD      -AMVD-GTVEA--WAHGD------QPASRRLAELYGLTAVRDLLQLKRTVSGAQDIPL--
MSHD_ROTMD      -RQLGDDATRYRLWVHGSATDTGIESPAHAFATLHGFEPVRVLYKMVLPLDAQTREELV-
MSHD_NOCDD      -RDAGPDGVRV--WAHGR------TPQAVSVAREDGWTAVRELHKMRMPLRDIAGDEPG-
MSHD_THEFY      -AHADARGLRV--WAHGD------LAPARALAASAGLQRMRALWKMRLPLRGTDSAP---
MSHD_CELFN      QEAASIPGRRLHVWAHGD------LPAARATAAATGLVVVRELWRMAVDV----------
MSHD_SANKS      LELMDAEGRVLSVWAHGD------LPAARSLAARTGLVVVRELWKMHLPLD---GSTS--
MSHD_KRIFD      ---LDHGKDRLRLWAHGR------LPGADELAAHFDLTVARELYFLRRP-----------
MSHD_XYLCX      GGTAGHHGKRLRVWAHGN------LEPARAFAAAAGYVVVRELLFLTKPFPPVVAPVE--
MSHD_KYTSD      ----LEHDPELLLWAHGD------MDGGRRLAASRGMVPRRPLWRMERPV------AG--
MSHD_CLAM3      -VLAEAAGSPVSVWAHGD------HPGARALAAATGLDRARELLQLRASVAE--------
MSHD_CLAMS      -VLAEAAGSPVSVWAHGD------HPAARALADATGLDRARELLQLRASVAE--------
MSHD_MICLC      AVRDLAREDTTSVWAHGM------LPGAVRLARRHGLEPVRELRRMRLSHA---------
MSHD_KINRD      -VEERAGARPVRLWSHGD------TPGASALAARAGWTRARELLRMERTSA---------
MSHD_STRRD      ----------LRLWAHGG------HPGAEALALSTGFTKIRSLWQMRRSLF---------
MSHD_THEBD      ----------VRLWAHGD------LPAAARLAAGFGMTRARALWRMRRPLT---------
MSHD_ACIC1      ----------LRLWAHGE------LPAAQAMARRLGFARRRVLLQMRRDLF---------
MSHD_THECD      ----------LRVWAHGD------LAPAAALAAAEGMARVRVLLQMRRPLQD--------
MSHD_SALAI      ----------LRAWAHGD------HPSAAALAVDLGYRRARVLWQLRRPLS---------
MSHD_SALTO      ----------LRAWAHGD------HPSAAALAVDLDYRRARVLWQLRRPLT---------
MSHD_STANL      R--------ALTIWAHGD------HPTALLLADRHDFTRDRVLWQMRRHLTD--------
MSHD_STRAW      ----------LRAWAHGG------HSAARHLAQVLGLTLFRELRQMRRPL---AG-----
MSHD_STRCO      ----------LRIWAHGG------HSAARHLAQVLGLSLFRELRQLRRPL---TG-----
MSHD_STRSW      ----------LRVWAHGG------HSAARHLAQVLGLTLFRELRQMRRSL---TD-----
MSHD_STRGG      ----------LRVWAHGG------SSAARHLAQVLGLSLFRELRQLRRSL---VP-----
MSHD_STRBB      ----------LRVWAHGG------HSSARHLAQVLGLTLFRELRQMRRPLGPPAT-----
MSHD_ACTMD      P---------VRFWAHGD------REGASGLAARLGARRVRELWVMRRELAGLPE-----
MSHD_SACEN      PSPDDTDTARLRIWSHGE------HPGALRLAERYGLVRARELWRMGRPLDTELA-----
MSHD_AMYMD      ---------GFRVWAHGD------HPAARKLALKTGLERKRELLILHVDVEGADWP----
MSHD_SACVD      ---------RLRIWSHGD------HPAAARLAERFGLSRARELLVMSASSAEQEWP----
MSHD_CATAD      --------KPIRVWSHGA------LPAAAALAAKRGLEPVRELWVMSRPLADVPP-----
MSHD_NOCSJ      --------MPLEAWSHGD------HPAAAALARSHGFERARELWVMRRQMASALP-----
MSHD_FRAAA      -------PARLDVWAHGD------LPPAAALAARLGFARTRVLFQLRRPLGAVAP-----
MSHD_FRACC      -------SSRLDIWAHGD------LPAAAALATRLTFTRTRVLLQLRRPLAAGTP-----
MSHD_FRASN      -------PVSLNIWAHGD------TPAAAALATRNGFDRERVLLQLRRPLASVRPGDP--
MSHD_GEOOG      -------DRPLRVWAHGD------LPGSAELAQRHGYERARVLLQMRRELAGVDP-----
MSHD_CORGB      -------------WAHGN------TAGAQALASTLRMKKTRELLVMEISDRALDG-----
MSHD_CORGL      -------------WAHGN------TAGAQALASTLRMKKTRELLVMEISDRALDD-----
MSHD_COREF      -------------WAHGD------LPPAQALASSLGLNKTRELLVMAVEGDALRE-----
MSHD_CORDI      -----------NVWAHGD------GAGAKAVAKALQLEQTRQLLVMAVEGDRLVE-----
MSHD_CORA7      ------------IWAHGN------LPAAQALAKRNEMDVVRRLLVMAIEGRDLRA-----
MSHD_CORK4      ERDIHTNGIGLTWWAHGD------LPPARAAAEHIGATADRELLVMELPGSVVKDESD--
MSHD_CORJK      ---------GIDVWAHGD------SAGAQRFVESLDARRTRELLKMSVDCPPATKAAKAM
MSHD_CORU7      ---------PLDTWAHGD------LAPARAMAEAANARRTRELHKMAVDASPGSDRGEQF
MSHD_PROFC      -------------WSFGD------CPGARELATQLGLREVRKLLKMSLPMPADQP-----
MSHD_BRAFD      LRAALALRPDAGVWVHGA------LEGSLAFLTDAGLTETRRLLTLRRDLGGAQP-----
MSHD_JONDD      -------------WVHGD------DPDVTRVLAQRGYVPARTLLVLSRDLSLADT-----
MSHD_BEUC1      -------------WAHGD------LPGAAQLAEAIGLRRVRELWHLGRDLAPAGAGGDE-
                             *                          * :  :              

MSHD_ACIFD      ----PARPIDCPP-----------------------------------------------
MSHD_NAKMY      ----YQPPAGVR------------------------------------------------
MSHD_MYCTU      ----DIPEPTIPD-----------------------------------------------
MSHD_MYCTA      ----DIPEPTIPD-----------------------------------------------
MSHD_MYCTF      ----DIPEPTIPD-----------------------------------------------
MSHD_MYCTK      ----DIPEPTIPD-----------------------------------------------
MSHD_MYCBO      ----DIPEPTIPD-----------------------------------------------
MSHD_MYCBP      ----DIPEPTIPD-----------------------------------------------
MSHD_MYCBT      ----DIPEPTIPD-----------------------------------------------
MSHD_MYCLB      ----TIPDPMVPDQL---------------------------------------------
MSHD_MYCLE      ----TIPDPMVPDQL---------------------------------------------
MSHD_MYCMM      ----QLPEPVIPN-----------------------------------------------
MSHD_MYCUA      ----QLPEPVIPN-----------------------------------------------
MSHD_MYCA1      ----DLPDS-VPAVP---------------------------------------------
MSHD_MYCPA      ----DLPDS-VPAVP---------------------------------------------
MSHD_MYCSK      ----DLPPVTVAD-----------------------------------------------
MSHD_MYCSS      ----DLPPVTVAD-----------------------------------------------
MSHD_MYCSJ      ----DLPPVTVAD-----------------------------------------------
MSHD_MYCS2      ----DLPPVPDTP-----------------------------------------------
MSHD_MYCGI      ----DLPPQTTAQ-----------------------------------------------
MSHD_MYCVP      ----DLPTAPPVD-----------------------------------------------
MSHD_MYCA9      ----DLPAIRVDA-----------------------------------------------
MSHD_RHOOB      ----ELPELVVLE-----------------------------------------------
MSHD_RHOJR      ----ELPELVVPE-----------------------------------------------
MSHD_RHOE4      ----QLPEIVVPE-----------------------------------------------
MSHD_NOCFA      ----QLPELVVPD-----------------------------------------------
MSHD_GORB4      ----ALPELIVDD-----------------------------------------------
MSHD_TSUPD      ----LDPAPSAPD-----------------------------------------------
MSHD_SEGRD      ----PLPEPVFPD-----------------------------------------------
MSHD_PSECP      -------EAALPE-----------------------------------------------
MSHD_ARTS2      -------DAALPD-----------------------------------------------
MSHD_PAEAT      -------DAGLPD-----------------------------------------------
MSHD_RENSM      -------AASLPT-----------------------------------------------
MSHD_KOCRD      -------EVSLPQ-----------------------------------------------
MSHD_ROTMD      ---ERSDARTLPE-----------------------------------------------
MSHD_NOCDD      ---GPWEAPELPEPELRPE-----------------------------------------
MSHD_THEFY      -------AATLPEPALRPE-----------------------------------------
MSHD_CELFN      ------TQHPPGAP----QLPP--------------------------------------
MSHD_SANKS      ------TPESAPAA----PLAP--------------------------------------
MSHD_KRIFD      -------SAPLPEP----GWPE--------------------------------------
MSHD_XYLCX      ------PTPPVTEP----VEPAPPVVEPVEPAPPVVEPVETTSASTSGVVSTGSTTGGGS
MSHD_KYTSD      ------EFSELPPV----ELPE--------------------------------------
MSHD_CLAM3      ------ARTGLGER----PMPA--------------------------------------
MSHD_CLAMS      ------ARTGLGER----QMPA--------------------------------------
MSHD_MICLC      ------ALAALPEV----RLAD--------------------------------------
MSHD_KINRD      ------GLSDLAVP----DLAA--------------------------------------
MSHD_STRRD      ---AAIPGFELPDG----------------------------------------------
MSHD_THEBD      ---TPLPAPELPEG----------------------------------------------
MSHD_ACIC1      ---APLPPVTLPDD----------------------------------------------
MSHD_THECD      ---SPLPEVTVPDG----------------------------------------------
MSHD_SALAI      ---APIPQPPLPEG----------------------------------------------
MSHD_SALTO      ---APIPEPPLPDG----------------------------------------------
MSHD_STANL      ---ADGDG-EPAAG----------------------------------------------
MSHD_STRAW      ---LDLAEPKLPDG----------------------------------------------
MSHD_STRCO      ---LDLPEPRLPEG----------------------------------------------
MSHD_STRSW      ---FDPAEPVLPEG----------------------------------------------
MSHD_STRGG      ---LDLAEPVLPEG----------------------------------------------
MSHD_STRBB      ---LDIPEPVLPEG----------------------------------------------
MSHD_ACTMD      -------VPPLPEG----------------------------------------------
MSHD_SACEN      -------EAELPPG----------------------------------------------
MSHD_AMYMD      -------EPILRDG----------------------------------------------
MSHD_SACVD      -------KPRLPEG----------------------------------------------
MSHD_CATAD      -------APTPPDG----------------------------------------------
MSHD_NOCSJ      -------QLRAPDG----------------------------------------------
MSHD_FRAAA      -----LPEPQLPAG----------------------------------------------
MSHD_FRACC      -----LPDPRLPAG----------------------------------------------
MSHD_FRASN      ---DDLPRPIIPAD----------------------------------------------
MSHD_GEOOG      -----EPRLRLPEG----------------------------------------------
MSHD_CORGB      -----SAAYKDP------------------------------------------------
MSHD_CORGL      -----SAAYKDP------------------------------------------------
MSHD_COREF      -----AAVYDNP------------------------------------------------
MSHD_CORDI      -----SAQLQVP------------------------------------------------
MSHD_CORA7      -----AEEAPTTV-----------------------------------------------
MSHD_CORK4      -NNPVAQAAATLP-----------------------------------------------
MSHD_CORJK      EAGGAEAEKRCAE-----------------------------------------------
MSHD_CORU7      RAGAEDAASKVES-----------------------------------------------
MSHD_PROFC      -------HDAHLP-----------------------------------------------
MSHD_BRAFD      ---LPSAPAPTLEG----------------------------------------------
MSHD_JONDD      ---QALATPVVPEG----------------------------------------------
MSHD_BEUC1      ---AALLATPLPGG----------------------------------------------
                                                                            

MSHD_ACIFD      -------FRTFRPGE-----DEDAWLEVNNRAFAWHPDQGDWDLETLLARERESWFDPAG
MSHD_NAKMY      -------IRTFQPGR-----DEDAFLRVNARAFASHPEQGRLDRSGLGEEMAQDWFDPNG
MSHD_MYCTU      ----GVVIRTYAGTS-----DDAELLRVNNAAFAGHPEQGGWTAVQLAERRGEAWFDPDG
MSHD_MYCTA      ----GVVIRTYAGTS-----DDAELLRVNNAAFAGHPEQGGWTAVQLAERRGEAWFDPDG
MSHD_MYCTF      ----GVVIRTYAGTS-----DDAELLRVNNAAFAGHPEQGGWTAVQLAERRGEAWFDPDG
MSHD_MYCTK      ----GVVIRTYAGTS-----DDAELLRVNNAAFAGHPEQGGWTAVQLAERRGEAWFDPDG
MSHD_MYCBO      ----GVVIRTYAGTS-----DDAELLRVNNAAFAGHPEQGGWTAVQLAERRGEAWFDPDG
MSHD_MYCBP      ----GVVIRTYAGTS-----DDAELLRVNNAAFAGHPEQGGWTAVQLAERRGEAWFDPDG
MSHD_MYCBT      ----GVVIRTYAGTS-----DDAELLRVNNAAFAGHPEQGGWTAVQLAERRGEAWFDPDG
MSHD_MYCLB      ----GVWVRTYVGTV-----DDAELLRVNNAAFAGHPEQGGWTATQLAERRSEPWFDPAG
MSHD_MYCLE      ----GVWVRTYVGTV-----DDAELLRVNNAAFAGHPEQGGWTATQLAERRSEPWFDPAG
MSHD_MYCMM      ----GLQIRTYAGTE-----DDAELLRVNNAAFAYHPEQGGWTEADLAERRGEPWFDPAG
MSHD_MYCUA      ----GLQIRTYAGTE-----DDAELLRVNNAAFAYHPEQGGWTEADLAERRGEPWFDPAG
MSHD_MYCA1      ----GVRIRTYAGLA-----DDAELLRVNNAAFAYHPEQGGWTDVELAERRAEPWFDPAG
MSHD_MYCPA      ----GVRIRTYAGPA-----DDAELLRVNNAAFAYHPEQGGWTDVELAERRAEPWFDPAG
MSHD_MYCSK      ----GVRLATYSGPG-----DDPELLRINNSAFAWHPEQGGWTDADIAERRAEAWFDPAG
MSHD_MYCSS      ----GVRLATYSGPG-----DDPELLRINNSAFAWHPEQGGWTDADIAERRAEAWFDPAG
MSHD_MYCSJ      ----GVRLATYSGPG-----DDPELLRVNNSAFAWHPEQGGWTDADIAERRAEAWFDPAG
MSHD_MYCS2      ----GVRIATYAGPG-----DDAEILRVNNAAFSWHPEQGGWTEHEIDERRNEGWFDPEG
MSHD_MYCGI      ----RVRFATYSGPH-----DDAEVLRVNNAAFSWHPEQGGWTDADIAERRGEPWFDPAG
MSHD_MYCVP      ----GVRFATYAGPQ-----DDAEVLRVNNAAFSWHPEQGGWTEADIAERRDEQWFDPDG
MSHD_MYCA9      ----SVTVRHYLGPQ-----DDSDLLRVNNAAFSWHPEQGGWTPGDLADRFAEPWFDPRG
MSHD_RHOOB      ----GISLRVYRGVE-----DDPEVLRVNAAAFAWHPEQGSWTEREMAERRAEAWFDPAG
MSHD_RHOJR      ----DISLRVYRGVE-----DDPEVLRVNAAAFAWHPEQGSWTERELAERRAEAWFDPSG
MSHD_RHOE4      ----GVTMRTYRGPE-----DDSEILRVNNAAFSWHPEQGGWTQAEIDERTAEGWFDPAG
MSHD_NOCFA      ----GIVLRTYAGPA-----DDAELLRVNNAAFDWHPEQGGWTQRDIAVRRAESWFDPAG
MSHD_GORB4      ----SVRLRTYAGSA-----DDAEILRVNNAAFDWHPEQGGWGAEQIAERVGAAWFDPEG
MSHD_TSUPD      ----GVTVRTYAGPA-----DDTALLAVNNAAFAWHPEQGGWGPEQIAERTGADWFDPAG
MSHD_SEGRD      ----GVSVRQYQGPQ-----DDEELLRVNNAAFDWHPEQGGWSIEKLRERLAQPWVDPAG
MSHD_PSECP      ----GVSLRPFVPGQ-----DEDAWLAVNSAAFAHHPEQGSLTRADLAARMEEDWFDPAG
MSHD_ARTS2      ----NVSLRAFIPGQ-----DEEAWLAANKAAFSHHPEQGNMTRQDLAARMAEDWFDPAG
MSHD_PAEAT      ----GVSLRAFVPGQ-----DEQAWLTANSAAFSHHPEQGSMTRADLEARKAEDWFDPEG
MSHD_RENSM      ----NISLRSFVPDQ-----DEAAWLAVNAAAFAHHPEQGETSLADLKSLMEEQWFDAAG
MSHD_KOCRD      ----GVRIRPFEVGR-----DEQAWLHVNSRAFAQHPEQGRITLGDLQEREGQSWFDPRG
MSHD_ROTMD      ----NLRMRTFT-GA-----DEFPWLRVNAAAFAHHPEQGKLTLADLRERTGSPWFRPEG
MSHD_NOCDD      -VAERVRLRPFVVGQ-----DEQAWLAANARAFADHPEQGQLTLDDLLQREVEDWFDPDG
MSHD_THEFY      -VAQQVEIRTFRVGV-----DEQEWLRTNARAFADHPEQGALTLEDLQQREQEPWFDPEG
MSHD_CELFN      ----GVAVRAFVPGQ-----DEDAWRRVNARAFAHHPEQGRMTSADLRARESEPWFDPAG
MSHD_SANKS      ----GVSLRAFRPGE-----DDAAWLAVNARAFASHPEQGRLTQTDLAARVAEPWFDAGS
MSHD_KRIFD      ----GIDVRAFVPGQ-----DDDAWLEVNARAFATHPEQGAWTTEDLGDRLHQPWFDPEG
MSHD_XYLCX      TTGGGYRVRAFVPGV-----DDDAWVALNARAFAAHPEQGRLTVADLHDRMAEPWFDPAG
MSHD_KYTSD      ----GISVRPFVAGQ-----DDEAWLRVNSRAFADHAEQGRMTAEDLTARTQEDWFDASG
MSHD_CLAM3      ----GLALSSFT-AD-----DADDWVALNARAFASHPEQGRMTRGDLDDRVAEPWFDPAL
MSHD_CLAMS      ----GVALSSFT-AD-----DADDWVALNARAFASHPEQGRMTRGDLDDRVAEAWFDPAS
MSHD_MICLC      ----GVTLRGFVPGQ-----DEQAWLDVNAAAFADHPEQGSLTRADLDDRMAEDWFDADG
MSHD_KINRD      ----GLAVRPFVPGA-----DDAAWVALNAAAFATHPEQGRWTLDDLRARLAEPWFDPAL
MSHD_STRRD      -----VRLRTFAPGSP----DEEAWVALNAKAFAHHPEQGSWTLEDLKRREQEPWFDPAG
MSHD_THEBD      -----VRLRTFEPGR-----DEEAWLALNARAFADHPEQGSWTLEDLKRRQQEPWFDPAG
MSHD_ACIC1      -----VQIRTFRPGA-----DDDAWIALNARAFADHPEQGSWTLEDLHRRMQESWFDPDG
MSHD_THECD      -----VTIRTFEPGR-----DETAWLRVNGRAFADHPEQGAWTLEDLRARQAEPWFDPAG
MSHD_SALAI      -----VTLRAFRPGT-----DDDAWLALNARAFADHPEQGRWTSADLRARRDEPWFDAAG
MSHD_SALTO      -----VTLRAYRPGA-----DDDAWLALNAKAFADHPEQGQWTAADLQARRDEPWFDAAG
MSHD_STANL      -----ITIRSFVPGR-----DETRLLEVNNAAFADHPDQGGWTVRDIAMREREDWFDPEG
MSHD_STRAW      -----VTVRAFVPGQ-----DDAAWLAVNAAAFAHHPEQGSLTQRDLDDRKAEPWFDPAG
MSHD_STRCO      -----VSVRTFVPGQ-----DDAAWLAVNAAAFAHHPEQGSLTQRDLDDRKAEPWFDPAG
MSHD_STRSW      -----VTVRAFVPGE-----DDAAWLAANAEAFAHHPEQGSLTQRDLDDRKGEPWFDPAG
MSHD_STRGG      -----VTVRTFEPGR-----DDAAWLAVNRAAFAHHPEQGSLTQQDLDDRKAEPWFDPKG
MSHD_STRBB      -----VTVRTFRPGE-----DEAAWLAANAAAFAHHPEQGSLTLRDLEDRMGEPWFDPEG
MSHD_ACTMD      -----VALRSFEPGR-----DEDAVVRVNARAFSWHPEQGAMTADDVRLKEAEDWFDADG
MSHD_SACEN      -----VTIRAFRTGV-----DEPAVVRVNHRAFSWHPEQGAMTEDDLRLKEREDWFDPAG
MSHD_AMYMD      -----VSLRTFVPGQ-----DEDAVVRVNARAFDWHPEQGALTVEDVRADERRAWFDEDG
MSHD_SACVD      -----VRLRTFVPGQ-----DEEAVIAVNARAFDWHPEQSQFDVKALREAQRESWFDADG
MSHD_CATAD      -----IRIATFRPGV-----DDEAWVEVNARAFAHHPEQGSMTVQDLRDRMAEPWFDPEG
MSHD_NOCSJ      -----VTVRAFRADSG----DAEEVLRVNAAAFAHHPEQGSMDATNLAERMAEPWFDPDG
MSHD_FRAAA      -----VTVRAFVPGR-----DDEAWLAVNAAAFADHPEQGRWTLDDLALRRAEPWFDPRG
MSHD_FRACC      -----VTVRTFVPDQ-----DDRAWLAVNAAAFADHPEQGRWTLDDLARRRAEPWFDPRG
MSHD_FRASN      -----VTIRAFEVGV-----DEEAWLAVNAEAFADHPEQGRWTLDDLRAREGEPWFDPAG
MSHD_GEOOG      -----VQVRTFRSGT-----DEQAWLRTNARAFASHPEQGSWTAEDLRLREAEPWFDPAG
MSHD_CORGB      -DGITHSSLANAPVE--KSVAEAKWLQSNNEAFDWHPEQGGWTTHRLAQAQKADWYKDSD
MSHD_CORGL      -DGITHSSLANAPVE--KSVAEAKWLQSNNEAFDWHPEQGGWTTHRLAQAQKADWYKDSD
MSHD_COREF      -AGITNSSLKTAPGT--RDEVEGKWLKANNEAFHWHPEQGGWDRNRLTRAQSATWFRETD
MSHD_CORDI      -SGFRVLALNEAYES--IPDIEQQWLRVNNEAFEWHPEQGGWDSARLAQARDTQWFRESD
MSHD_CORA7      -DGLEIQTYTESVERFGREHVEAEWVRTNNEAFSWHPEQGGWDLERLHRGMEAEWFDPAD
MSHD_CORK4      -DDVTVLSWTESARRWGKDAVDAAWLAVNNEAFDWHPEQGGWDQARLDQARRASWYDPDG
MSHD_CORJK      -QDFEVLSYTESVARFDADSVDAEWVRINNEAFAWHPEQGGWDVDYLRSARDTNWFDPDG
MSHD_CORU7      -QGLTVLTYPEAVERFGEELVDEEWVRVNNEAFAWHPEQGGWDIDQLRSARDTAWFDPNG
MSHD_PROFC      -EGLRLDHFRDDDLD--------QLVAVNHAAFVHHPEQGAMTAEDARNRMAQDWFDPAG
MSHD_BRAFD      -----LRLDTFEES-----RDAEAWVAVNVRAFADHPEQGALTRADLEQRLAQPWFDAED
MSHD_JONDD      -----FVCRRFDPI-----SDADSLLAANSDAFSWHPEQGRLTHHDLSMRMKEPWFTPDH
MSHD_BEUC1      -----ERLRTFGGTE----AEEHAWLALNARAFASHPEQGAMTLEDLRVREGETWFDPSL
                                            *  **  *.:*.              *     

MSHD_ACIFD      FLLAEQD------------------------------------------------GRLVG
MSHD_NAKMY      FFLAVTDPG----------------------------------------------DELLA
MSHD_MYCTU      LILAFG------DSPRERPG------------------------------------RLLG
MSHD_MYCTA      LILAFG------DSPRERPG------------------------------------RLLG
MSHD_MYCTF      LILAFG------DSPRERPG------------------------------------RLLG
MSHD_MYCTK      LILAFG------DSPRERPG------------------------------------RLLG
MSHD_MYCBO      LILAFG------DSPRERPG------------------------------------RLLG
MSHD_MYCBP      LILAFG------DSPRERPG------------------------------------RLLG
MSHD_MYCBT      LILAFG------DSPRERPG------------------------------------RLLG
MSHD_MYCLB      LFLAFG------DSSSNQPG------------------------------------KLLG
MSHD_MYCLE      LFLAFG------DSSSNQPG------------------------------------KLLG
MSHD_MYCMM      LFLALEGSEGAEDSPRGQP-------------------------------------RLLG
MSHD_MYCUA      LFLALEGSEGAEDSPSGQP-------------------------------------RLLG
MSHD_MYCA1      LFLAFG------DDDSDRPG------------------------------------RLLG
MSHD_MYCPA      LFLAFG------DDDSDRPG------------------------------------RLLG
MSHD_MYCSK      LFMAFD----------DASG------------------------------------KLLG
MSHD_MYCSS      LFMAFD----------DASG------------------------------------KLLG
MSHD_MYCSJ      LFMAFD----------DASG------------------------------------KLLG
MSHD_MYCS2      LFQAFD----------EQTG------------------------------------SLLG
MSHD_MYCGI      FFLAFD----------EDTG------------------------------------ALLG
MSHD_MYCVP      FFLAFD----------EDSG------------------------------------RLLG
MSHD_MYCA9      LFLAHD----------VQTA------------------------------------KLLG
MSHD_RHOOB      LFMAFATSD---------EK------------------------------------RLLG
MSHD_RHOJR      LFMAFAASD---------DQ------------------------------------RLLG
MSHD_RHOE4      LFMAFADTD---------PD------------------------------------TLLG
MSHD_NOCFA      LFLATDTAA---------PD------------------------------------RVLG
MSHD_GORB4      LFLAFDAAN---------PE------------------------------------RLLG
MSHD_TSUPD      LFLAIGSGSG----SDEADG------------------------------------RLLG
MSHD_SEGRD      IFLARD-----------EQD------------------------------------RLIG
MSHD_PSECP      FLLAVD---------AGG--------------------------------------RVLG
MSHD_ARTS2      FLLAVD---------PSG--------------------------------------RILG
MSHD_PAEAT      FLLAVN---------AEG--------------------------------------ELLG
MSHD_RENSM      FLLAVD---------ETD--------------------------------------QIMG
MSHD_KOCRD      FLLAVS---------EQDPD------------------------------------RVLG
MSHD_ROTMD      FFIASE---------VEDDS------------------------------------AIAA
MSHD_NOCDD      FFLATA---------KDG-G-------------------------------------VAA
MSHD_THEFY      FFVAVD---------RGS-G------------------------------------RIAG
MSHD_CELFN      FLLAE------------RDG------------------------------------QLLG
MSHD_SANKS      FLLAE------------RDG------------------------------------DLVG
MSHD_KRIFD      FFLAV----------DSKTG------------------------------------ALAG
MSHD_XYLCX      FFLA-----------EAPDG------------------------------------TLAG
MSHD_KYTSD      FLLLVD---------DTRDG------------------------------------EVVG
MSHD_CLAM3      LLLA-----------RDADG------------------------------------RLAG
MSHD_CLAMS      LLLA-----------RDADG------------------------------------RLAG
MSHD_MICLC      LLLAA----------READG------------------------------------RLLG
MSHD_KINRD      LLLA------------EAPD------------------------------------GLAA
MSHD_STRRD      FFL------------AERPTGSGDGDVADGGSTDGGPADSGSADGGAGEGGTGDGNRLIG
MSHD_THEBD      FFL------------AERAG------------------------------------TLVG
MSHD_ACIC1      FFL------------AERDG------------------------------------ELVG
MSHD_THECD      LFL------------AERDG------------------------------------RLIG
MSHD_SALAI      FLL------------AVDPAG-----------------------------------HLRG
MSHD_SALTO      FLL------------AVDPAG-----------------------------------QLLG
MSHD_STANL      LLL------------AERDVDG----------------------------------QVLG
MSHD_STRAW      FFL------------AERDG------------------------------------ELIG
MSHD_STRCO      FFL------------AERDG------------------------------------ELIG
MSHD_STRSW      FFL------------AFRGE------------------------------------ELVG
MSHD_STRGG      FFL------------AERDG------------------------------------EIVG
MSHD_STRBB      FFL------------AERGG------------------------------------EIVG
MSHD_ACTMD      FLL-----------AVDGAD------------------------------------RLLG
MSHD_SACEN      FLL-----------AVDSHD------------------------------------TLLG
MSHD_AMYMD      FFL-----------AEE-RG------------------------------------EVIG
MSHD_SACVD      FFL-----------AENAEG------------------------------------RVVG
MSHD_CATAD      FFLAWRG-------AK-----------------------------------------LAG
MSHD_NOCSJ      LLLATSA-------AADGGE------------------------------------QVLG
MSHD_FRAAA      FFV------------AERDG------------------------------------QLVG
MSHD_FRACC      FFL------------AEHDG------------------------------------ALVG
MSHD_FRASN      FFL------------AERNG------------------------------------ALLG
MSHD_GEOOG      FFL------------AWDGD------------------------------------RLLG
MSHD_CORGB      VLFLWDGEE------------------------------------------------IVG
MSHD_CORGL      VLFLWDGEE------------------------------------------------IVG
MSHD_COREF      VLFLWDGDE------------------------------------------------LVG
MSHD_CORDI      VLFLIDTAKR----------T------------------------------------VAG
MSHD_CORA7      VLFLWDSHGGAH-----SAPT------------------------------------MAG
MSHD_CORK4      VLLLWGSEGDQKDGDTDSLPP------------------------------------LLG
MSHD_CORJK      VLMLWVRDENSAAERVGIPCAANGGEGNDDVF------------------------RLVG
MSHD_CORU7      VLMVWSCGED--EDAAGPRCA--------------------------------------G
MSHD_PROFC      LLVARDEAGT-----------------------------------------------LVG
MSHD_BRAFD      MLVALRDE------------------------------------------------TLVG
MSHD_JONDD      LHVVTPVS------------------------------------------------ESAR
MSHD_BEUC1      LWLVHDDG------------------------------------------------DGAL
                .                                                           

MSHD_ACIFD      FCWTKVHAPRSSS--------------ALGEIYVIATDPERAPRGLGSCLLVAGLDYLAH
MSHD_NAKMY      FHWTKVHPAEPAGQ---------NPTGALGEIYVLGVDPAAGIRGLGSVLAERGLQYLAQ
MSHD_MYCTU      FHWTKVHPDH----------------PGLGEVYVLGVDPAAQRRGLGQMLTSIGIVSLAR
MSHD_MYCTA      FHWTKVHPDH----------------PGLGEVYVLGVDPAAQRRGLGQMLTSIGIVSLAR
MSHD_MYCTF      FHWTKVHPDH----------------PGLGEVYVLGVDPAAQRRGLGQMLTSIGIVSLAR
MSHD_MYCTK      FHWTKVHPDH----------------PGLGEVYVLGVDPAAQRRGLGQMLTSIGIVSLAR
MSHD_MYCBO      FHWTKVHPDH----------------PGLGEVYVLGVDPAAQRRGLGQMLTSIGIVSLAR
MSHD_MYCBP      FHWTKVHPDH----------------PGLGEVYVLGVDPAAQRRGLGQMLTSIGIVSLAR
MSHD_MYCBT      FHWTKVHPDH----------------PGLGEVYVLGVDPAAQRRGLGQMLTSIGIVSLAR
MSHD_MYCLB      FHWTKVHAAH----------------PGLGEVYVLGVDPSAQGRGLGQMLTSIGIASLAQ
MSHD_MYCLE      FHWTKVHAAH----------------PGLGEVYVLGVDPSAQGRGLGQMLTSIGIASLAQ
MSHD_MYCMM      FHWTKIHLDD----------------PGLGEVYVLGVDPAAQGRGLGRTLTMIGLRSLAQ
MSHD_MYCUA      FHWTKIHLDD----------------PGLGEVYVLGVDPAAQGRGLGRTLTMIGLRSLTQ
MSHD_MYCA1      FHWTKVHLDQ----------------PGLGEVYVVGVDPCAQGRGLGQALTAVGIEWLAR
MSHD_MYCPA      FHWTKVHLDQ----------------PGLGEVYVVGVDPCAQGRGLGQALTAVGIEWLAR
MSHD_MYCSK      FHWTKVHG------------------PDLGEVYVVGVDPAAQGRGLGATLTLTGLHHLAE
MSHD_MYCSS      FHWTKVHG------------------PDLGEVYVVGVDPAAQGRGLGATLTLTGLHHLAE
MSHD_MYCSJ      FHWTKVHG------------------PDLGEVYVVGVDPAAQGRGLGATLTLTGLHHLAE
MSHD_MYCS2      FHWTKIHD------------------ASLGEVYVVGVDPQAQGRGLGYTLTLIGLHHLAE
MSHD_MYCGI      FHWTKVHS------------------ESLGEVYVVGVDPAAQGRGLGAALTLLGLHHLES
MSHD_MYCVP      FHWTKVHS------------------ATLGEVYVVGVDTAAQGRGLGGALTLIGLHHLAD
MSHD_MYCA9      FHWTKRHLDK----------------PGMGEVYIVGVDPAAQGRGLGHLLTLVGLHHLAG
MSHD_RHOOB      FHWTKVHPKQGDE-------------PAIGEVYVVAIGPDAQGRGLGRLLTLAGLHYLRD
MSHD_RHOJR      FHWTKVHPKQGDE-------------PAIGEVYVVAIGPDAQGRGLGRLLTLAGLHYLRD
MSHD_RHOE4      FHWTKVHAPEGDD-------------PELGEVYVVGIDPAAQGRGLGRVLTLAGMHYLRD
MSHD_NOCFA      FHWTKVHADE--Q-------------PPVGEVYVVGIDPAAQGRGLGRLLTLAGLHHLRE
MSHD_GORB4      FHWTKQHDTE------------------LGEVYIVGVDPAAQGRGLGRLLTLAGLHHLAA
MSHD_TSUPD      FHWTKVADPA----------------TGLGEVYVVAVAPEGQGRGLGRLLTSVGLHYLAD
MSHD_SEGRD      FHWTRTHPQTQTE-------------HKLGEVYVLGVDPACHCKGLGKALTLVGLRHLRD
MSHD_PSECP      FHWTKVHPRH----------GSH---PAIGEVYVVGVAPEAQGSGLGKALTLAGIKYLQD
MSHD_ARTS2      FHWTKVHPGH----------GGH---PAIGEVYVVGVTPEAQGMGLGKALTVAGIKYLQD
MSHD_PAEAT      FHWTKVHPRQ----------GPH---PAIGEVYVVGVTPEAQGLGLGKALTVAGIKHLQD
MSHD_RENSM      FHWTKIHAAP----------AGH---QAIGEVYVVGIAPAAQGKGLGKALTLAGIDYLQK
MSHD_KOCRD      FHWTKVHPGS----------GDS---PALGEVYAVGVDPEQQGSGLGRALTAAGINHLAQ
MSHD_ROTMD      FTWTKIPTGQ----------EQSE-LSPSGEIYVVGVNPQAQGGGLGRTLTLRALAYLAC
MSHD_NOCDD      FHWTKTHADG----------AGLTDGEPVGEVYVVGVDPEWQGSGLGRALTLAGLRHLRD
MSHD_THEFY      FHWTKVHDDG----------AGLTDGEPVGEVYVVGVDPDWQGSGLGRVLTLRGLHHLRD
MSHD_CELFN      SVWTKVHPGSE--------APDGAPGEEVGEIYVVGVDPDAQGLGMGRALTALGLAHLR-
MSHD_SANKS      FCWLKVPADQ----------PQDAP--RVGEIYALGVDPSAQGLRLGTALTAAGLDRLR-
MSHD_KRIFD      FHWTKVEG-------------------DEGEVYVVGVDPSYQGTGLGKALTLHGLHHLQE
MSHD_XYLCX      SLWTKVEG-------------------DDGEIYAVGVDPAHQGRGLGATLTAVGLDHL--
MSHD_KYTSD      FHWTKVDQL------------------PVGEVYVVGVDPERQGEGLGRVATLVGLHHL-A
MSHD_CLAM3      FHWLKVE---------------GGQ----AEVYVLGVDPDRAARGLGSALLAAGLDLL-A
MSHD_CLAMS      FHWLKVD---------------GGQ----AEVYVLGVDPDRAARGLGSALLAAGLDLL-A
MSHD_MICLC      FHWTKVEPD------------AGADGPRVGEVYAVGVSPDAQGLGLGRALTLAGLHRM-A
MSHD_KINRD      FCWMKVEDGL-------------------GELYVLGVDPARSGAGLGRALLVRGLRAV-A
MSHD_STRRD      FHWTKVHGD------------GGHGHEPIGEVYVVGVDPAEQGGGLGRSLTLAGLSHLRA
MSHD_THEBD      FHWTKVHAQ------------AEGADGPIGEVYVVGVDPEERGTGLGRALTLAGLAHLRS
MSHD_ACIC1      FHWTKVHGSPAGQASNG---SSGHGHEPLGEVYILGVDPKAQGLGLGRALTIVGLRYLRS
MSHD_THECD      FHWTKVHPD------------------PIGEVYVVGVDPSAQGLGLGRVLTLIGLHHLRD
MSHD_SALAI      FHWTKVHER--------------PGSPRIGEVYVLGVDPQAHGGGLGKALTAAGLAYLRD
MSHD_SALTO      FHWTKIHER--------------PGSARIGEVYVLGVDPTAHGGGLGKALTAAGLAYLRD
MSHD_STANL      FHWTKVHGS---------------GDSAIGEIYVLGVAPEAQGLKLGAALTTAGLRYLRG
MSHD_STRAW      FHWTKVHAQ-----------------EGIGEVYVLGVRPGAQGGGLGKALTTIGLRHLEA
MSHD_STRCO      FHWTKVHAE-----------------ERLGEVYVLGIRPDTQGGGLGKALTTIGLRHLEG
MSHD_STRSW      FHWTKAHAA-----------------EQLGEVYVVGVRPGAQGGGLGKALTTIGLRHLAA
MSHD_STRGG      FHWTKVHAE-----------------ERLGEVYVVGVLPEAQGGGLGKALTSIGLHHLAA
MSHD_STRBB      FHWTKVHAQ-----------------ERLGEVYVVGVRPEAQGGGLGRSLTAIGLRHLAG
MSHD_ACTMD      FHWTKRHDES------------------MGEVYVVGVDPDAQGGGLGKALTLAGLVHLKS
MSHD_SACEN      FHWTKIHPDG------------------TGEVYVVGVDPDTQGNGLGRSLTVAGLRHLRA
MSHD_AMYMD      FHWTKVHEPTPGR--------FGGE--RVGEVYVVGVDPAAQGGGLGRALTLAGLRYLAS
MSHD_SACVD      FHWTKVHPANPNR--------FGGR--PVGEVYVVGVDPDAQGGGLGKALTLAGLRHLRQ
MSHD_CATAD      FHWTKVHDHSA-Y--------GDGP---VGEVYVVGLDPAEQGHGLGRTLTEVGLRHLHD
MSHD_NOCSJ      FHWTKVHPGDAGA--------GAGPGVEVGEVYVVGIDPAAQGRGLGKVLTLAGLHHLAG
MSHD_FRAAA      FHWTKIHEVDETP-------PPGTRPGPIGEVYVVGVLPGAGGAGLGRALTLIGLRHLQA
MSHD_FRACC      FHWTKVHETDQTP-------PRNAQPGPIGEVYVVGVLPGAGGAGLGRALTLIGLRHLQA
MSHD_FRASN      FHWTKVHPQDPVPEHPAATDQPAGQPGPIGEVYVVGVASAAAGTGLGAALTIVGLRHLRD
MSHD_GEOOG      SHWTKVHP------------PGDEGPEAVGEVYVLGIDPDAQGLGLGRALTDVGLAHLRR
MSHD_CORGB      FHWVKQH--------------SPELQ----EIYVVGLSSAYRGRGLGDPLVRLGLHHMRA
MSHD_CORGL      FHWVKQH--------------SPELQ----EIYVVGLSSAYRGRGLGDPLVRLGLHHMRA
MSHD_COREF      FHWVKKH--------------SDELQ----EIYVVGLAEAYRGKGLGDPLVRLGLRHMVN
MSHD_CORDI      FHWTKRH--------------GDLAEGADGEVYVVGLGSAYRRRGLGDLLIRMGLHHLEY
MSHD_CORA7      FHWLKWH--------------AEDTP-AFGEVYVVGLAEDYRGRGLGGPLLTAGLQRMVE
MSHD_CORK4      FHWTKLAREG-----------DDETGRKVGEVYVIGLARKAQGRGLGRASTAKGIQYLAS
MSHD_CORJK      FHWTKIPLEEK----------EKDAGERTGEVYVVCLADDARGRGLGQAITQLGMKSLLE
MSHD_CORU7      FHWTKIPTEEQ----------EEPEGERAGEVYVVCLADEARGKGLGPAITMLGIGELMK
MSHD_PROFC      FHWTKVA---------------DEDGRPRGEVYVLGVDPDFEGKGVGRALLDAGILHMRE
MSHD_BRAFD      FVWIKREQPG--------------ATDRDAEIYVVATDPSVQGHRVAGHLMATVLERLER
MSHD_JONDD      IVGFVWLKAE--------------PHSRSIELYVLGVTEAAQGQGVGRFLTELATVTALN
MSHD_BEUC1      LASMWLKV----------------PDAATGEIYVLGVDPGAQGRGLGRALTDRALDVLRA
                                              *:* :          :.             

MSHD_ACIFD      HDI----------PTASLYVEDTNERALRLYDRFGFVVDHEDVRLVWRLPAAS-------
MSHD_NAKMY      RGL----------DTALLYVESDNAPAVRLYERLGFTVFQRNVVYRPTNQG---------
MSHD_MYCTU      RLGGRKTLDPAVEPAVLLYVESDNVAAVRTYQSLGFTTYSVDTAYALAGTDN--------
MSHD_MYCTA      RLGGRKTLDPAVEPAVLLYVESDNVAAVRTYQSLGFTTYSVDTAYALAGTDN--------
MSHD_MYCTF      RLGGRKTLDPAVEPAVLLYVESDNVAAVRTYQSLGFTTYSVDTAYALAGTDN--------
MSHD_MYCTK      RLGGRKTLDPAVEPAVLLYVESDNVAAVRTYQSLGFTTYSVDTAYALAGTDN--------
MSHD_MYCBO      RLGGRKTLDPAVEPAVLLYVESDNVAAVRTYQSLGFTTYSVDTAYALAGTDN--------
MSHD_MYCBP      RLGGRKTLDPAVEPAVLLYVESDNVAAVRTYQSLGFTTYSVDTAYALAGTDN--------
MSHD_MYCBT      RLGGRKTLDPAVEPAVLLYVESDNVAAVRTYQSLGFTTYSVDTAYALAGTDN--------
MSHD_MYCLB      RLVG-----PSAEPTVMLYVESDNVAAARTYERLGFTTYSVDTAYALARIDD--------
MSHD_MYCLE      RLVG-----PSAEPTVMLYVESDNVAAARTYERLGFTTYSVDTAYALARIDD--------
MSHD_MYCMM      RLGDR---DLGRESTVMLYVESDNIAAVRTYQGLGFSTHSVDTAYALAAPDAALA-----
MSHD_MYCUA      RLGDR---DLGHESTVMLYVESDNIAAVRTYQGLGFSTHSVDTAYALAAPDAALA-----
MSHD_MYCA1      RLGAG---DSAADPTVMLYVEADNVAAVRTYQRLGFTTYSVDTAYAVPPAAN--------
MSHD_MYCPA      RLGAG---DSAADPTVMLYVEADNVAAVRTYQRLGFTTYSVDTAYAVPPAAN--------
MSHD_MYCSK      RLSNS------PQPTVMLYVEADNGAAVKTYRRLGFDVSSVDAAYAAVAD----------
MSHD_MYCSS      RLSNS------PQPTVMLYVEADNGAAVKTYRRLGFDVSSVDAAYAAVAD----------
MSHD_MYCSJ      RLSNS------PQPTVMLYVEADNGAAVKTYRRLGFDVSSVDAAYAAVAD----------
MSHD_MYCS2      KLAG-------PEPTVLLYVEADNSAAVNTYRKLGFEVFSVDAAYAAN------------
MSHD_MYCGI      RLTGDG-----RVADVMLYVEADNTAAVKTYRRLGFDIVNTDVAYAAVAPTDV-------
MSHD_MYCVP      RLLSSG-----HDADVMLYVEADNTAAVKTYRRLGFEVVNTDVAYAVEG-----------
MSHD_MYCA9      LGLE----------TVLLYVESDNQAALRTYERLGFAVALTDAAYGRA------------
MSHD_RHOOB      RGLG----------AVLLYVEGDNASALHTYDRLGFERFHTDVAYARA------------
MSHD_RHOJR      RGLG----------AVLLYVEGDNESALHTYDRLGFERFHTDVAYARA------------
MSHD_RHOE4      RGLG----------TVLLYVEGDNTAALHTYERLGFDRFHVDMAYARAL-----------
MSHD_NOCFA      RGLG----------GVLLYTEADNTAAVNTYTKLGFAPAHVDVAYAANGA----------
MSHD_GORB4      TGRS----------EVNLYVEGDNTAALHTYERLGFGRYAIDVAYGRPEGD---------
MSHD_TSUPD      RKLD----------TVELYVEGDNAAALHTYTKLGFSEHERHVAYAHS------------
MSHD_SEGRD      QGLA----------QAKLYVEQTNAPALATYRGLGFTVHAQDVAYVRG------------
MSHD_PSECP      LG----------LHAVMLYTDADNTPAVSLYRRLGFTRWDMDVMYGPVKEG---------
MSHD_ARTS2      KG----------LHAVVLYTDADNTPAVSLYRRLGFTRWDADVMYGPKNGG---------
MSHD_PAEAT      QG----------LHAVMLYVDADNEAAVALYQKLGFVRWDTDVMYGPLTKN---------
MSHD_RENSM      KG----------LSSIMLYVDADNTAAVSLYQSLGFARWDADTMYSYPSATNSNNKFQ--
MSHD_KOCRD      EG----------LCEVMLYVDADNSAAMALYESLGFERWHVDVMYRS-------------
MSHD_ROTMD      AEDENGE----PLRAIDLYVDADNTAAYSLYTSLGFGVATVDRMYAPAQQDEPAA-----
MSHD_NOCDD      AG----------LPWVHLYVDGDNEAAVRLYESLGFAMWDTDVMYAPPRDDAPRPNV---
MSHD_THEFY      RG----------LPWVLLYVDEENRPAVQLYRSLGFELWESDVMYGRVPEER--------
MSHD_CELFN      DRG---------LRTVILYTGAENTVAVHTYRRAGFARTAVDVMYGPPPAGSPAHGTPLV
MSHD_SANKS      EVG---------VEVVELYTEGDNTVAIRTYTAAGFTRATVDVQMARP------------
MSHD_KRIFD      VRG---------LPAVTLYVDGTNTAARALYEKLGFTTAALDVQYAPATV----------
MSHD_XYLCX      ATR---------ARRATLYVDGDNAAALATYARAGFVPTAVDVQYGKATGGTPVPRALPS
MSHD_KYTSD      DRG---------VETVELYVDGDNRAAVTTYGRLGFERAAVDVQYGPPV-----------
MSHD_CLAM3      ARG---------LDEVDLYVEADNAPALALYRRAAFRDAAVDVQYRRA------------
MSHD_CLAMS      ERG---------HDEVDLYVEADNTPALALYRRAAFRDAAVDVQYRRA------------
MSHD_MICLC      EQG---------VDVVDLYVDADNTAAVALYTSLGFELFAADAQYRRP------------
MSHD_KINRD      GR----------VDRVDLYVDGDNLRAVRLYAGLGFSRAATDVQYASGPR----------
MSHD_STRRD      -RG---------LAQVMLYVDESNTAAIRLYEKLGFTRWDVDVMYRK-------------
MSHD_THEBD      -RG---------LDQVMLYVDEANTAAVRLYESLGFTRWTVDVMYRR-------------
MSHD_ACIC1      -RR---------LPHVMLYVDATNAPAIRLYESLGFRHWGTDVLFERGGTANGEGTS---
MSHD_THECD      -RG---------LPAVMLYVDESNRPALRLYESLGFTRYAVDVMYQSPPPH---------
MSHD_SALAI      RRG---------LDRVMLYVDESNTAAVALYERLGFARWSAHVNYQRS------------
MSHD_SALTO      QRG---------LDRVMLYVDESNTAAVALYERLGFARWSAHVNYQLG------------
MSHD_STANL      -RG---------LDTVMLYVDESNVRAVRLYTGAGFTRWTTDVNYHKKL-----------
MSHD_STRAW      -QG---------LPTAMLYVDADNKAAVSVYERLGFATHETDLMYRTES-----------
MSHD_STRCO      -QG---------LPTAMLYVDADNKAAVAVYERLGFVTHETDLMYRTET-----------
MSHD_STRSW      -QG---------LPTAMLYVDADNKAAVTVYERLGFVTYETDLMYRSET-----------
MSHD_STRGG      -EA---------LPTAMLYVDADNTAAVTVYERMGFTTHEVDLMYRTES-----------
MSHD_STRBB      -RG---------LPTAMLYVDADNFPAVAVYGRQGFTTYETDLMYRTET-----------
MSHD_ACTMD      -TG---------LRDVHLYVESDNSPAVRVYTRLGFSRWKADVQYAL-------------
MSHD_SACEN      -KG---------CAQVMLYVEADNTAAIKVYQRLEFARWDTDVQFGR-------------
MSHD_AMYMD      -RG---------LRQIILYVEGDNAAALAVYTKLGFTRHETDVQYGR-------------
MSHD_SACVD      -RG---------LEQVILYVEGDNAPAIAVYRKLGFETVETDVQYAQGS-----------
MSHD_CATAD      -RG---------LGEVILYVEADNTPAVAVYTKLGFTRRSADVMYQL-------------
MSHD_NOCSJ      -RG---------VPEVLLYVESDNRPAIAVYAGLGFTHADDDTHVQYRR-----------
MSHD_FRAAA      -EG---------LAAVLLYVDEDNERAVRMYTGLDFTVHTRDVSYHWRGAAAD-------
MSHD_FRACC      -EG---------LDSVLLYVDEDNVRAVRMYTGLGFITYVRDVSYHWERPSTG-------
MSHD_FRASN      -IG---------LASVMLYVDEDNARAVRLYTRLGFRRHAADVSY--RRPARG-------
MSHD_GEOOG      -LG---------LRQVLLYVEEDNTAAVTLYERSGFTRHAVDVSWRRAR-----------
MSHD_CORGB      HGA----------RKVILYVEADNTPAVAAYEKLGFTVAESHVVYEK-------------
MSHD_CORGL      HGA----------RKVILYVEAGNTPAVAAYEKLGFTVAESHVVYEK-------------
MSHD_COREF      GGA----------RRVILYVEADNDSAVAAYEKLGFTVAERHVVYEK-------------
MSHD_CORDI      EHA----------RRVILYVEGDNESARRAYDALGFHVVESHVTYSPQSSS---------
MSHD_CORA7      KGA----------DKVILYVEADNDPAVKAYERLGFSIAEEHCVWAKSD-----------
MSHD_CORK4      NDA----------AYVELYVEADNAPAVHAYEALGFTVVERHTAWKF-------------
MSHD_CORJK      NGC----------GRIELYVEGDNAPAVSTYKRLGFEVVHTDVVYRGRL-----------
MSHD_CORU7      RGV----------GTVELYVEGDNGPAVATYEGLGFGIVHTDVVYRGELN----------
MSHD_PROFC      LGV----------EAIDLYVEGANERVVHMYERAGFSVVSTDVGYAPAKPARHQDHGRQS
MSHD_BRAFD      DGV----------PGVELYVEADNAPALRLYENWGFEVSGRDVQLRATERG---------
MSHD_JONDD      QGY----------PRLHLYVEADNTRALALYTQHGFAPMERHVNFTQPTGELGHEPPS--
MSHD_BEUC1      RGV----------DRVELYVEGENARARALYEHSGFTPVAVHAQYGIP------------
                                 **.   *  .   *    *     .                  

MSHD_ACIFD      ----------------
MSHD_NAKMY      ----------------
MSHD_MYCTU      ----------------
MSHD_MYCTA      ----------------
MSHD_MYCTF      ----------------
MSHD_MYCTK      ----------------
MSHD_MYCBO      ----------------
MSHD_MYCBP      ----------------
MSHD_MYCBT      ----------------
MSHD_MYCLB      ----------------
MSHD_MYCLE      ----------------
MSHD_MYCMM      ----------------
MSHD_MYCUA      ----------------
MSHD_MYCA1      ----------------
MSHD_MYCPA      ----------------
MSHD_MYCSK      ----------------
MSHD_MYCSS      ----------------
MSHD_MYCSJ      ----------------
MSHD_MYCS2      ----------------
MSHD_MYCGI      ----------------
MSHD_MYCVP      ----------------
MSHD_MYCA9      ----------------
MSHD_RHOOB      ----------------
MSHD_RHOJR      ----------------
MSHD_RHOE4      ----------------
MSHD_NOCFA      ----------------
MSHD_GORB4      ----------------
MSHD_TSUPD      ----------------
MSHD_SEGRD      ----------------
MSHD_PSECP      ----------------
MSHD_ARTS2      ----------------
MSHD_PAEAT      ----------------
MSHD_RENSM      ----------------
MSHD_KOCRD      ----------------
MSHD_ROTMD      ----------------
MSHD_NOCDD      ----------------
MSHD_THEFY      ----------------
MSHD_CELFN      RVTDTPSSPGDATMGS
MSHD_SANKS      ---------SDATA--
MSHD_KRIFD      ----------------
MSHD_XYLCX      R---------------
MSHD_KYTSD      ----------------
MSHD_CLAM3      ----------------
MSHD_CLAMS      ----------------
MSHD_MICLC      ----------------
MSHD_KINRD      ----------------
MSHD_STRRD      ----------------
MSHD_THEBD      ----------------
MSHD_ACIC1      ----------------
MSHD_THECD      ----------------
MSHD_SALAI      ----------------
MSHD_SALTO      ----------------
MSHD_STANL      ----------------
MSHD_STRAW      ----------------
MSHD_STRCO      ----------------
MSHD_STRSW      ----------------
MSHD_STRGG      ----------------
MSHD_STRBB      ----------------
MSHD_ACTMD      ----------------
MSHD_SACEN      ----------------
MSHD_AMYMD      ----------------
MSHD_SACVD      ----------------
MSHD_CATAD      ----------------
MSHD_NOCSJ      ----------------
MSHD_FRAAA      ----------------
MSHD_FRACC      ----------------
MSHD_FRASN      ----------------
MSHD_GEOOG      ----------------
MSHD_CORGB      ----------------
MSHD_CORGL      ----------------
MSHD_COREF      ----------------
MSHD_CORDI      ----------------
MSHD_CORA7      ----------------
MSHD_CORK4      ----------------
MSHD_CORJK      ----------------
MSHD_CORU7      ----------------
MSHD_PROFC      SPQERDA---------
MSHD_BRAFD      ----------------
MSHD_JONDD      ----------------
MSHD_BEUC1      ----------------